Lanugo pada bayi baru lahir

lanugo pada bayi baru lahir

none Penting untuk dibaca! Usia kehamilan adalah rentang waktu usia janin dimulai dari awal pembuahan hingga bayi dilahirkan. Secara sederhana usia kehamilan bisa diperkirakan dengan cara mengetahui hari pertama haid terakhir (HPHT). Perhitungan HPHT menggunakan asumsi bahwa pembuahan terjadi pada hari ke 14 dari siklus mentruasi. Asumsi ini mengakibatkan metode ini mempunyai tingkat kesalahan plus minus 2 minggu.

Setelah dinyatakan hamil, banyak ibu yang mulai bertanya-tanya tentang bagaimana cara mengetahui umur kehamilan. Secara normal, usia bayi di dalam kandungan adalah mencapai 38-40 minggu. Meskipun demikian, bayi sudah mulai siap dilahirkan sejak usia 37 minggu. Untuk mengetahui berapa usia kandungan sekarang, ibu dapat menghitungnya melalui kalkulator kehamilan online pada halaman ini. Dasar penghitungannya menggunakan HPHT atau Hari Pertama Haid Terakhir.

Oleh karena itu, Ibu perlu tahu kapan tanggal menstruasi sebelumnya dengan rutin mencatat periode haid dan siklusnya setiap bulan. Nutrisi Makanan Ibu Hamil Ibu hamil membutuhkan nutrisi yang baik agar bayi dapat berkembang dengan optimal. Bahkan sejak berencana hamil, ibu perlu mendapatkan asupan asam folat yang cukup agar ketika mengandung, janin terhindar dari risiko cacat tabung saraf. Beberapa nutrisi makanan yang dibutuhkan oleh ibu hamil antara lain protein, karbohidrat, serat, lemak, folat, zat besi, vitamin D, kalsium, kolin, zinc, dan kalium.

Ibu bisa mendapatkan berbagai nutrisi tersebut dari makanan bergizi seimbang. Selain itu, ibu juga dapat mengonsumsi vitamin prenatal dan susu khusus untuk ibu hamil. Prenagen Esensis hadir untuk menutrisi kebutuhan ibu lanugo pada bayi baru lahir sedang merencanakan kehamilan.

Dengan kandungan protein, asam folat, dan zinc mampu mendukung kesehatan reproduksi calon ibu. Sedangkan Prenagen Mommy hadir dengan kandungan protein, asam folat, zinc, DHA & omega 3, serta zat besi yang mampu mencukupi gizi ibu dan calon bayi. Perkembangan Janin Tiap Trimester Letak janin pada kehamilan normal adalah di dalam rahim.

Ia akan tumbuh dan berkembang sesuai dengan usianya. Lantas bagaimana perkembangan janin tiap trimesternya? Berikut ulasannya, Bu. Trimester 1 Pada usia kehamilan mulai 4 minggu atau 1 bulan, janin sudah ada di dalam rahim. Meskipun demikian, ibu belum bisa merabanya karena ukurannya masih kecil. Ia masih berbentuk embrio yang akan terus berkembang seiring dengan pertambahan usia.

Di usia ini, ukuran embrio berkisar 0,2 hingga 0,5 centimeter. Perkembangan organ dimulai dari otak, jantung, paru, dan sumsum tulang belakang. Seluruh organ tubuhnya baru akan berkembang sempurna di usia 8 minggu.

Hingga akhir trimester pertama kehamilan, umumnya janin berukuran 30 gram dengan panjang 2,5 centimeter. Beberapa ibu akan merasakan kram perut serta nyeri payudara di awal kehamilan. Tubuh ibu juga terasa lemas dan mudah lelah. Tak jarang pula ibu merasakan morning sickness yang parah mulai usia kehamilan 4 minggu hingga 16 minggu.

Trimester 2 Memasuki trimester kedua, janin mengalami perkembangan yang cukup pesat. Ia mulai dapat menelan air ketuban serta mendengar suara di dalam rahim. Terdapat juga bulu-bulu halus atau lanugo yang tumbuh di seluruh tubuhnya.

Jika di awal kehamilan janin masih berbentuk embrio, berbeda dengan trimester kedua ini. Ibu mulai dapat merasakan tendangan janin pada saat memasuki usia 16 hingga 20 minggu. Berat badan janin pun mencapai 1 kilogram dengan panjang kurang lebih 10 centimeter. Hal yang dirasakan oleh ibu di trimester kedua kehamilan antara lain rasa lelah dan pegal, mudah pusing, mulai muncul stretchmark di perut dan paha, serta puting yang menggelap.

Sebagian besar ibu juga sudah tidak lagi merasakan mual dan muntah di trimester kedua kehamilan. Trimester 3 Di akhir kehamilan, janin sudah memiliki kerangka dan tulang yang sempurna. Lanugo pada bayi baru lahir masih di dalam perut, kini ia telah menyerupai bayi yang sudah lahir, Bu! Ia sudah dapat membuka mata, mendengar dengan lebih jelas, dan menelan. Bahkan ia sudah dapat merasakan cegukan. Ia juga sudah dapat mengubah posisi kepalanya dari atas ke bawah dan sebaliknya.

Hingga saat bersalin, umumnya kepala bayi sudah berada di bawah dengan posisi siap dilahirkan. Berat badan ideal janin di trimester 3 kehamilan adalah mencapai 2,5 kilogram dengan panjang 49 centimeter. Tak perlu khawatir jika ibu kerap merasakan kontraksi palsu, sakit punggung, dan sering buang air.

Ini merupakan hal yang wajar terjadi pada ibu hamil di trimester akhir. Meskipun demikian, ibu perlu waspada jika merasakan kontraksi hebat, ketuban rembes, atau bengkak di seluruh tubuh.

Segera cari pertolongan ya, Bu! Mengetahui usia kehamilan sangat penting untuk ibu hamil guna memastikan kondisi janin dan ibu sesuai dengan usianya. Untuk itulah, ibu dapat menggunakan kalkulator usia kehamilan sebagai aplikasi yang membantu untuk mengetahui umur bayi di dalam kandungan.
Perubahan yang ibu rasakan saat hamil trimester 2 Kehamilan trimester 2 mulai dari usia 14-27 minggu.

Pada masa ini, sebagian besar gejala hamil muda sudah mereda dan energi mulai terkumpul kembali untuk beraktivitas seperti biasa. Namun, ada beberapa perubahan lain yang terjadi dan ibu hamil rasakan saat trimester 2, yaitu: • perut semakin membesar, • berat badan naik sekitar 1,5-2 kilogram setiap bulan, • nafsu makan mulai membaik, • perubahan warna kulit (bercak hitam di wajah atau garis gelap dari pusar sampai kemaluan), • rambut lebih tebal, • kaki kram terutama saat tidur, • merasakan payudara nyeri dan membesar, • nyeri punggung, dan • muncul lanugo pada bayi baru lahir mark.

Mengutip dari British Columbiastretch mark adalah fenomena alami yang umumnya akan memudar bahkan hilang total setelah hamil.

Namun, tidak semua wanita hamil akan langsung mengalaminya saat memasuki atau sepanjang trimester 2. Belum ada pula cara yang terbukti ampuh untuk mencegah kemunculan gurat-gurat putih pengganggu penampilan pada trimester 2 ini.

Namun, menjaga kenaikan berat badan saat hamil agar tidak sampai berlebihan dapat mengurangi keparahan stretch mark. Perkembangan janin saat hamil trimester 2 Semakin besar perut ibu, semakin banyak pula perubahan yang terjadi pada janin di dalam rahim.

S epanjang trimester kedua, paru-paru, jantung, dan sistem peredaran darah janin mulai berkembang. Berikut ini adalah penjelasan yang lebih rinci tentang perkembangan janin pada trimester 2. Usia kandungan 4 bulan (14-17 minggu) Calon orangtua sudah bisa tahu apa jenis kelamin calon bayi pada trimester 2. Wajah janin dan rambut di kepalanya juga sudah mulai tampak jelas pada pemeriksaan USG.

Janin sudah mulai bisa mendengar suara dari luar saat ibu hamil 4 bulan. Selain itu, ari-ari atau plasenta juga sudah selesai terbentuk. Janin juga mulai menerima “sumbangan” antibodi dari tubuh ibu untuk menguatkan sistem imunnya sendiri saat melawan bakteri dari tubuh ibu. Usia kandungan 5 bulan (18-22 minggu) Bulan kelima pada kehamilan trimester 2, alis dan bulu mata janin sudah mulai muncul. Rambut berbulu halus (lanugo) juga akan muncul di seluruh tubuh janin dan bertahan sampai setelah lahir.

Kulit janin masih tipis dan berkilau karena tertutupi lapisan pelindung berwarna krem bernama vernix. Vernix terbuat dari kelenjar minyak tubuh janin.

Selain itu, kaki bayi sudah mulai bisa bergerak dengan baik dan bakal gigi sudah mulai terbentuk saat fase kehamilan 5 bulan. Usia kandungan 6 bulan (23-27 minggu) Pada fase trimester kedua, sistem pernapasan bayi sudah mulai bekerja karena paru-parunya sudah memproduksi zat yang disebut surfaktan. Fungsi surfaktan adalah untuk membantu paru-paru janin berkembang secara normal setelah lahir nanti.

Mata janin usia kandungan 6 bulan kemungkinan sudah dapat terbuka dan menutup sendiri. Untuk kehamilan anak pertama, gerakan janin bisa ibu rasakan mulai usia kehamilan 20 minggu.

Sementara itu, kehamilan anak kedua dan selanjutnya, gerakan janin ibu rasakan saat hamil 18 minggu. Kondisi buruk yang bisa terjadi saat hamil trimester 2 Kehamilan pada umumnya adalah kondisi yang riskan, walau trimester 2 merupakan masa kehamilan yang paling nyaman.

Meski begitu, tetap ada berbagai risiko dan tanda bahaya yang muncul di trimester ini dan perlu ibu waspadai. Berikut beberapa kondisi buruk yang bisa terjadi. 1. Perdarahan vagina Perdarahan saat hamil trimester pertama adalah hal wajar. Mengutip dari American College of Obstetrician and Gynecologists ( ACOG ) perdarahan hamil muda terjadi pada 15-25 persen wanita.

Namun bila perdarahan ini terjadi di trimester kedua kehamilan (sebelum usia 20 minggu), bisa menjadi tanda keguguran. Keguguran sebelum usia kehamilan 20 minggu, dapat terjadi karena beberapa faktor berbeda, seperti: • faktor ibu (septum uterus, kondisi rahim terbagi dua bagian terpisah), • inkompetensi serviks (leher rahim terbuka terlalu cepat dan memicu kelahiran dini) • faktor ayah (kelainan kromosom) • penyakit autoimun (lupus), • faktor janin.

Perdarahan pada trimester 2 juga dapat terjadi akibat kondisi: • plasenta previa, • solusio plasenta, dan • persalinan dini. Masalah-masalah ini memang lebih sering terjadi pada trimester ketiga, tetapi juga dapat terjadi pada akhir trimester kedua.

2. Ketuban pecah dini Ketuban akan pecah ketika saatnya melahirkan, tetapi kalau pecah saat trimester 2, itu adalah ketuban pecah dini ( KPD ) dan bisa menyebabkan masalah serius. Saat ibu hamil mengalami ini, bayi harus segera dokter keluarkan karena bayi tidak lagi memiliki perlindungan terhadap infeksi. Kantung ketuban yang pecah pada trimester 2 dapat menjadi penyebab bayi lahir prematur. Bayi yang lahir pusia 24-28 minggu kehamilan berisiko paling tinggi mengalami masalah medis jangka panjang yang serius, terutama penyakit paru-paru.

Penyebab ketuban pecah dini adalah melemahnya selaput kontraksi karena infeksi pada rahim. 3. Preeklampsia Preeklampsia adalah masalah tekanan darah tinggi yang terjadi ketika kandungan memasuki usia kehamilan 20 minggu. Tekanan darah tinggi preeklampsia yaitu ketika angka tensi mencapai 140/90 bahkan lebih saat hamil. Seorang ibu hamil dapat mengalami preeklampsia meski tidak pernah memiliki riwayat hipertensi sebelumnya. Pada kehamilan pertama, preeklamsia lebih mungkin terjadi selama trimester ketiga.

Namun, beberapa ibu hamil mengalami preeklampsia sejak trimester kedua. Pemeriksaan kehamilan selama hamil trimester 2 Saat fase trimester kedua, ibu hamil sudah bisa mengetahui jenis kelamin dan wujud janin lewat USG. Pemeriksaan USG ini bisa ibu lakukan pada kehamilan usia 18 hingga 20 minggu.

Pemeriksaan ini bisa membantu mendeteksi kelainan bawaan janin yang biasanya terlihat pada usia kehamilan 18-24 minggu. Pada trimester 2 kehamilan, dokter akan melakukan beberapa pemeriksaan kehamilan berikut ini: • mengukur tekanan darah, • memeriksa berat badan, • skrining diabetes gestasional dengan tes darah, • tes cacat lahir dan tes genetik lainnya, seperti tes amniocentesis.

Pemeriksaan USG pada trimester 2 juga bertujuan untuk memeriksa pertumbuhan, posisi bayi, dan memberikan tanggal perkiraan lahir. Ibu juga kemungkinan sudah bisa merasakan gerakan janin dalam perut. Gerakan janin umumnya tidak akan terlalu terasa dan hanya sebentar saja. Perubahan gairah seksual ibu saat hamil trimester 2 Saat kehamilan trimester pertama, mungkin kebanyakan ibu hamil mengalami penurunan gairah seksual.

Namun, gairah seksual ibu hamil akan meningkat pada akhir trimester pertama dan memasuki trimester kedua. Rasa mual dan kelelahan yang biasanya terjadi di trimester pertama sudah mereda. Peningkatan gairah seksual terjadi karena pengaruh peningkatan hormon estrogen.

Hormon ini meningkatkan aliran darah di daerah organ intim dan menyebabkan area tersebut lebih sensitif, sehingga rangsangan seksual juga bertambah besar. Cairan vagina juga meningkat saat trimester 2 kehamilan. Ini yang membuat vagina lebih siap menerima penetrasi. Perubahan payudara yang lebih berkembang dan lebih sensitif juga menjadi alasan meningkatnya keinginan seksual ibu hamil.

Ada beberapa posisi seks yang bisa dilakukan saat kehamilan trimester kedua, yaitu: • duduk di pangkuan pasangan, • merangkak ( doggy style ), dan • tidur menyamping. Ibu bisa berbaring memunggungi pasangan, sehingga bisa melakukan penetrasi dari belakang sambil memeluk mesra. Setelah memasuki 20 minggu kehamilan, hindari posisi yang membuat Anda berbaring telentang, seperti posisi misionaris. Ketika berbaring telentang, rahim yang membesar akan menekan aorta, yang berfungsi mengalirkan darah ke plasenta.

Kondisi ini bisa mengganggu pertumbuhan janin. Pasangan juga perlu menghindari meniupkan udara ke daerah genital. Meniup udara ke dalam vagina bisa menyebabkan emboli udara (gelembung udara yang masuk ke dalam sirkulasi darah). Hal ini jarang terjadi, tetapi bisa mengancam jiwa ibu hamil atau bayi. Sementara untuk oral seks selama kehamilan bisa dibilang aman. Nutrisi yang wajib terpenuhi saat hamil trimester 2 Berbagai asupan nutrisi yang harus Anda penuhi pada masa trimester satu tetap wajib dipenuhi juga selama trimester 2.

Berikut nutrisi tambahan lainnya yang juga penting untuk perkembangan janin pada fase kehamilan trimester 2. 1. Vitamin D Vitamin D ibu butuhkan untuk membantu membangun tulang dan gigi janin yang sedang berkembang. Asupan vitamin D selama kehamilan trimester kedua adalah 2000-4000 IU per hari.

Ibu hamil juga bisa mendapatkan tambahan vitamin D dari makanan untuk ibu hamil berikut ini: • ikan salmon, • keju, • kuning telur, • suplemen hamil yang mengandung vitamin D. Mengutip dari situs resmi WHOmengonsumsi suplemen vitamin D selama kehamilan bisa mengurangi risiko preeklampsia, bayi berat badan lahir rendah ( BBLR), dan kelahiran prematur.

2. Asam lemak omega-3 Ibu hamil disarankan mengonsumsi makanan yang mengandung asam lemak esensil omega-3 selama masa kehamilan, termasuk trimester 2. Asam lemak omega-3 berfungsi mendukung perkembangan jantung, otak, mata, sistem kekebalan tubuh, dan sistem saraf pusat janin dalam kandungan. Ibu hamil bisa mendapatkan asam lemak omega-3 dari makanan berikut: • ikan berlemak (kembung dan salmon), • biji-bijian, • telur, • minyak canola, dan • buah alpukat Asam lemak omega-3 juga dapat mencegah persalinan prematur, menurunkan risiko preeklampsia, dan mengurangi kemungkinan depresi pascapersalinan.

3. Air Ibu hamil butuh asupan cairan lebih banyak, tak terkecuali saat kehamilan trimester 2 ini. Air yang ibu konsumsi dapat membantu terbentuknya plasenta dan kantong ketuban dalam rahim.

Mengalami dehidrasi saat hamil pada trimester 2 dapat menyebabkan janin mengalami cacat tabung saraf, seperti anencephaly dan penurunan produksi ASI. Ibu yang sedang hamil harus minum setidaknya 8 hingga 12 gelas air sehari untuk mencegah dehidrasi dan komplikasinya. 4. Folat Kebutuhan asam folat masih perlu ibu penuhi selama lanugo pada bayi baru lahir kedua.

Kebutuhan folat selama trimester kedua adalah sebesar 600 mikrogram per hari. Pemenuhan kebutuhan folat ini penting untuk mengurangi risiko bayi cacat lahirseperti spina bifida.

Ibu bisa mendapatkan folat dari berbagai makanan, seperti sayuran hijau, jeruk, ayam, ikan kerang, dan kacang-kacangan. 5. Kalsium Kebutuhan kalsium ibu hamil saat trimester 2 adalah 1200 mg. Ibu bisa memenuhi kebutuhan ini dengan mengonsumsi: • susu, • keju, • yohurt, • sayuran hijau (seperti brokoli, bayam), • ikan bertulang (seperti sarden dan ikan teri), • kacang kedelai dan produknya, • telur.

Perkembangan janin pada fase ini masuk pada pembentukan tulang dan juga pemadatan tulang dalam tubuh bayi. Ini membuat kebutuhan kalsium ibu hamil cukup tinggi dan penting untuk dipenuhi. 6. Zat besi Kebutuhan zat besi ibu hamil makin tinggi mendekati waktu persalinan. Zat besi berperan untuk mendukung pembentukan sel darah merah yang makin meningkat.

Selama hamil trimester dua, kebutuhan zat besi ibu hamil adalah 35 miligram. Ibu bisa memenuhi kebutuhan zat besi ini dari: • daging merah, • sayuran hijau, • kuning telur, dan • kacang-kacangan. Beberapa ibu hamil mungkin membutuhkan suplemen zat besi bila mengalami anemia defisiensi zat besi ( ADB). 7. Seng Sama seperti zat besi, kebutuhan seng makin meningkat selama trimester kedua dan ketiga kehamilan.

Kebutuhan zat gizi seng pada trimester kedua adalah sebesar 14 miligram. Kebutuhan seng yang tidak terpenuhi dapat meningkatkan risiko bayi cacat lahir, keterbatasan pertumbuhan bayi, dan kelahiran prematur. Untuk itu, Anda perlu memenuhi kebutuhan seng ini dari berbagai makanan, seperti daging merah, seafood, sayuran hijau, dan kacang-kacangan.

Hal yang perlu ibu lakukan saat hamil trimester 2 Menjaga kesehatan perlu dilakukan calon ibu sepanjang kehamilan, termasuk pada trimester 2. Berikut ini ada beberapa tips yang dapat ibu hamil ikuti selama trimester kedua. Olahraga Kehamilan bukan jadi alasan untuk tidak berolahraga dan menggerakan badan secara aktif. Olahraga adalah cara yang sehat dan mudah untuk menghindari risiko resistensi insulin pada ibu hamil.

Resistensi insulin dapat menyebabkan diabetes gestasional yang ditandai dengan kadar gula darah tinggi selama hamil. Namun, selalu pastikan pada dokter kandungan Anda mengenai olahraga yang cocok saat hamil. Pasalnya pada trimester 2, perut ibu hamil sudah membesar sehingga perlu berhati-hati dalam memilih jenis olahraga.

Mengonsumsi suplemen tambahan Bila kebutuhan zat besi, zinc (seng), atau kalsium sangat tinggi, kemungkinan dokter akan merekomendasikan suplemen tambahan. Pada beberapa kondisi, vitamin yang didapatkan dari makanan saja tidak cukup, sehingga perlu mendapatkan tambahan. Minum suplemen tambahan secara teratur sesuai anjuran dokter agar nutrisi ibu dan janin tetap terjaga di trimester 2 kehamilan.

staff, f. (2009). Changes in Your Body During Pregnancy: Second Trimester. Retrieved 26 October 2020, from https://familydoctor.org/changes-in-your-body-during-pregnancy-second-trimester/ Bleeding During Pregnancy. (2020). Retrieved 26 October 2020, from https://www.acog.org/womens-health/faqs/bleeding-during-pregnancy 2nd trimester pregnancy: What to expect.

(2020). Retrieved 26 October 2020, from https://www.mayoclinic.org/healthy-lifestyle/pregnancy-week-by-week/in-depth/pregnancy/art-20047732 Fetal development: What happens during the 2nd trimester?. (2020). Retrieved 26 October 2020, from https://www.mayoclinic.org/healthy-lifestyle/pregnancy-week-by-week/in-depth/fetal-development/art-20046151?pg=2 The second trimester is a time of rapid growth for your baby.

- Healthy Families BC. (2018). Retrieved 26 October 2020, from https://www.healthyfamiliesbc.ca/home/articles/babies-development-during-second-trimester Common physical changes during the second trimester of pregnancy - Healthy Families BC.

(2013). Retrieved 26 October 2020, from https://www.healthyfamiliesbc.ca/home/articles/mothers-physical-changes-during-second-trimester Stages of pregnancy - womenshealth.gov. (2016). Retrieved 26 October 2020, from https://www.womenshealth.gov/pregnancy/youre-pregnant-now-what/stages-pregnancy SOAL MATERNITAS 1. Seorang perempuan 23 th datang ke BPM ingin memeriksakan diri dengan keluhan tidak mendapat haid selama 3 bulan, merasakan nyeri payudara, mudah lelah dan sering mual di pagi hari.

Dari hasil pemeriksaan didapatkan TTV dalam batas normal, dari pemeriksaan palpasi didapatkan balotmen positif, dan hasil tes urin menunjukan indicator kehamilan positif. Berdasarkan data diatas yang merupakan tanda kemungkinan hamil adalah a.

Telat haid b. Nyeri payudara c. Mudah lelah d. Sering mual di pagi hari e. Balotmen positif 2. Seorang perempuan datang ke BPM mengatakan merasa hamil dan ingin memeriksakan diri. Perawat melakukan pemeriksaan diperoleh hasil TTV normal, tes urin positif.

Untuk mendapatkan data penunjang tambahan dilakukan pemeriksaan dalam dan teraba perlunakan daerah istmus sehingga uterus mudah difleksikan.

Tanda kehamilan yang diperoleh perawat melalui pemeriksaan dalam pada perempuan diatas disebut a. Tanda Piskacek b. Tanda Hegar c. Tanda Goodlls d. Tanda Chadwick e. Tanda Mc Donald 3. Seorang perempuan berusia 27 th datang ke BPM mengatakan sedang hamil dan ingin memeriksakan kehamilannya, perempuan tersebut lupa berapa umur pasti kehamilannya, dari hasil pemeriksaan diperoleh TTV normal, hasil Leopold didapatkan TFU 28 cm dan DJJ 130 x/mnt.

Berapa nilai estimasi kemungkinan usia kehamilan perempuan tersebut a. 20 minggu b. 24 minggu c. 26 minggu d. 36 minggu e. 40 minggu 4. Seorang perempuan 21 tahun datang ke BPM dan mengatakan merasa hamil 3 bulan ingin memeriksakan diri, dari hasil pemeriksaan didapatkan hasil tes urine positif, TFU pertengahan simpisis dan pusat, DJJ 126 x/mnt, dari hasil USG didapatkan tampak kerakan janin dan tempat imlantasi plasenta.

Tanda kemungkinan hamil yang dapat digunakan lanugo pada bayi baru lahir menegakan diagnose kehamilan kasus di atas adalah a. Hasi tes urine positif b. Teraba TFU c. Terdengar DJJ 126 x/mnt d. Tampak gerakan janin e. Tampak implantasi plasenta 5. Seorang perempuan 25 th datang ke BPM mengatakan hamil 2 bulan dan mengeluh mual muntah berlebih sejak 2 hari yang lalu, tampak lemas, pucat dan bibir tampak kering, dari hasil pemeriksaan TD 100/80 mmhg, nadi 87 x/mnt, respirasi 17 x/mnt, suhu 35,6 C.

Diet makan yang dianjurkan kepada pasien diatas adalah a. Makan tinggi protein b. Makan sewaktu tapi banyak c. Makanan berat sedikit tapi sering d. Makan ringan kering dan sering e. Makan sedikit dan banyak minum 6. Seorang perempuan 25 th datang ke BPM mengatakan hamil 2 bulan dan mengeluh mual muntah berlebih sejak 2 hari yang lalu, tidak nafsu makan, tampak lemas, pucat dan bibir tampak kering, dari hasil pemeriksaan TD 90/70 mmhg, nadi 96 x/mnt, respirasi 17 x/mnt, suhu 35,6 C.

Factor fisiologis apakah yang dapat menyebabkan kondisi pasien diatas a. Perubahan metabolisme selama hamil b. Kondisi rumah tangga yang tidak harmonis c. Kehamilan yang tidak diinginkan d. Ketakutan terhadap proses kehamilan dan persalinan e. Perubahan psikologis selama kehamilan 7. Seorang perempuan berusia 23 th, HPHT : 1 -8-2011 ,mengaku hamil kedua, belum pernah keguguran, datang ke BPS perawat D tgl 7-3-2012 untuk pemeriksaan kehamilan mengeluh sesak, perut buncit.

Hasil pemeriksaan fisik didapatkan : TTV dalam batas normal, Pemeriksaan Leopold didapatkan : L1 : Bulat,lunak tidak melenting, TFU : 36 cm ; L2 : teraba 1 tahanan yang besar kanan dan kiri; L3 : teraba bagian keras, melenting. Bja : terdapat 2 bjj di 2 punctum max.

Diagnosa yang dapat ditegakan dari kasus tersebut adalah a. G1P0A0 gravida 30 mg dengan kemungkinan hamil kembar b. G1P0A0 gravida 30 mg dengan kemungkinan bayi besar c. G1P0A0 gravida 30 mg dengan kemungkinan hidramnion d. G1P0A0 gravida 30 mg dengan kemungkinan mola e. G1P0A0 gravida 30 mg normal 8. Seorang perempuan berusia 20 tahun GI PO AO, memasuki usia kehamilan 8 mgg datang ke BPS,mengeluhkan sering mual lanugo pada bayi baru lahir hingga nafsu makan menurun.

Dari hasil pemeriksaan didapatkan lidah kering, turgor kulit berkurang, KU ibu lemah. Menurut saudara termasuk pada Hiperemesis grade apa ? a. grade 1 b. grade 2 c. grade 3 d. grade 4 e. grade 5 9. Seorang perempuan usia 21 tahun datang ke BPM untuk konsultasi mengenai keluhan kesehatan reproduksinya namun perempuan tersebut enggan untuk menceritakan keluhannya karena di BPM sedang ada pasien lain. Sehingga komunikasi antara klien dan perawat menjadi terhambat.

Faktor penghambat apakah yang terjadi pada klien dan perawat? a. Faktor individual b. Faktor situasional c. Factor yang lanugo pada bayi baru lahir dengan interaksi d. Kegagalan dalam percakapan e. Faktor pengetahuan 10. Seorang perempuan berumur 22 tahun G1P0A0 hamil 8 minggu, datang ke poli kandungan untuk memeriksaakan kehamilannya. Hasil pengkajian Tekanan darah 120/80 mmHg, respirasi 21x/menit, nadi 80x/menit, denyut jantung janin 145x/menit, pasien mengeluhkan sering buang air kecil, merasakan mual, pasien khawatir keluhan yang dialami adalah tidak normal.

Apakah pendidikan kesehatan yang prioritas untuk disampaikan pada pasien berdasarkan kasus di atas? a. Nutrisi kehamilan b. Mengenali tanda-tanda kehamilan c. Perubahan fisik dan psikologis kehamilan d. Masalah-masalah umum pada masa kehamilan e. Mengenali tanda dan bahaya pada masa kehamilan 11.

Seorang perempuan berumur 25 tahun G1P0A0 hamil 32 minggu, datang ke poli kandungan untuk memeriksakan kehamilan. Hasil pengkajian tekanan darah 110/75 mmHg, respirasi 21x/menit, nadi 88x/menit, pasien mengatakan sulit tidur dan sering terbangun, jika tidur terlentang terasa sesak.Pasien bertanya ke perawat “Apa yang dapat saya lakukan supaya saya dapat tidur dengan nyaman?” Bagaimanakan respon yang dapat diberikan oleh perawat terhadap pasien tersebut?

a. “Ibu dapat mengurangi jam tidur di siang hari, sehingga saat malam waktu tidur lebih panjang” b. “ Kondisi sulit tidur yang ibu alami adalah normal, yang penting ibu tetap sempatkan tidur saat malam hari” c. “ Ibu dapat mencoba tidur dengan posisi miringdan gunakan bantal sebagai bantalan “ d. “ Silahkan ibu mencoba tidur di ruangan yang lebih luas, dan tenang sehingga tidak teganggu” e.

“ Saat tidur sebaiknya ibu gunakan pakaian yang longgar, agar pernafasan ibu menjadi lebih lancar” 12. Seorang perempuan berumur 20 tahun G1P0A0 hamil 36 minggu, datang ke poli kandungan dengan keluhan sejak 1 hari yang lalu tidak dapat merasakan gerakan bayi lanugo pada bayi baru lahir perutnya, pasien mengatakan biasanya gerakannya aktif. Apakah pemeriksaan segera yang dilakukan pada kasus tersebut?

a. Pemeriksaan dalam b. Pemeriksaan leopold c. Pemeriksaan tanda vital d. Pengukuran tinggi fundus e. Pemeriksaan denyut jantung janin 13. Seorang perempuan berusia 25 tahun, G1P0A0 umur kehamilan 40 minggumasuk Ruang bersalin dengan keluhan mulas, disertai adanya lendir campur darah keluar dari alat kelaminnya.Hasil wawancara dan pemeriksaan fisik: pasien merasa perutnya bertambah sakit,tinggi fundus uteri 35 cm, kepala sudah masuk pintu atas panggul 3/5, his 3x/10 menit/45 detik,denyut jantung janin 145x/menit ireguler,dilatasi servik 7-8 cm.

Apakah tindakan segera yang dilakukan pada kasus tersebut? a. Amniotomi b. Manajemen nyeri c. Kolaborasi Pemberian analgesic d. Menganjurkan klien posisi jongkok sambil diikuti meneran e. Evaluasi dilatasi servik secara rutin dengan pemeriksaan dalam 14. Seorang perempuan berusia 25 tahun, G2P1A0, di ruang bersalin, mengeluh perutnya mulas terus-menerus.Hasil pemeriksaan dilatasi servik 4 cm, kontraksi 3x/10’/50”,tidak terdapat relaksasi, DJJ 155x/menit.

Apakah tindakan keperawatan prioritas yang dilakukan pada kasus tersebut? a. Tingkatkan hidrasi b. Ajarkan teknik nafas dalam c. Anjurkan pasien untuk istirahat d. Kolaborasi pemberian uterotonika e. Ajarkan keluarga melakukan counter pressure 15. Seorang perempuan G1P0A0, umur 24 tahun hamil 26 minggu, masuk RS dibawa oleh keluarga dengan keluhan kepalanya pusing. Saat dikaji diperoleh tekanan darah 170/100 mmHg, nadi 84x/mnt, respirasi 24x/mnt, pasien tampak lemah.

Apakah masalah utama pada kasus tersebut? a. Resiko injury b. Intoleran aktivitas c. Peningkatan cardiac output d. Ketidakefektifan perfusi jaringan ke otak e. Gangguan sensori persepsi penglihatan 16. Seorang perempuan G1P0A0, usia 28 tahun hamil 36 minggu, datang ke poli kebidanan RS karena sejak tadi malam kepalanya terasa pusing.

Hasil pemeriksaan, tekanan darah 190/110 mmHg, nadi 84x/mnt, respirasi 24x/mnt,denyut jantung janin 160x/menit, pasien diinstruksikan untuk diberi MgSO4 40 % melalui IV. Apakah tindakan yang dilakukan sebelum pemberian terapi tersebut? a. Cek suhu tubuh b. Cek tekanan darah c. Cek nadi per menit d. Cek kontraksi uterus e.

Cek respirasi per menit 17. Seorang perempuan berumur 20 tahun P1A0, satu jam lalu melahirkan bayi perempuan di ruang bersalin, saat dilakukan monitoring kala empat hasilnya : tekanan darah 80/60 mmHg, nadi 100x/menit, respirasi 22x/menit,Tinggi fundus uteri 1 jari di atas pusat, kontraksi lemah, perdarahan pervagina > 500 cc, pasien merasa lemah.

Apakah tindakan utama yang dapat dilakukan untuk menghentikan perdarahan berdasarkan kasus tersebut? a. Persiapan kuret b. Memberikan oksitosin drip c. Melakukan penggantian cairan d. Melakukan masase uterus, hingga uterus mengeras e. Melakukan pengeluaran sisa plasenta secara manual 18. Seorang perempuan berumur lanugo pada bayi baru lahir tahun, G1POAO hamil 40 minggu, melahirkan di RS pukul 14.00, setelah 15 menit paska persalinan, tidak ada tanda-tanda plasenta lepas.

Apakah tindakan yang prioritas dilakukan berdasarkan kasus tersebut? a. Memberikan oksitosin dosis ke-dua b.

Melakukan masase uterus selama 15 ‘ c. Melakukan tarikan tali pusat terkendali d. Mengecek kembali tanda plasenta lepas e. Melakukan pengeluaran plasenta secara manual 19. Seorang perempuan, berumur 30 tahun datang ke ruang IGD Kebidanan. Hasil pengkajian didapatkan pasien mengalami perdarahan pasca persalinan akibat retensio plasenta, TD 90/ 50 mmHg, N: 100 x/menit, Klien tampak pucat dan lemah, konjungtiva pucat, akral dingin, CRT 4 detik.

Apakah tindakan utama perawat untuk dapat menolong pasien tersebut? a. Memberikan terapi infus. b. Memberikan tranfusi darah c. Memberikan terapi oksigen d. Melakukan kolaborasi tindakan curetage e. Melakukan kolaborasi pemberian terapi antikoagulasi 20. Saat dilakukan pemeriksaan fisik pada pasien perempuan yang mengalami perdarahan di peroleh data TD 90/ 60 mmHg, N: 100 x/menit, Klien tampak pucat dan lemah, konjungtiva pucat, akral dingin, CRT >2 detik.

Apakah Diagnosa keperawatan yang utama pada kasus tersebut? a. Nyeri b/d inkontinuitas jaringan b. Gangguan pertukaran gas b/d asidosis respiratorik c. Ketakutan/ansietas b/d krisis situasi (perdarahan) d. Defisit pengetahuan berhubungan dengan kurangnya informasi e.

Resiko deficit volume cairan b/d kehilangan berlebihan melalui rute normal dan atau abnormal (perdarahan). 21. Seorang perempuan berusia 23 tahun mengeluh mual muntah pada pagi hari.

Saat ini klien sedang mengandung dengan usia kehamilan 2 minggu. Manakah anjuran yang tepat untuk mengatasi keluhan diatas a. Beri air putih b. Anjurkan pasien untuk istirahat c. Berikan vitamin dan suplement d. Anjurkan untuk makan sedikit tapi sering e. Hindari bau masakan yang mencetuskan mual 22. Seorang ibu, berumur 57 tahun, merupakan keluarga dari pasien yang mengalami depresi akibat pemerkosaan yang memasuki hari kedua perawatan serta baru pertama kali dirawat.

Ibu menyatakan belum mampu dan tidak tahu cara merawat pasien. Apakah tahap pertama pendidikan kesehatan yang dilakukan perawat pada kasus tersebut? a. Melatih keluarga untuk merawat pasien langsung b. Menjelaskan kondisi pasien yang harus diwaspadai oleh keluarga. c. Mengikutsertakan anggota keluarga yang lain yang peduli kepada klien.

d. Melatih keluarga untuk merawat pasien langsung. Keluarga untuk merawat pasien. e. Menjelaskan tentang masalah yang dialami pasien dan pentingnya peran keluarga untuk mendukung pasien 23. Seorang wanita yang sudah menikah selama enam tahun datang ke poli kandungan dengan keluhan terlambat haid, mudah lelah, sudah tiga hari mengalami nyeri hebat didaerah perut bawah dan menyebar di seluruh perut, terdapat perdarahan pada vagina.

Apakah jenis pemeriksaan yang tepat untuk memastikan diagnosa definitif dari kasus diatas? a. Pemeriksaan Ultrasonography b. Pemeriksaan rontgen c. Pemeriksaan urin d. Pemeriksaan fisik e. Pemeriksaan darah 24. Seorang wanita datang ke poli KB untuk pemasangan alat KB. Hasil anamesa didapatkan ibu belum pernah menggunakan KB sebelumnya dan masih menyusui. Ibu tersebut menginginkan alat KB yang dapat digunakan dalam waktu jangka panjang, tidak menganggu produksi ASI, tidak terjadinya peningkatan berat badan, dan harga murah.

Alat KB manakah lanugo pada bayi baru lahir bisa di gunakan oleh wanita tersebut ? a. Pil b. Suntik c. Implant d. IUD e. Tubektomy 25. Seorang wanita berusia 25 tahun, datang ke klinik dengan keluhan diare sudah 2 minggu disertai demam dan batuk, tidak ada nafsu makan, riwayat gonta ganti pasangan.

Pada pemeriksaan fisik ditemukan bintik-bintik merah diseluruh tubuh. Pemeriksaan penunjang apakah yang perlu dilakukan untuk menegakkan diagnose definitif pada pasien tersebut? a. ELISA b. CD 4 c. Rontgen d. Mantoux tes e. Limfosit 26.

lanugo pada bayi baru lahir

Seorang pria datang ke Puskesmas dengan keluhan terdapat luka di kemaluan disertai rasa perih dan gatal setelah berhubungan dengan Pekerja Seks Komersil. Hasil pemeriksaan didapatkan ulkus multiple, vesikel di korpus penis yang tertutup pus, demam dan berat badan klien turun. Klien mengatakan malu bila kencing di toilet umum. Apakah masalah keperawatan dari kasus diatas? a. Nyeri akut b. Infeksi c. Harga diri rendah d. Hipertermi e. Nutrisi kurang dari kebutuhan 27.

Seorang bayi lahir dengan gestasi cukup bulan, berat badan lahir 2000 gram, APGAR skor 7/8, tampak bayi kurang aktif bergerak, dan kulit keriput. Hasil anamnesa dari ibu, lanugo pada bayi baru lahir bahwa selama hamil, ibu tidak melakukan pemeriksaan secara teratur, berat badan selama hamil hanya naik 5 kilo dan tidak rutin minum vitamin yang diberikan oleh dokter puskesmas.

Apakah masalah keperawatan dari kasus diatas? a. Kurang pengetahuan tentang antenatal care b. Nutrisi kurang dari kebutuhan c. Risiko tinggi perdarahan d. Risiko tinggi anemia e. Risiko lahir cacat 28. Seorang wanita datang ke dokter, dengan keluhan sakit saat buang air kecil dan gatal pada vagina. Hasil pemeriksaan ditemukan uretra udema, urin berwarna keputihan seperti susu, status lokalis regio vagina dan perineum hiperemis, bercak-bercak putih, flour albus putih kental dan berbau amis.

Pemeriksaan fisik normal. Pemeriksaan laboratorium apakah yang dilakukan untuk menunjang diagnosa definitif dari kasus diatas?

a. Sediaan basah usap vagina b. Biomolekuler c. Biopsi d. Serologi e. Urine 29. Seorang lanugo pada bayi baru lahir 40 tahun, dirawat di rumah sakit dengan keluhan adanya luka pada payudara yang tidak sembuh. Hasil pemeriksaan ditemukan eksim pada puting susu, benjolan pada payudara kanan dengan konsistensi keras dan diameter 2-5cm, berbatas tegas, bau, serta sulit digerakkan. Dari puting payudara keluar darah dan nanah, puting payudara tertarik kedalam.

Apakah tindakan keperawatan kolaborasi pada kasus diatas? a. Kolaborasi imunoterapi b. Kolaborasi tindakan mastektomi c. Kolaborasi pemberian antibiotik d. Kolaborasi pemberian kemoterapi e. Kolaborasi pemberian radioterapi 30. Ny. T usia 34 tahun sudah 2 bulan mengalami haid yang tidak teratur, Ny. T berencana untuk melakukan pemeriksaan pap smear. Informasi yang harus diberikan kepada Ny. T sebelum melakukan pemeriksaan pap smear yaitu.

a. Ibu dalam keadaan tidak haid, tidak berhubungan badan 1-2 hari sebelum pemeriksaan b. Ibu dalam keadaan haid, tidak berhubungan badan 1-2 hari sebelum pemeriksaan c. Ibu dalam keadaan puasa, dalam keadaan haid, tidak berhubungan badan 1-2 hari sebelum pemeriksaan d.

Ibu dalam keadaan tidak haid e. Ibu dalam keadaan puasa 31. Ny. T usia 34 tahun setelah dilakukan pemeriksaan pap smear ditemukan hasil (+) ca. servics stadium 1A. Berikut merupakan gambaran klinis dari ca. cerviks yaitu. a. Perdarahan abnormal dari vagina, nyeri saat kontak hubungan seksual b. Perdarahan abnormal dari vagina, perdarahan saat kontak berhubungan seksual, urgensi berkemih c.

Perdarahan abnormal dari vagina, pembesaran daerah abdomen, nyeri daerah vagina d. Perdarahan abnormal dari vagina, pembesaran daerah abdomen, nyeri tekan daerah abdomen e.

Perdarahan abnormal dari vagina, nyeri saat kontak hubungan seksual, urgensi berkemih 32. Ny. K usia 59 tahun datang ke poli ginekologi RSUD dengan keluhan haid yang tidak teratur sudah 3 bulan disertai dengan nyeri diperut bagian bawah. Data pengkajian yang harus dilengkapi sesuai dengan kasus diatas yaitu a. Status pernikahan/ hubungan b. Usia saat pertama kali hamil c.

Tanggal dan hasil pemeriksaan pap smear terakhir d. Terapi medis saat ini e. Aktifitas perawatan diri 33. Ny. K usia 59 tahun datang ke poli ginekologi RSUD dengan keluhan haid yang tidak teratur sudah 3 bulan disertai dengan nyeri diperut bagian bawah. Setelah dilakukan pengkajian lebih lanjut didapat data, Ny. K menyatakan pusing, lemas, sakit bila berkemih, perdarahan saat dirumah sudah ± 5x ganti pembalut dengan kondisi pembalut penuh dari jam 07.00 – 14.00, tidak nafsu makan, BB turun sebanyak 3Kg, membran mukosa kering.Diagnosa keperawatn prioritas berdasarkan kasus diatas yaitu.

a. Gangguan rasa nyaman nyeri b. Gangguan eliminasi urine c. Kurang pengetahuan mengenai proses pengobatan d. Gangguan kebutuhan nutrisi e. Ketidakseimbangan volume cairan 34. Ny. K usia 59 tahun datang ke poli ginekologi RSUD dengan keluhan haid yang tidak teratur sudah 3 bulan disertai dengan nyeri diperut bagian bawah.

Setelah dilakukan pengkajian lebih lanjut didapat data, Ny. K menyatakan pusing, lemas, sakit bila berkemih, perdarahan saat dirumah sudah ± 5x ganti pembalut dengan kondisi pembalut penuh dari jam 07.00 – 14.00, tidak nafsu makan, BB turun sebanyak 3Kg, membran mukosa kering.

Implementasi keperawatan pada diagnosa keperawatan prioritas pada Ny. K yaitu. a. Memonitor batasan karakteristik nyeri b. Memonitor haluaran urine c. Memonitor TTV d.

Memonitor balance cairan e. Memberikan pendidikan lanugo pada bayi baru lahir 35. Ny. N usia 26 tahun dengan P1A0 NH2 melahirkan secara spontan, setelah dilakukan pemeriksaan fisik ditemukan involusi uterus 2 jari dibawah pusat, kontraksi (+), teraba keras.

Perubahan fisiologis, involusi uterus terjadi karna adanya aktifitas. a. Peningkatan hormon progesteron dan kontraksi fundus uteri b. Peningkatan hormon estrogen dan atropi dinding abdomen c. Peningkatan hormon estrogen dan retraksi fundus uteri d. Penurunan hormon progesteron dan kontraksi, retraksi serabut otot uterus e. Penurunan hormon estrogen dan kontraksi, retraksi serabut otot uterus 36. Ny. N usia 26 tahun dengan P1A0 NH2 melahirkan secara spontan.

Secara psikologis Ny. N berada dalam fase taking in. Dibawah ini merupakan perilaku ibu dalam fase taking in a. Khawatir tentang penampilannya sebagai seorang ibu b.

Ujung-ujung jari tangan menyentuh bayi c. Melepaskan peran sebelumnya sebagai orang tua yang tidak memiliki anak d. Menyadari kehadiran bayi baru lahir e. Melibatkan suami dalam perawatan bayi baru lahir 37. Lanugo pada bayi baru lahir. N usia 26 tahun dengan P1A0 NH2 melahirkan secara spontan, bayi perempuan dengan BB 2800 gram. Bayi Ny. P tampak tidak puas setelah menyusui, terlihat sering menangis dan saat dirangsang bayi tampak mencari puting ibu.

Reflek menyusui yang ditemukan pada bayi Ny. P yaitu. a. Moro b. Fencing c. Rooting d. Glabellar e. Palmar 38. Ny. N usia 26 tahun dengan P1A0 NH2 melahirkan secara spontan, bayi perempuan dengan BB 2800 gram. Bayi Ny. P tampak tidak puas setelah menyusui, terlihat sering menangis dan saat dirangsang bayi tampak mencari puting ibu, payudara Ny. P teraba penuh, pembesaran kelenjar limfe (+), puting exverted +/+. Diagnosa keperawatn prioritas berdasarkan kasus diatas yaitu.

a. Ketidakcukupan air susu ibu b. Ketidakefektidan pola makan bayi c. Ketidakefektifan pemberian asi d. Diskontinuitas pemberian asi e. Kesiapan meningkatkan pemberian asi 39. Ny. N usia 26 tahun dengan P1A0 NH2 melahirkan secara spontan, bayi perempuan dengan BB 2800 gram. Bayi Ny. P tampak tidak puas setelah menyusui, terlihat sering menangis dan saat dirangsang bayi tampak mencari puting ibu, payudara Ny. P teraba penuh, pembesaran kelenjar limfe (+), puting exverted +/+.

Implemetasi keperawatan pada kasus diatas yaitu. a. Pemberian informasi mengenai posisi ibu menyusui b. Perawatan payudara c. Kompress hangat payudara d.

Pemberian informasi mengenai nutrisi ibu menyusui e. Anjurkan ibu untuk memberikan asi setiap 2 jam 40. N, usia 24 tahun datang ke poli kandungan dengan suaminya karena terlambat haid. HPHT Ny. N 3/10/2012 dengan siklus menstruasi 28 hari. Keluhan morning sicknes dirasakan oleh Ny. N sangat berat, setiap makanan yang dimakan selalu dimuntahkan lagi hingga tidak bisa melakukan aktifitas seperti biasa, tampak lemas dan pucat dan merasa pusing.Hasil TTV : TD 110/70, Nadi 68 x/menit, Suhu 36,40C dan Respirasi 16x/menit.

Kapan taksiran partus Ny. N ? a. 9 - 7 – 2013 b. 10 - 7 – 2013 c. 11 - 7 – 2013 d. 12 - 7 – 2013 e. 13 - 7 – 2013 41. A 25 tahun G2P1A0 datang ke poliklinik kandungan untuk memeriksakan kehamilannya yang memasuki 35 minggu. Perawat B melakukan pemeriksaan DJJ, dari hasil pemeriksaan DJJ didapatkan 5’detik11 5’ detik 12 5’detik 11.

Apa yang pertama kali dilakukan perawat B dalam melakukan pemeriksaan diatas ? a. Meletakan monoaurel secara tegak lurus pada dinding perut ibu b.

Menentukan punggung janin c. Meraba denyut jantung ibu d. Memastikan DJJ e. Membedakan bunyi jantung ibu dan DJJ 42. Ketika anda sedang bertugas di UGD datang seorang wanita dengan perdarahan jalan lahir.

Darah tampak segar dan membasahi kain yang ia gunakan. Ia mengaku baru saja melahirkan 48 jam yang lalu. Wanita tersebut tampak lemah. Dari hasil pemeriksaan didapatkan data: TD 80/60 mmHg, nadi 110x/mnt, TFU sepusat, kontraksi lemah. Hasil pemeriksaan kotiledon tidak utuh. Tindakan apa yang harus anda lakukan dengan segera pada klien tersebut? a. Periksa tanda vital b. Berikan cairan melalui intravena c. Transfusi darah d.

Pemeriksaan lab darah lengkap e. Kolaborasi pemeriksaan USG 43. Saat perawat bertugas di UGD, perawat mendapatkan pasien wanita dengan keluhan adanya keluaran cairan pada jalan lahir. Usia kehamilan 32 minggu. Pembukaan 4-5 cm. Dari hasil pengkajian didapatkan data sbb: G3P2A0, Leopold I TFU 36 cm, Leopold II puka, Leopold III bagian presentasi sudah masuk PAP, kontraksi lemah, DJJ 140x/mnt.

Sedangkan hasil pemeriksaan dalam didapatkan portio lunak, penipisan serviks 60%. Berdasarkan hasil pengkajian diatas, apa yang klien alami ? a. KET b. Molahidatidosa c. Abortus d. Ketuban pecah dini e. Partus lama 44. datang seorang wanita dengan perdarahan jalan lahir. Saat dianamnesa oleh perawat didapatkan informasi bahwa wanita tersebut baru melahirkan 3 jam yang lalu di bidan, jenis persalinan spontan, dengan status paritas Lanugo pada bayi baru lahir.

TD 90/60, Nadi 110x/mnt, Respirasi 24x/mnt, suhu 36.8oC. Kontraksi lemah, TFU pertengahan pusat. BB bayi 4.2 Kg, Panjang 53 cm. Plasenta lengkap, telah dilakukan perineoraphy. Tindakan apa yang harus perawat lakukan a. Massage uterus b. Repair perineoraphy c. Pemberian oksitosin 10 unit IM d. Kompresi bimanual e. Tinggikan kaki 45 derajat 45. Seorang perempuan berusia 24 tahun, datang untuk melakukan antenatal ke puskesmas dengan status G1P0A0. Berdasarkan data hasil anamnesa perawat, diketahui HPHT 20 Maret 2012.

Kapan taksiran persalinan bagi perempuan di atas ? a. 13 Desember 2012 b. 17 Desember 2012 c. 20 Desember 2012 d. 23 Desember 2012 e. 27 Desember 2012 46. Seorang perempuan berusia 24 tahun, datang untuk melakukan antenatal ke puskesmas pada tanggal 31 Oktober 2012. Berdasarkan data hasil anamnesa perawat, diketahui status G1P0A0, HPHT 20 Maret 2012. Berapa usia gestasi bagi perempuan di atas ? a. 28 – 29 minggu b. 29 – 30 minggu c. 30 – 31 minggu d. 31 – 32 minggu e. 32 – 33 minggu 47.

Seorang perempuan, berusia 29 tahun datang ke IGD dengan keluhan perdarahan per vaginam disertai nyeri. Hasil pengkajian, diperoleh data : uterus terasa tegang, bagian-bagian janin sulit untuk dipalpasi dan gerakan janin berkurang.

Lanugo pada bayi baru lahir masalah yang terjadi pada kasus di atas ? a. Solusio plasenta ringan b. Solusio plasenta sedang c. Solusio plasenta berat d.

Plasenta previa parsialis e. Plasenta previa totalis 48. Seorang perempuan berusia 35 tahun post partum hari ke 2 dirawat di ruang nifas mengatakan belum menyusui bayinya dan mengeluh nyeri, payudara bengkak serta hasil pemeriksaan fisik didapatkan payudara ibu teraba keras. Apa tindakan yang harus dilakukan pada pasien diatas ? a.

Kompres dingin b. Kompres hangat c. Pijatan halus d. Ajarkan relaksasi e. Ajarkan distraksi 49. Seorang perempuan berusia 24 tahun, datang untuk melakukan antenatal ke puskesmas pada tanggal 31 Oktober 2012. Berdasarkan data hasil anamnesa perawat, diketahui status G1P0A0, HPHT 20 Maret 2012.

Berapa usia gestasi bagi perempuan di atas ? a. 28 – 29 minggu b. 29 – 30 minggu c. 30 – 31 minggu d. 31 – 32 minggu e. 32 – 33 minggu 50. Seorang perempuan berusia 35 tahun datang ke puskesmas untuk melakukan KB, tetapi ibu belum tahu jenis KB apa yang akan digunakan.

Ibu sudah memiliki 6 orang anak dengan jarak kelahiran antara 2-3 tahun. apa jenis KB yang sebaiknya digunakan oleh pasien tersebut ? a. IUD b. Tubektomi c. Vasektomi d. Pil e. Suntik 51. seorang ibu post partum spontan hari pertama terdapat luka episiotomy dan belum BAK selama 4 jam.

Pada saat di palpasi bladder teraba keras. Apa tindakan yang dilakukan pada pasien tersebut ? a. lakukan pemasangan kateter untuk mengeluarkan urin b. membiarkan ibu mendengar bunyi air mengalir, merendam tangan di air hangat c. membantu ibu ke kamar kecil atau berkemih di bedpan jika ia tidak mampu berjalan d. membantu ibu mandi atau melakukan sitz bath e. meletakkan minyak peppermint didalam bedpan di bawah ibu 52. Seorang ibu G2P1A0 datang ke UGD diantar oleh suaminya dengan keluhan perdarahan pervagina, darah berwarna lanugo pada bayi baru lahir segar, tidak ada nyeri pada perut, hasil pemeriksan DJJ (+), konjungtiva anemis, usia gestasi 30 minggu.

Apakah Manajemen yang tepat untuk mengatasi kasus tersebut ? a. SC b. Konservatif c. Pemberian tokolitik d. Partus normal e. Perawatan dengan bedrest 53. seorang perempuan sedang dalam proses melahirkan dengan tanda-tanda kontraksi lebih teratur, kekuatan sedang, frekuensinya tiap tiga sampai lima menit, ibu terlihat meringis kesakitan, ibu terlihat ragu-ragu untuk mengatasi nyeri.

Apa yang seharusnya lanugo pada bayi baru lahir oleh perawat ? a. Cobalah untuk memahami nyeri dan rasa tidak nyaman yang diungkapkan ibu b. Dalam melakukan prosedur yang diperlukan bersikap baik, penuh perhatian dan kompeten c. Dorong pasien dan pasangannya untuk mengungkapkan kehawatirannya d. Jalin hubungan baik dengan ibu dan keluarganya e. Lakukan massage pada punggung dan perut ibu serta anjurkan untuk tetap lakukan teknik nafas dalam 54.

Seorang perempuan datang ke UGD dengan keluhan mulas usia kehamilan 39 minggu. Hasil pemeriksaan adalah TD 130/80 mmHg, N 98 x/menit, R 22 x/menit. Pembukaan cervik 5. Selaput ketuban masih utuh. Kontraksi (+), DJJ bayi 122 x/menit. Pasien tampak kesakitan, wajah pasien meringis sampai dengan menangis. apa masalah keperawatan pada pasien diatas? a. Nyeri b. Cemas c. Gangguan rasa nyaman d. Gangguan body image e. Resiko tinggi terjadi infeksi 55. Seorang perempuan berusia 33 tahun P3A0, pasien mengatakan selama hamil tidak pernah melakukan senam hamil.

Hasil pemeriksaan fisik terlihat jelas abdomen lunak/ dinding perut lembek dan kendor. apakah tindakan yang dilakukan kepada pasien tersebut ? a. Mengajarkan senam hamil b. Mengajarkan senam nifas c. Mengajarkan yoga d. Menganjurkan untuk sit up e. Menganjurkan untuk push up 56. Seorang ibu P1A0, melahirkan dengan cara SC. Pada pemeriksaan payudara didapatkan hasil puting susu datar.Apakah tindakan yang tepat untuk pasien tersebut ? a. mengajarkan Teknik Hoffman b.

mengajarkan Homan’s sign c. mengajarkan Senam nifas d. mengajarkan Perawatan payudara e. mengajarkan Teknik pompa ASI 57.

seorang perempuan G1P0A0 hamil 5 minggu mengeluh sering kencing dan tidak dapat menahannya. Pasien mengatakan dalam sehari bisa kencing lebih dari 10 kali. Apa masalah yang dialami oleh pasien tersebut ? a. Gangguan rasa cemas b.

Kurang pengetahuan tentang perkembangan kehamilan c. Kurang pengetahuan tentang perkembangan kehamilan normal d. Gangguan nyeri e. Gangguan rasa nyaman 58. seorang perempuan 30 tahun G2P1 A0 usia kehamilan 32 minggu, mengeluh mengalami kesulitan B.A.B (Konstipasi).

Pasien mengatakan sudah minum air putih yang banyak. apakah intervensi untuk mengatasi masalah pasien diatas ? a. Berikan makanan TKTP b. Berikan makanan rendah natrium c. Berikan makanan buah-buahan segar dan sayuran d.

Anjurkan makan yang cukup e. Anjurkan tidur siang 59. Seorang perempuan usia 22 tahun G1P0A0 usia kehamilan 6 mg datang ke poli obstetrik dengan ditemani oleh suaminya mengeluh mual sampai dengan muntah, cepat lelah dan BB mengalami penurunan.

Apakah informasi yang harus diberikan oleh perawat? a. Anjurkan pada saat pagi-pagi untuk menyiapkan biscuit manis b. Anjurkan suaminya untuk menyiapkan makanan c. Anjurkan untuk menjaga aktivitas d. Anjurkan untuk beraktivitas e. Anjutkan untuk beristirahat 60. seorang perempuan berusi 36 tahun G4P1A2 dengan usia kehamilan 5 minggu datang ke poli obstetrik untuk memeriksakan kehamilannya.

Bayi yang dilahirkan mengalami kecacatan dan pada saat dilahirkan mengalami hipoglikemi. Pernah mengalami pre eklampsi pada kehamilan kedua. apakah pengkajian tambahan untuk menentukan tindakan yang akan dilakukan ?

a. Riwayat hipertensi b. Riwayat TORCH c. Riwayat DM d. Riwayat penyakit jantung e. Riwayat abortus 61. seorang perempuan berusi 47 tahun dirawat di ruang ginekologi dengan Ca Cervix Stadium II, pasien sedang menjalani kemoterapi, keluhan pasien mual, tidak nafsu makan, BB 36 kg, TB 151 cm.

Hasil pemeriksaan konjungtiva lanugo pada bayi baru lahir, wajah klien terlihat pucat, nilai Hb 10,2 gr%. apakah intervensi yang akan dilakukan terhadap pasien tersebut? a. Berikan nutrisi parenteral b. Berikan transfusi darah WB 3 labu c. Anjurkan makan sedikit tapi sering d. Berikan nutrsi TKTP e. Berikan makanan dalam keadaan hangat 62. Seorang perempuan berusi 36 tahun memiliki 2 orang lanugo pada bayi baru lahir dengan usia anak paling kecil, tidak pernah menggunakan KB.

Ibu ingin menggunakan KB tetapi ibu memiliki penyakit hipertensi sejak 4 tahun yang lalu. Pasien mengkonsumsi obat antihipertensi. Hasil pemeriksaan TD 140/90 mmHg. apakah informasi yang diberikan oleh perawat ? a. Menganjurkan pasien untuk menggunakan KB suntik 1 bulan b.

Menganjurkan pasien untuk menggunakan KB pil c. Menganjurkan pasien untuk menggunakan KB suntik lanugo pada bayi baru lahir bulan d. Menganjurkan pasien untuk melakukan sterilisasi e. Menganjurkan pasien untuk menggunakan KB IUD 63. Seorang perempuan datang ke UGD ditemani oleh kelaurganya dengan keluhan mulas. usia kehamilan 39 minggu primigravida. Pada saat diperiksa didapatkan : TD 130/80 mmHg, N 98 x/menit, R 22 x/menit. Pada saat dilakukan pemeriksaan dalam didapatkan pembukaan 5.

Selaput ketuban masih utuh. Kontraksi (+), DJJ bayi 122x/menit Ini adalah persalinan pertama bagi pasien. pasien menginginkan partus normal. Wajah terlihat tegang, pasien ingin ditemani suaminya. Pasien takut kalau bayinya terlahir cacat dan tidak bisa melahirkan secara normal. apakah diagnosa keperawatan yang muncul ? a. Nyeri b. Cemas c. Gangguan rasa nyaman d. Gangguan body image e. Resiko tinggi terjadi infeksi 64. Seorang perempuan berusia 52 tahun datang ke UGD mengeluh adanya perdarahan yang keluar dari jalan lahir sampai menghabiskan dua kain panjang.

Pasien mengeluh pusing dan lemah. Konjungtiva anemis, wajah pasien terlihat pucat. Hasil pemeriksaan medis diketahui bahwa wanita tersebut terdiagnosa Ca Servix stadium II b. Nilai Hb 7,8 gr%. apakah intervensi yang tepat untuk pasien diatas? a. Kolaborasi untuk pemberian tranfusi PRC dan pemberian cairan IV b.

Anjurkan pasien untuk beristirahat c. Periksa Hb secara periodik d. Observasi TTV tiap 8 jam e. Kolaborasi untuk pemberian obat koagulan 65. seorang perempuan berusia 33 tahun G1P0A0 dengan usia kehamilan 38 minggu, datang ke UGD pada pukul 14.00 WIB. Pasien mengatakan tidak merasakan mulas, sudah keluar flek. Pemeriksaan leopold ; presentasi bokong, punggung kiri, belum masuk pap. DJJ (+) 124 x/menit, TD 110/70 mmHg, N 96 x/menit.

pakah pemeriksaan yang diperlukan untuk mengetahui ketuban sudah pecah atau belum ? a. Pemeriksaan air kencing b. Pemeriksaan dalam c. Pemeriksaan CTG d. Pemeriksaan USG e. Pemeriksaan darah 66. Seorang laki-laki berusia 28 th di antar ke IGD Rumah Sakit Jiwa oleh keluarganya, pasien mengeluh setiap pagi dan sore mendengar suara-suara anak kecil yang tertawa dan bermain, pasien merasa sangat terganggu dengan suara-suara tersebut padahal pasien tidak melihat ada anak kecil, keluarga mengatakan pasien mengalami hal ini sejak kematian anak pertamanya sehingga sering melamun dan berbicara sendiri serta sering memukul-mukul telinganya.

Apakah predisposisi pada kasus di atas? a. Menikah usia muda b. Suara anak-anak selalu muncul c. Kematian pada anggota keluarga d. Merasa bersalah pada keluarga e. Merasa terganggu dengan suara-suara 67. Seorang perempuan berusia 20 th datang ke poliklinik kehamilan dengan keluhan mules disertai dengan keluaran darah bercampur lendir.Pada pemeriksaan tanda vital diperoleh TD 120/80 mmHg, frekuensi nadi 80x/menit, frekuensi nafas 20x/menit.

Pada pemeriksaan obstetrik didapatkan ibu hamil 38 minggu G1P0A0 ada keinginan untuk meneran, perineum menonjol, ada tekanan pada anus dan vulva membuka. Apakah tindakan yang harus dilakukan pada pasien diatas? a. Mengobservasi kemajuan persalinan b. Memimpin ibu untuk meneran c. Melakukan pemeriksa dalam d. Mengobservasi HIS pasien e. Memecahkan ketuban 68. Seorang wanita P3A0 usia 24 tahun keluaran darah dari jalan lahirsetelah melahirkan didapatkan data fundusnya 3 cm di atas umbilikus, miring ke kiri dan lunak.

Tanda vitalnya Suhu 37 ° C, TD 110/70 mmHgfrekuensi nadi : 80 x/mntfrekuensi nafas 18 x/mnt, kolaburatif pemberian pitosin dicampur dengan normal salin 20 tetes per menit. Apakah rencana tindakan pertama yang harus dilakukan pada pasien diatas ? a. Kaji cara memijat fundus b. Kaji jumlah karakter lokhea c. Kaji tanda-tanda vital d. Kaji jumlah keluaran darah f. Kaji karakteristik darah yang keluar 69. Seorang wanita P3A0 usia 24 tahun keluaran darah dari jalan lahirsetelah melahirkan didapatkan data fundusnya 3 cm di atas umbilikus, miring ke kiri dan lunak.

Tanda vitalnya Suhu 37 ° C, TD 110/70 mmHgfrekuensi nadi : 80 x/mntfrekuensi nafas 18 x/mnt, kolaburatif pemberian pitosin dicampur dengan normal salin 20 tetes per menit.

Apakah rencana tindakan pertama yang harus dilakukan pada pasien diatas ? a. Kaji cara memijat fundus b. Kaji jumlah karakter lokhea c. Kaji tanda-tanda vital d. Kaji jumlah keluaran darah e. Kaji karakteristik darah yang keluar 70. Seorang perempuan usia 25 tahun pada gestasi usia 33 mgg datang ke ruangan persalinan, data subyektif ia mengatakan perdarahan tidak disertai nyeri dan darah merah terang.

Suhu 36 °C, frekuensi Nadi 100 x /menitFrekuensi nafas 28 x /mnt TD 100/68 mmHg DJJ 156 x/mnt. Uterus lunak dan tidak ada nyeri tekan. Apakah prioritas tindakan keperawatan pada klien tersebut ? a. Memberi medikasi sesuai program b. Memulai terapi cairan iv c. Memberikan terapi penggatian darah sesuai program d. Mengkaji tanda-tanda vital, masukan dan keluaran dan jumlah perdarahan e. Melakukan observasi keadaan umum janin 71. Seorang ibu kehamilan 35 minggu datang ke poliklinik kehamilan, Hasil pemeriksaan didapatkan data subyektif mengeluh mual dan nyeri kepala selama tiga hari.

Pemeriksaan fisik menunjukkan TD 160/90 mmHg. Edema pada jari dan wajah, berat badan naik 3 kg. Hasil urinalisis ditemukan protein + 2. ibu masuk ruang perawatan dan pemberian MgSO4 dimulai. Apakah tindakan yang harus segera dilakukan pasien di atas ialah ? a. Memantau pemberian MgsO4 b. Mempertahankan lingkungan yang tenang tanpa gangguan c.

Mempertahankan lingkungan dengan pencahayaan terang d. Melakukan tirah baring e. Memantau penurunan berat badan 72. Seorang peremuan kehamilan 38 minggu dengan G3P2A0 datang ke poliklinik kandunganhasil pemeriksaan didapatkan edema bagian tungkai, TD 130/80 mmHg.

Tidak ada protein urine. Ia mengutarakan kecemasannya tidak bisa buang air besar. Apakah tindakan prioritas yang diberikan pada pasien di atas ? a. Memberi konseling tentang diet tinggi serat dan asupan cairan b. Mendiskusikan tanda dan bahaya dari hKK c. Mengkaji edema d. Memantau kenaikan berat badan e. Mendemonstrasikan cara melakukan latihan fisik ringan 73.

Seorang perempuan G1PAO datang ke poliklinik hasil pemeriksaan kehamilan 6 minggu dan data subyektif mengeluh muntah-muntah selama dua hari dan tidak mampu mengkonsumsi makanan atau cairan data obyektif didapatkan mata tampak cekung, turgor kulit buruk. TD 100/60 mmhg, frekuensi Nadi : 98 x/mnt. Manakah prioritas tindakan keperawatan yang harus dilakukan pada pasien diatas? a. Mengkaji status cairan dan elektrolit b.

Mengkaji nilai laboratorium c. Menimbang berat badan d. Mengkaji asupan nutrisi e. Mengkaji status gizi 74. Seorang perempuan G1P0A0 datang ke poliklinik hasil pemeriksaan kehamilan 30 minggu, tanda-tanda vital dalam batas normal data subyektif klien mengeluh tidak nyaman mengalami insomnia, edema di tumit dan kontraksi braxton hicks. Manakah prioritas tindakan keperawatan yang harus dilakukan pada pasien diatas? a. Melakukan relaksasi b. Menopang bagian tubuh dengan bantal c.

Menghindari minuman berkafein d. Menghindari makan pada malam hari e. Melakukan perawatan diri 75. Seorang bayi lahir di ruang bersalin dengan keluhan tidak langsung menangis. Pada pemeriksaan bugar diperoeh bugar diperoleh bayi prematur, tonus otot lemas, tidak menangis, mekonium jernih. Setelah bayi dihangatkan, diposisikan dan dikeringkan, dirangsang taktil, direposisi. setelah tindakan dilakukan evaluasi dan didapat bayi tidak menangis.

Frekuensi jantung < 100 x/mnt. Apakah tindakan keperawatan yang harus dilakukan pada pasien diatas? a. Memberiakan ventilasi tekanan positif b. Melakukan kompresi dada c. Memberikan epinefrin d. Melakukan RJP e. Memberikan O2 76. Perempuan 25 tahun datang ke LSM yang menangani masalah kekerasan pada wanita, mengadukan suaminya yang sering memukulnya setiap saat. Apakah tehnik yang dapat digunakan untuk menggali informasi dari klien tersebut? a. Verifikasi b.

Refleksi c. Negosiasi d. Konfrontasi e. Konfirmasi 77. Perempuan 25 tahun 7 hari postpartum, datang kepoliklinik kebidanan. Mengeluh payudara terasa nyeri dan lecet sehingga takut untuk menyusui bayinya. Klien mengatakan bayinya sering menangis meskipun telah disusui. Apakah tindakan perawatan yang tepat pada klien? a. Posisi menyusui yang baik dan benar b.

Nutrisi setelah melahirkan c. Perawatan puting dan payudara d. Penggunaan susu formula e. Cara merangsang bayi untuk menyusu 78.

Lanugo pada bayi baru lahir 34 tahun G1P0 hamil 26 minggu dengan diabetes melitus lebih dari 5 tahun datang keklinik kebidanan mengeluh sakit kepala, berkeringat, dan merasa sangat gugup (nervous). Apakah yang terjadi pada klien berdasarkan kasus diatas? a. Hipoglikemia b. Hiperemesis gravidarum c. Hipotiroidisme d. Lanugo pada bayi baru lahir e. Hiperglikemia 79. Seorang perempuan, 23 tahun datang ke UGD dengan perdarahan jalan lahir.

Mengaku amenorrhea 16 minggu yang lalu. Dari hasil pemeriksaan didapatkan data: TFU 1 jari di atas simphisis pubis, kontraksi kuat. Hasil pemeriksaan dalam: portio lunak, pembukaan (+). Apakah yang dialami oleh Ny L berdasarkan pengkajian yang telah anda lakukan? a. KET b. Molahidatidosa c. Abortus d. Plasenta Previa e. Solutio Plasenta 80. Seorang perempuan, P4A0 post partum 3 hari yang lalu, tampak sedih, marah dan frustasi karena bayi yang dilahirkannya tidak sesuai dengan harapannya.

Apakah yang dialami oleh pasien diatas? a. Post partum blues b. Depresi postpartum c. Psikosis postpartum d. Bipolar e.

Gangguan mood 81. Seorang perempuan datang kepoli kandungan untuk memeriksakan kehamilannya. Pasien mengatakan kehamilannya saat ini merupakan kehamilan kedua. Kehamilan sebelumnya ia mengalami keguguran saat usia kehamilannya tujuh bulan. Bagaimanakah dokumentasi status pasien tersebut? a. G2P0A1 b. G2P1A0 c. G2P0A0 d. G2P1A1 e. G2P0A2 82. Seorang perempuan, hamil 8 minggu mengalami mual muntah hebat disertai dengan nadi cepat 100-140x/mnt, tekanan darah sistol berkurang 80 mmHg, apatis, kulit pucat, kadang ikterus, dan ada aseton dan bilirubin.

Berapakah tingkat hiperemesis gravidarum pasien tersebut? a. Tingkat I b. Tingkat II c. Tingkat III d. Tingkat sedang e. Tingkat berat 83.

Seorang perempuan pada fase aktif persalinan, mengalami kemajuan pembukaan cerviks dari 4 cm menjadi 5 cm dalam 8 jam. Klien tersebut dinyatakan distosia hipotonik diberikan oksitosin (pitosin) untuk membantu/merangsang kontraksi. Hal yang paling penting harus diperhatikan oleh perawat saat ini adalah: a. Monitoring Denyut Jantung Janin b. Cek perineum apakah terjadi udem c.

Persiapan utuk persalinan Sectio d. Mencatat waktu dan lamanya kontraksi e. Menambah dosis pitosin dan mempercepat jumlah tetesan 84. Seorang klien dengan usia kehamilan 8 minggu mengeluh sering ke kamar mandi untuk BAK.

Perawat menjelaskan bahwa peningkatan frekuensi BAK pada ibu hamil disebabkan karena kapasitas kandung kemih. Selama kehamilan kapasitas bladder berkurang akibat? a. Otot detrusor mengalami atonia b. Penekanan akibat pembesaran uterus c. Rangsang reflex autonom d.

lanugo pada bayi baru lahir

Penyempitan saluran kemih di trigonum e. Adanya peningkatan hormone kehamilan 85. Ny. H, 22 tahun, hamil cukup bulan datang ke ruang bersalin rumah sakit A pada tanggal 5 November 2013 jam 9 pagi.

Menurut klien ini kehamilannya yang ketiga, pernah mengalami abortus lanugo pada bayi baru lahir melahirkan sekali. Ia mengeluh rasa kencang- kencang sejak malam hari. Pada saat dilakukan pemeriksaan didapatkan janin tunggal, presentasi kepala dengan penurunan 4/5, 2 kontraksi dalam 10 menit dan lamanya 30 detik.

DJJ 130 x/m, pembukaan 2 cm, selaput ketuban utuh dan tidak ada molase tulang kepala. Tekanan darah 120/85 mmHg, Nadi 88 x/m, temperatur 370C. Apakah tindakan selanjutnya yang dilakukan perawat?

a. Memecahkan ketuban b. Membimbing ibu untuk meneran c. Menyiapkan obat-obatan dan alat partus d. Memberitahukan ibu untuk menarik nafas panjang bila ada kontraksi 86. Ny H 30 tahun berada di ruang bersalin rumah sakit A, 15 menit yang lalu telah lahir bayi perempuan.

Sampai saat ini plasenta belum lepas dan sebelumnya sudah dilakukan penegangan dan dorongan dorsocranial. Apakah tindakan selanjutnya yang dilakukan perawat? a. Lakukan kateterisasi b. Lakukan manual plasenta c.

Beri dosis ulangan oksitosin lanugo pada bayi baru lahir unit IM d. Lakukan kembali penegangan tali pusat 87. Nn.J, 26 tahun, post operasi Manchester- Forthergill dan kolporafi posterior kolpokleisis atas indikasi prolaps uteri grade IV, sistokel grade IV dan rektokel grade IV, 5 hari yang lalu di ruang ginekologi rumah sakit A.Saat ini klien mengeluh nyeri pada daerah kemaluan.

luka masih tertutup verban. Skala nyeri 8-9. terpasang folley cathether. BAK lewat kantung urin di perut klien. BAB belum. Pada pemeriksaan tanda-tanda vital didapat Tekanan darah 120/80 mmHg, Nadi 84 x/m, Respirasi 20 x/m, Suhu 36,4oC.

BB saat ini 43 Kg, TB 145 Cm. Apakah masalah keperawatan yang utama klien tersebut? a. Ansietas b. Nyeri akut c. Gangguan konsep diri d. Gangguan eliminasi; konstipasi 88. Ny.E 37 tahun datang ke poliklinik ginekologi rumah sakit A untuk dilakukan kemoterapi yang ke 20.

sudah hamper 1 tahun didiagnosa kanker serviks stadium IV A. Ia merasa diasing, dan depresi. Apakah tindakan keperawatan yang dilakukan untuk mengatasi keluhan tersebut?

a. Anjurkan untuk istirahat b. Batasi kegiatan yang menyebabkan depresi c. Keluarga,teman tetap berkomunikasi dengan pasien d. Hindari kontak langsung dengan pasien bila pasien sedang menjalankan kemoterapi 89. Seorang perempuan berusia 34 tahun post partum hari pertama,dirawat di Ruang Nifas. Mengeluh nyeri pada area perineum skala 5 dari rentang skala nyeri 1-10.

terdapat luka episiotomi derajat 3. Manakah posisi baring yang dapat mengurangi gangguan rasa nyaman nyeri pasien tersebut? a. dorsal recumbent b. Semi fowler c. lithotomi d. fowler e. sim 90. Seorang perempuan berusia 34 tahun merasa hamil 8 bulan,datang memeriksakan diri ke Poli Kandungan.

Hasil anamnesis didapatkan data riwayat melahirkan anak pertama pada tahun 2006, melahirkan anak kedua pada tahun 2008 dan pernah mengalami abortus 1 kali pada tahun 2009. Bagaimanakah pencatatan riwayat paritas untuk pasien tersebut? a. G1P2A1 b. G2P2A1 c. G2P3A1 d. G3P2A1 e. G4P2A1 91. Seorang perempuan berusia 28 tahun, dirawat diruang Nifas.

Riwayat persalinan spontan 3 jam yang lalu. Didapatkan data TFU 2 cm diatas pusat, kontraksi uterus kurang, uterus teraba lunak,lochea rubra,ganti pembalut 2 kali dalam 2 jam terakhir. Manakah tindakan yang harus perawat lakukan pada pasien tersebut? a. Massage pada bagian fundus rahim b. Mengukur tekanan darah pasien c. Melakukan perawatan perineum d. Mengatur posisi sim e. Massage back rub 92. Seorang perempuan usia 24 tahun baru memiliki bayi pertamanya,tampak kesulitan saat menyusui bayinya.

Areola mamae tidak seluruhnya masuk kedalam mulut bayi. Pasien mengatakan belum tahu cara menyusui. Manakah hal pertama yang harus diajarkan pada pasien tersebut? a. Nutrisi untuk ibu menyusui b. Perawatan payudara c. Tehnik menyusui d. Breast feeding e. Supresi laktasi 93. Seorang perempuan usia 27 tahun mengaku hamil 3 bulan, datang memeriksakan diri ke Poli kandungan.

Hasil anamnesis didapatkan keluhan adanya peningkatan frekuensi berkemih baik siang maupun malam,sehingga tidurnya terganggu karena sering terbangun untuk buang air kecil. Pendidikan kesehatan yang dapat perawat sampaikan pada pasien tersebut? a. Mengganti underware setiap selesai buang air kecil b. Atur kegiatan dengan jeda istirahat c. Membatasi minum saat akan tidur d. Anjurkan minumsuplement vitamin e.

Membatasi aktivitas rutin 94. Seorang perempuan usia 25 tahun,merasa hamil 4 bulan. Datang memeriksakan diri ke Poli Kandungan dengan keluhan keluaran darah sedikit – sedikit dari vaginanya sejak 2 lanugo pada bayi baru lahir yang lalu, nyeri atau mules tidak ada, pembukaan servik tidak ada.

Manakah tindakan tepat yang harus dilakukan pada pasien tersebut? a. Istirahat tirah baring dengan observasi ketat terhadap perdarahan b. Kolaborasi pemasangan laminariastif c. Kolaborasi augmentasi oksitosin d. Kolaborasi tindakan kuretase e. Sectio caesaria 95. Seorang perempuan usia 32 tahun post sectio caesaria hari kedua. Riwayat anestesi dengan narkose lanugo pada bayi baru lahir. Saat dikaji pasien masih bedrest,aktivitas dibantu, ROM dalam batas normal. Manakahproritas rencana tindakan yang harus dilakukan oleh perawat ?

a. Anjurkan pasien mobilisasi secara bertahap b. Observasi derajat kemandirian pasien c. Lakukan perawatn luka d. Observasi tanda vital e. Ajarkan senam nifas 96. Seorang perempuan berusia 24 tahun, post partum spontan 8 jam,mengalami perdarahan pervaginam lebih kurang 600 cckonsistensi uterus teraba lunak, terdapat distensi pada kandung kemih.

Hasil pemeriksaan tandatanda vital didapatkan Tekanan darah 110/90 mmHg, frekwensi nadi lanugo pada bayi baru lahir x/mnt. Manakah prioritas tindakan keperawatan yang dapat dilakukan ?

a. Mengobservasi jumlah lokhea b. Melakukan pemasangan kateter c. Melakukan masage pada fundus uteri d. Melakukan pemasangan infus e. Melakukan tranfusi darah 97. Seorang wanita usia 30 tahun baru 5 hari melahirkan anak pertamanya. Pasien mengeluh susah tidur, sering menangis, sedihtetapi penyebab kesedihannya tidak jelas, pasien juga kurang perhatian terhadap bayinya.

Manakah diagnosis keperawatan yang tepat? a. Koping individu tidak efektif yang berhubungan dengan stres kelahiran b. Gangguan interaksi sosial yang berhubungan dengan depresi berat c. Koping keluarga yang tidak efektif yang berhubungan dengan depresi mental d. Perubahan peran orang tua yang berhubungan dengan post partum blues e.

Perubahan proses keluarga yang berhubungan dengan depresi maternal 98. Seorang klien yang beradapadafaseaktifpersalinan, hanyamengalamikemajuanpembukaancerviksdari 4 cm menjadi 5 cm dalam 8 jam.

Klientersebutdinyatakandistosiahipotonikdiberikanoksitosin (pitosin) untukmembantu/merangsangkontraksi. Hal yang paling pentingharusdiperhatikanolehperawatsaatiniadalah: a. Monitoring DenyutJantungJanin b. Cek perineum apakahterjadiudem c. PersiapanutukpersalinanSectio d. Mencatatwaktudanlamanyakontraksi e. Menambahdosispitosindanmempercepatjumlahtetesan 99. Seorangkliendenganusiakehamilan 8 minggumengeluhseringkekamarmandiuntuk BAK.

PerawatmenjelaskanbahwapeningkatanfrekuensiBAK padaibuhamildisebabkankarenakapasitaskandungkemih. Selamakehamilankapasitas bladder berkurangakibat a. Otot detrusor mengalamiatonia b. Penekananakibatpembesaran uterus c. Rangsang reflex autonom d.

Penyempitansalurankemih di trigonum e. Adanyapeningkatan hormone kehamilan 100. Ny L, 23 tahun datang ke UGD dengan perdarahan jalan lahir. Mengaku amenorrhea 16 minggu yang lalu. Dari hasil pemeriksaan didapatkan data: TFU 1 jari bawah pusat, kontraksi kuat. Hasil pemeriksaan dalam: portio lunak, pembukaan (+).

Apakah yang dialami oleh Ny L berdasarkan pengkajian yang telah anda lakukan? a. KET b. Molahidatidosa c. Abortus d. PlasentaPrevia e. SolutioPlasenta 101. Nyonya S, 28 tahun datang ke UGD dengan perdarahan jalan lahir. Darah tampak segar dan membasahi kain yang ia gunakan. Dari hasil pemeriksaan didapatkan data: TD 80/60 mmHg, nadi 110x/mnt. pakah tindakan yang harus anda lakukan dengan segera pada klien tersebut?

a. Periksatanda vital b. Berikancairanmelaluiintravena c. Transfusidarah d. Pemeriksaan lab darahlengkap e. Kolaborasipemeriksaan USG 102. Ny K, 35 tahun mengeluh dengan perdarahan jalan lahir. Warna darah merah segar, ia mengaku perdarahan seperti ini bukan untuk yang pertama kalinya. Dari hasil pengkajian didapatkan data sbb: G3P2A0, 34 minggu, L II posisi janin melintang, L III bagian presentasi belum masuk PAP, kontraksi tidak ada.

Apakah yang dialami oleh Ny K berdasarkan pengkajian yang telah anda lakukan? a. KET b. Molahidatidosa c. Abortus d. PlasentaPrevia e.

SolutioPlasenta 103. Ny M, 32 tahun mengeluh dengan perdarahan jalan lahir. Dari hasil pengkajian didapatkan data sbb: G3P2A0, 35 minggu, DJJ 138x/mnt. Sedangkan hasil pemeriksaan pembukaan (+). Apakah intervensi yang dapat anda lakukan pada klien tersebut: a. Kajikehilangandarah b. Kolaborasiuntukterminasikehamilan c. Kolaborasiuntukterapiekspektatif d. Bedrestsampaiusiakehamilan 37 minggu e. Berikandukunganemosional 104.

Ny N, 30 tahun mengeluh perdarahan jalan lahir. Dari hasil pengkajian didapatkan data: usia kehamilan 35 minggu, DJJ 138x/mnt, pembukaan (+). Apakah pertimbangan dari saudara sehingga tidak dilakukan therapy ekspektatif pada Ny N? a. Perdarahansedikit, tidakmengancamibu b. Usiakehamilan< 36 minggu c. TBBJ < 2500 gr d.

Placenta LetakRendah e. Pembukaan (+) 105. Ny C, post partum 6 minggu yang lalu, ia selalu tampak sedih, merasa kehilangan, marah atau frustasi karena bayi yang dilahirkannya lanugo pada bayi baru lahir sesuai dengan harapannya. Apakah yang dialami oleh Ny L berdasarkan tanda dan gejala yang dirasakannya? a. Post partum blues b. Depresi postpartum c. Psikosis postpartum d. Bipolar e. Gangguan mood 106.

Ny B, mengatakan kehamilannya saat ini merupakan kehamilan kedua. Kehamilan sebelumnya ia mengalami keguguran saat usia kehamilannya tujuh bulan. Bagaimanakah status kehamilan Ny B? a. G2P0A1 b. G2P1A0 c. G2P0A0 d. G2P1A1 e.

G2P0A2 107. Ny D datang dengan keluhan pandangan kabur dan pusing. Hasil ananmnesa didapatkan data sbb: G2P1A0, 36 minggu, dari hasil pemeriksaan fisik didapatkan hasil: TD 160/110mmHg. Berapakahdosis MgSO4 40% yang harusdiberikanuntukmencegahkejangpadaNy D? a. 4 gram MgSO4 diberikan IV dalam 20 menit b. Dosisawal 8 gram IM larutan MgSO4 c. Dosisawal 4 gram tiap 4 - 6 jam IM d. Dosisawal 4 gram MgSO4 IM e.

Drip 8 gram MgSO4 tiap 4-6jam Seorang perempuan berusia 26 tahun dengan status kehamilan G1P0A0, umur kehamilan 16 minggu, dirawat di ruang nifas dengan keluhan sering pusing dan pandangan kabur.

Kondisi ini membuat ibu gelisah. Hasil pemeriksaan, tekanan darah ibu 150/100 mmHg, nadi 86x/menit, protein urin (-), kenaikan berat badan selama hamil 4 kg, denyut jantung janin 136x/menit. Apakah tindakan yang harus dilakukan oleh perawat? a. Menyarankan diet tinggi protein b. Kolaborasi pemberian dekstros 5% c. Memberikan informasi tentang kehamilannya d. Mengobservasi tekanan darah e.

Menganjurkan cukup tidur 109. Seorang wanita berusia 30 tahun datang ke poli kebidanan untuk pemeriksaan kehamilan. Hasil pemeriksaan, status kehamilan G2P1A0, usia kehamilan 36 minggu, tinggi fundus uteri 38 cm, dan presentasi kepala. Pasien memiliki riwayat persalinan sectio saecar.Apakah yang harus disarankan kepada pasien tersebut? a. Berhati-hati apabila berhubungan suami isteri b. Mulai intens perawatan payudara c.

Latihan merangkak setiap pagi d. Banyak berjalan kaki e. Diet rendah karbohidrat 110. Seorang wanita berusia 27 tahun dibawa ke UGD karena mengalami perdarahan pasca melahirkan. Pada saat pengkajian di ruang kebidanan, perdarahan sudah tidak muncul, konjungtiva, bibir, dan kuku terlihat pucat, badan lemah, nafsu makan menurun.

Tekanan darah 110/90 mmHg, frekuensi nadi 72 x/menit, frekuensi pernafasan 18 x/menit, Nilai Hb 6,2 g/dL (normal Hb 13-17 g/dL). Apakah diagnosa keperawatan prioritas dari kasus tersebut? a. Pemenuhan nutrisi kurang dari kebutuhan tubuh b. Ketidakefektifan perfusi jaringan perifer c. Defisit volume cairan dan elektrolit d.

Risiko perdarahan ulang e. Penurunan curah jantung 111. Seorang ibu berusia 35 tahun, 6 jam post partum spontan dengan diagnosa Pre Eklampsia Berat dirawat di ruang Nifas. Hasil pengkajian: tekanan darah 180/110 mmHg, frekuensi nadi 90x/menit, frekuensi nafas 26x/menit, mengeluh sesak dan nafas berat.

Apakah tindakan prioritas perawat? a. Mengkolaborasikan obat sesak b. Menganjurkan napas dalam c. Memposisikan semi fowler d. Memberikan terapi O2 e. Melakukan terapi uap 112. Seorang ibu berusia 40 tahun, postpartum hari ke-40, datang ke poli klinik untuk konsultasi penggunaan KB. Dari hasil pengkajian, didapatkan data memiliki 4 anak.

Anak ketiga dan keempat masing-masing berusia 2,5 tahun dan 40 hari. Tekanan darah 140/100 mmHg, nadi 90x/menit, tinggi badan 155 cm, dan berat badan 85 kg. Apakah jenis kontrasepsi yang disarankan pada pasien tersebut? a. Pil b. IUD c. Suntik d. Kondom e. Tubektomi 113. Seorang ibu berusia 25 tahun, primipara hari kelima, datang ke puskesmas dengan keluhan kemerahan pada kedua payudara dan luka pada puting susunya sejak 3 hari yang lalu.

Suhu tubuh ibu 38o C. Breast care sudah dilakukan, tetapi bayi tidak mau menyusu sehingga ibu gelisah dan tidak dapat tidur.Apakah masalah keperawatan prioritas pada pasien tersebut? a. Cemas b. Nyeri c. Infeksi d. Hipertermi e. Gangguan tidur 108. 114. Seorang ibu bersama putrinya yang berusia 17 tahun datang ke Posyandu untuk memeriksanan kehamilan putrinya.

lanugo pada bayi baru lahir

Dari hasil pengkajian didapatkan bahwa kehamilan tersebut diluar nikah dan telah ada usaha untuk menggugurkannya, namun tidak berhasil. Yang dirasakan saat ini adalah mual dan muntah. Apa tindakan perawat selanjutnya a. Merujuk ke psikolog b. Melaksanakan konseling c. Mengobati mual dan muntahnya d. Menyarankan untuk melapor ke Petugas PPA e. Melakukan pendampingan selama kehamilan 115. Ibu post partum, 23 tahun berada di Klinik Bersalin, telah melahirkan bayi laki-laki 30 menit yang lalu dengan berat badan 3800 gram.

Mengeluh nyeri pada jalan lahir. Hasil pemeriksaan, robekan derajat III pada perinium, perdarahan 200 cc, tinggi fundus uteri 2 jari di atas pusat, blast teraba penuh oleh urine.

Apakan tindakan yang diberikan pada pasien tersebut a. Melakukan rujukan ke Rumah Sakit b. Memberikan obat anti perdarahan c. Memasang cateter untuk mengeluarkan urine d. Menjahit luka perinium setelah dilakukan anestesi e. Memasang tampon untuk menghentikan perdarahan 116. Ibu post partum berumur 38 tahun, datang ke klinik kebidanan untuk mendapatkan alat kontrasepsi.

Hasil pengkajian dan pemeriksaan, ibu telah melahirkan secara spontan 40 hari yang lalu, tekanan darah 120/80 mm Hg, pada ekstremitas bawah terdapat varises. Apakah alat kontrasepsi yang di berikan pada pasien lanugo pada bayi baru lahir a. Pil b. IUD c. Suntik d. Kondom e. Implant 117. Seorang ibu hamil berusia 28 tahun datang ke Pusksemas dengan keluhan tidak merasakan gerakan bayinya selama 2 hari. Hasil pemeriksaan dan pengkajian didapatkan ibu tampak lemah, usia kehamilan 28 minggu, G2P0A1, denyut jantung lanugo pada bayi baru lahir negatif, tinggu fundus uteri 2 jari diatas pusat.

Apakah tindakan keperawatan pada pasien tersebut? a. Mengakhiri kehamilan b. Merujuknya ke rumah sakit c. Memperbaiki keadaan umum ibu d.

Menganjurkan untuk istirahat total e. Memberikan rangsangan melalui infus 118. Seorang pasien perempuan berusia 21 tahun berada di Poli Keluarga Berencana dan akan dilakukan pemasangan IUD.

Hasil pemeriksaan didapatkan tekanan darah 120/80mmHg, terdapat pengeluaran darah menstruasiwarnakuningkecoklatan, perawat sudah siap untuk melakukan pemasangan IUD.

Apakah alat yang harus disiapkan untukmembantumeluruskanporsio saat melakukan insersi IUD ? a. Tenakulum b. Flenster klem c. Tampon tang d. Sonde uterus e. Speculum 119. Seorang perempuan berusia 23 tahun, datang kePoli Keluarga Berencana bermaksud inginmengunakanalatkontrasepsiselain IUD, Dari hasil pemeriksaan didapatkan tekanan darah 120/80mmHg,tidakadapembesaran thyroid dan tidak ada varises, terdapat keluaran darah menstruasiwarnakuningbening dan masih menyusui bayinya.

Kontarasepsi apakah yang aman digunakanoleh pasien tersebut ? a. Metode Operasi Wanita (MOW) b. Suntik Depoprovera c. Inplan d. Pil Kombinasi e. Mini Pil 120. Seorang perempuan hamil 2 bulan, datang ke BPM diantar oleh suami dan mengeluh muntah-muntah, apa yang dimakan dan diminum keluar lagi, ibu tersebut tampak sangat lemah, mata cekung, bibir kering. Dari pemeriksaan diperoleh : TD 90 mmHg, nadi 100 x/mnt, suhu normal, nafas 16 x/mnt. Apa kemungkinan diagnosis diatas? a. Dyspepsia b. Emisis Gravidarum c.

Gastritis d. Hipertensi Gravidarum e. Ulkus peptikum 121. Seorang perempuan hamil 8 bulan, datang ke BPM diantar oleh ibunya, mengeluh sering pusing, mata berkunang-kungang, kadang tubuh tidak seimbang. Dari pemeriksaan diperoleh: BP 90 mmHg, nadi 84 x/mnt, nafas 24x/mnt, suhu normal dan pemeriksaan Hb 10gr%. Penatalaksanaan apa yang dilakukan oleh seorang bidan?

a. Menganjurkan untuk istirahat b. Memberikan imunisasi tetanus toksoid c. Memberikan vitamin sulfas ferrous dan vitamin c d. Mengajarkan untuk melakukan senam hamil e. Mengkaji kesiapan dalam manghadapi persalinan 122. Seorang perempuan hamil 8 bulan, datang ke BPM diantar oleh suami dan mengeluh sakit kepala yang sangat hebat dan penglihatan tampak tidak jelas.

Pemeriksaan diperoleh : BP 160 mmHg, nadi 84 x/mnt, suhu 37,5 celcius, nafas 20 x/mnt. Didapati pada tungkai terjadi edema. Dari pemeriksaan urine didapati proteinunria +++. Apa kemungkinan diagnosis diatas? a. Transient hipertensi b. Pre-eklampsi ringan c. Pre-eklampsi berat d.

Hipertensi esensial e. Eklampsi 123. Ibu melahirkan seorang bayi disaat usia kehamilan 39 minggu. Setelah dilakukan pemeriksaan didapati bayi menangis kuat, warna kulit kemerahan, dan gerakan bayi aktif. Berat badan bayi 2.300 gram dan panjang badan 42 cm.

Berdasarkan data diatas apakah diagnosis bayi tersebut? a. BBLR b. BBLER c. BBLSR d. Mikrosomia e. Premature 124. Seorang bayi telah lahir 5 jam yang lalu.

Berat badan bayi saat lahir 2300gran lahir dengan spontan. Hasil pemeriksaan fisik ternyata suhu bayi 36 derajat celcius dan bibir tampak sianosis. Apa kemungkinan diagnosis diatas? a. Evaporasi b. Hipertermi c. Hipotermi d. Konduksi e. Radiasi 125. Seorang bayi telah lahir 5 jam yang lalu. Berat badan bayi saat lahir 2300gran lahir dengan spontan.

Hasil pemeriksaan fisik ternyata suhu bayi 36 derajat celcius dan bibir tampak sianosis. Apa kemungkinan diagnosis diatas? a. Evaporasi b. Hipertermi c. Hipotermi d. Konduksi e. Radiasi SOAL MANKEP 1. Seorang ketua tim yang bertugas di ruang rawat pediatric selama 3 tahun, mendapatkan banyak kritikan mengenai gaya kepemimpinnya yang tradisional. Kepala ruangan pediatrik kemudian mengikutsertakan ia dalam pelatihan kepemimpinan.

Setelah pelatihan, perawat tersebut berusaha untuk mengubah tipe kepemimpinannya menjadi transformasional. Tindakan apakah yang mengindikasikan tipe kepemimpinan transformasional? a. Mengerjakan tugas keperawatan harian b. Berfokus pada pencapaian tugas harian c. Menindak tegas setiap anggota team yang melakukan kesalahan d. Memberikan penghargaan berdasarkan produktivitas kerja e. Mempengaruhi anggota team dengan visi 2. Ruang rawat neuro dengan 12 tempat tidur dan BOR 85%.

Berdasarkan struktur ketenagaan diketahui memiliki kepala ruang dengan jenjang pendidikan S.Kep, pengalaman kerja 5 tahun, 4 Ners dengan pengalaman kerja 2 tahun, 5 Diploma keperawatan dengan pengalaman kerja 3-4 tahun. Ruangan tersebut memiliki ruang gizi dan terdapat 1 tenaga administrasi. Berdasarkan karakteristik perawat yang ada, model pengorganisasian keperawatan yang cocok untuk diimplementasikan adalah a.

Keperawatan Fungsional b. Keperawatan Modular c. Keperawatan team d. Keperawatan Primer e. Manajemen Kasus 3. Seorang Ners, melakukan asuhan pada pasien berusia 19 tahun dengan diagnosa medis gagal ginjal kronis. Perawat mendiskusikan tindakan yang akan dilakukan lanugo pada bayi baru lahir dengan dokter tanpa melibatkan pasien. Prinsip etika apakah yang dilanggar oleh perawat tersebut? a. Autonomy b. Fidelity c. Veracity d. Beneficence e. Confidentiality 4.

Hasil survey kepuasan pasien pada bulan Maret diketahui 65% pasien mengeluhkan komunikasi perawat yang tidak ramah dan terkesan lanugo pada bayi baru lahir.

Manager rawat inap ditugaskan untuk mengadakan pelatihan caring bagi semua staf keperawatan. Sebelumnya ia telah menganggarkan untuk mengirim 2 perawat ke seminar keperawatan nasional. Terkait dengan masalah kepuasan pasien ia mempertimbangkan pengalihan dana seminar untuk pelaksanaan pelatihan caring bagi perawat.

Prinsip etika apakah yang mendasari keputusan manajer tersebut? a. Autonomy b. Fidelity c. Veracity d. Beneficence e. Utility 5. Seorang pasien berusia 84 tahun dirawat dengan diagnosa medis diabetes mellitus. Pasien hanya dijaga oleh anaknya. Berdasarkan hasil operan dengan dinas sore diketahui pasien gelisah dan sering mengaruk-garuk kulitnya.

Setelah diberikan medikasi pasien mulai tenang. Pada jam 1 pagi, perawat melihat pasien kembali menggaruk-garuk kulit tangannya pada saat tidur. Perawat kemudian menanyakan persetujuan dari anak pasien untuk dilakukan pemasangan restrain. Apakah tujuan dari interevensi keperawatan tersebut? a. Membatasi mobilitas pasien b. Meningkatkan kenyamanan tidur pasien c. Mencegah potensi bahaya fisik d. Menciptakan hubungan yang baik antara perawat dan pasien e. Lanugo pada bayi baru lahir aktivitas fisik pasien 6.

Ruang rawat neurologi dengan struktur tenaga Keperawatan yang tersedia 21 perawat, 7 Ners, 5 lulusan D3 dan sisanya SPK.

Berdasarkan data sharing perawat bulan Juni diketahui 5 perawat mengeluhkan kurangnya penghargaan dari pihak manajemen dan seringkali insentif yang diberikan tidak adil. Apakah langkah yang tepat untuk situasi tersebut? a. Memberikan kebebasan dalam pelaksanaan tugas b. Merencanakan evaluasi kinerja secara kontinyu dan objektif c. Menegosiasi peningkatan pendapatan d. Merancang pelatihan secara teratur dan berkala e. Membangun kerjasama kelompok 7.

Pihak manajemen hendak melakukan perubahan di ruang rawat pediatric. Perubahan tersebut sudah dilaksanakan di dua ruang rawat inap dan menunjukan hasil yang baik. Kepala ruang pediatrik perawat berusaha untuk mengimplementasikan perubahan tersebut. Salah satu perawat diruangan dengan pengalaman kerja 2 tahun lebih lama dari kepala ruangan, kesulitan menerima kemungkinan yang baru dan berusaha mempengaruhi staf yang lain untuk menolak perubahan.

Tindakan apa yang tepat untuk menangani situasi tersebut? a. Merotasi ulang lanugo pada bayi baru lahir yang ada b. Memberikan penghargaan bagi semua staf ruangan c. Menetapkan visi dan misi yang jelas d. Menerapkan komunikasi persuasive e. Menegosiasi ulang perubahan dengan pihak manajemen 8. Seorang pasien baru datang dari ruangan Instalasi gawat darurat, sebagai perawat, kita mempunyai kewajiban untuk mampu mengorientasikan pasien baru tersebut.

Apakah tindakan pertamakali yang dilakukan perawat untuk mengorientasikan pasien baru tersebut? a. Menjelaskan discharge planning b. Menyiapkan tempat tidur pasien c. Menjelaskan lanugo pada bayi baru lahir yang merawat d. Menjelaskan fasilitas kesehatan yang ada di RS e. Menjelaskan hak dan kewajiban pasien/ keluarga 9. Seorang perawat sedang persiapan pengelolaan pemulangan pasien yang sudah dinyatakan sembuh atau pulih dari penyakitnya. Apakah prioritas persiapan yang harus dilakukan pada kasus tersebut?

a. Pengkajian kesiapan pasien pulang b. Menyelesaikan administrasi keuangan c. Menyediakan leaflet yang berkaitan dengan perawatan di rumah d. Memberikan pendidikan kesehatan yang sesuai dengan kebutuhan pasien e.

Tersedianya prosedur pemulangan bagi pasien yang membutuhkan tindak lanjut perawatan di rumah 10. Seorang perawat “X” adalah kepala ruang di ICU mengatakan, "Saya tidak punya waktu untuk membicarakan masalah ini dengan Anda sekarang. Lihat saja di kantor saya nanti "saat staf bertanya apakah mereka bisa bicara tentang suatu masalah.

Manakah dari strategi resolusi konflik yang Perawat “X” gunakan? a. Pendekatan yang kompetitif atau negosiasi b. Mengurangi komponen emosional dalam konflik c. Penarikan kepentingan dengan mengacuhkan kepentingan kelompok lain d.

Menentukan tujuan bersama dan bekerja sama dalam mencapai suatu tujuan e. Menunggu suasana tenang dan melanjutkan kembali penyelesaian selanjutnya 11. Ruang X terdiri dari perawat yang berbeda – beda dalam memberikan asuhan keperawatan, perawat ruangan dibagi dengan komposisi tenaga professional, tekhnikal dan pembantu dalam satu grup kecil yang saling membantu.

Metode apa yang digunakan oleh lanugo pada bayi baru lahir perawatan diatas ? a. Moduler b. Fungsional c. Metode Tim d. Penugasan/kasus e. Keperawatan primer 12. Di Bangsal Paviliun, kebanyakan staff perawatnya di usia 50 tahun keatas, percaya diri, sekali kali agresif.

Ns Z, adalah unit manager muda di bangsal pavilium tersebut, merasa tidak nyaman dan percaya dia adalah kambing hitam dari segala sesuatu yang tidak beres di departemennya.

Apakah tidakan yang tepat dilakukan oleh Ns Z? a. a.Mencari bantuan dari direktur keperawatan. b. Terus bekerja secara independen. c. Mengabaikan perasaannya. d. d.Pindah dari bangsal paviliun.

e. Mengidentifikasi sumber konflik dan memahami poin gesekan 13. Ns A adalah kepala ruangan perawatan penyakit dalam, Ns A mempunyai tim: Ns B sebagai Perawat PrimerNs C sebagai Clinical Care ManagerNs D, E, F sebagai perawat associate. Ns C mendapatkan data bahwa sebanyak 25% dokumentasi asuhan keperawatan pasien pada bagian evaluasi tidak lengkap. Siapakah yang harus bertanggung jawab terhadap tugas dokumentasi tersebut ?

a. Ns A b. Ns B c. Ns D d. Ns E e. Ns F 14. Ns A adalah kepala ruangan perawatan bedah. Ns A mempunyai tim yaitu : Ns B sebagai perawat primerNs C sebagai Clinical Care Manager, Ns D sebagai perawat associate. Ns B akan menghadiri rapat penjaminan mutu bulanan karena Ns A tidak bisa hadir sehingga Ns B akan mendelegasikan beberapa tugas asuhan keperawatan kepada Ns D selama menghadiri rapat. Manakah tugas yang boleh didelegasikan oleh Ns B kepada Ns D?

a. Pengkajian b. Perencanaan c. Diagnosis Keperawatan d. Implementasi e. Evaluasi 15. Ruang Melati adalah ruang perawatan penyakit dalam dengan kapasitas 25 TT. Di ruangan tersebut terdapat 22 orang pasien dengan kategori perawatan minimal 3 orang, perawatan parsial 14 orang dan perawatan total 5 orang. Keterangan: kategori minimal; 0.17, kategori parsial: 0.27; kategori total 0,36.

Berapakah kebutuhan tenaga perawat yang dinas pagi berdasarkan kondisi tingkat ketergantungan pasien di ruangan itu dengan rumus Douglas? a. 6 orang b. 7 orang c. 8 orang d. 9 orang e. 10 orang 16. Di ruang perawatan bedah terdapat 6 orang pasien dengan kategori sebagai berikut: 1 orang klien dapat melakukan personal hygiene sendiri, makan sendiri, aktivitas sendiri, 2 orang klien dengan makan dan mandi dibantu dan 17.

18. 19. 20. 21. 22. memakai infuse serta kateter urine, serta 3 orang memerlukan observasi TTV dan perubahan posisi setiap 2 jam Berapakah Jumlah pasien dengan kategori perawatan parsial? a. 1 orang b. 2 orang c. 3 orang d. 4 orang e. 5 orang Ns A adalah kepala Ruangan perawatan anak. Ns A mempunyai tim: Ns B adalah ketua tim, Ns C dan D adalah perawat pelaksana.

Ns A Membagikan tugas kepada setiap staf perawat. Ns B mendapat tugas untuk memimpin timbang terima pada setiap pergantian shift. Ns C dan D mendapat tugas untuk melaksanakan asuhan keperawatan kepada pasien. Manakah dari fungsi manajemen yang sesuai dengan kegiatan Ns A tersebut? a. Perencanaan b. Pengorganisasian c. Staffing d. Pengarahan e. Pengawasan Nurse A sebagai kepala ruangan perawatan anak melakukan audit terhadap kejadian phlebitis, infeksi nosokomial setiap bulan. Setelah dilakukan rekapitulasi didapatkan hasil bahwa angka kejadian phlebitis meningkat sebanyak 10% dan kejadian infeksi perkemihan meningkat sebanyak 5%.

manakah fungsi manajemen yang tepat pada kegiatan Ns A tersebut? a. Perencanaan b. Pengorganisasian c. Staffing d. Pengarahan e. Pengawasan Nurse A sebagai perawat primer (PP) melakukan kegiatan bimbingan terhadap staf perawat pelaksana dengan mengkaji dan melihat laporan dokumentasi asuhan keperawatan pasien di ruangan serta memberikan feed back kepada staf yang melakukan dokumentasi kegiatan tersebut.

Apakah kegiatan yang dilakukan oleh Ns A? a. Lanugo pada bayi baru lahir tidak langsung b. Supervise langsung c. Memberi motivasi d. Pembimbingan e. Pengawasan Sebuah Puskesmas menyelenggarakan pelayanan kesehatan kepada masyarakat. Pengunjung di Puskesmas mengeluhkan sikap petugas kesehatan yang tidak cepat tanggap terhadap kebutuhan pasien seperti lamanya waktu menunggu untuk diperiksa oleh dokter atau menunggu obat dari apotik.

Apakah dimensi mutu yang muncul pada kasus diatas? a. Tangible b. Accses c. Responsiveness d. Comfort e. Complete Pada sebuah ruangan rawat inap penyakit bedah didapatkan laporan dari keluhan pasien bahwa perilaku perawat kurang ramah, Ns A sebagai kepala ruangan ingin menerapkan sebuah ide kepada seluruh staf nya untuk menunjukan perilaku caring kepada pasien, Ns A mengumpulkan data tentang motivasi semua staf perawat dalam pelaksanaan caring kepada pasien.

Apakah fase yang tepat pada tahap perubahan kegiatan Ns A tersebut ? a. Unfreezing b. Moving c. Refreezing d. Freezing e. Motivating Pada sebuah ruangan rawat inap penyakit dalam didapatkan data angka flebitis di ruangan meningkat sebanyak 10%. Setelah melakukan pengkajian, Nurse A sebagai kepala ruangan bermaksud mengadakan rapat dan mengajak seluruh staf nya untuk berkumpul dan mendiskusikan permasalahan tersebut untuk mencari solusinya.

Apakah gaya kepemimpinan yang tepat pada kasus diatas? a. Gaya kepemimpinan otokratis 23. 24. 25. 26. 27. 28. b. Gaya kepemimpinan permisif c. Gaya kepemimpinan laissez faire d. Gaya kepemimpinan demokratis e. Gaya kepemimpinan directing Seorang kepala ruang Penyakit Bedah Saraf mengelola 20 perawat pelaksana dengan kapasitas 30 tempat tidur.

kepala ruang membuat struktur, serta menentukan jenis pemberian asuhan keperawatan dengan menggunakan metode tim. Apakah proses manajemen yang sedang diterapkan oleh kepala ruang tersebut? a. Perencanaan b. Pengorganisasian c. Kepersonaliaan d. Pengarahan e. Pengendalian Kapasitas ruangan bedah Syaraf adalah 50 tempat tidur dengan rata-rata BOR 90%. Perawat pelaksana yang bertugas di ruangan tersebut adalah berjumlah 10 orang.

Metode asuhan keperawatan yang manakah cocok dengan kondisi seperti itu?Apakah proses manajemen yang sedang diterapkan oleh kepala ruang tersebut? a. Metode keperawatan fungsional b. Metode keperawatan tim c. Metode keperawatan primer d. Metode keperawatan manajemen kasus e. Metode Keperawatan Modular Seorang Kepala Ruang ICCU, menemukan perawat yang sedang mengalami kesulitan dalam memasang infus, kemudian Kepala ruangan tersebut membantu dalam memasang infus.

Apakah fungsi yang sedang dilakukan oleh kepala ruangan tersebut? a. Supervisi b. Koordinasi c. Evaluasi d. Edukasi e. Komunikasi Ruang rawat inap bedah orthopedi berjumlah 22 pasien, dengan klasifikasi sebagai berikut: 3 pasien dgn perawatan minimal, 14 pasien dengan perawatan parsial dan 5 pasien dengan perawatan total.

Berapakah jumlah perawat yang dibutuhkan untuk dinas pagi? a. 3 b. 4 c. 5 d. 6 e. 7 Ruang rawat inap bedah orthopedibedi berjumlah 22 pasien, dengan klasifikasi sebagai berikut: 3 pasien dgn perawatan minimal, 14 pasien dengan perawatan parsial dan 5 pasien dengan perawatan total. Berapakah jumlah perawat yang dibutuhkan untuk dinas sore?

a. 3 b. 4 c. 5 d. 6 e. 7 Ruang rawat di rumah sakit akan mengadakan suatu perubahan dalam pendokumentasian asuhan keperawatan. Dalam menghadapi hal tersebut kepala bidang keperawatan mengadakan rapat bersama perawat ruangan dan menginformasikan rencana kegiatan tersebut. Kegiatan yang dilakukan oleh kepala bidang keperawatan dalam proses perubahan berada pada fase : a.

Unfreezing b. Implementasi c. Moving d. Orientasi e. Refreezing 29. Hasil pelatihan yang dilakukan oleh kepala bidang keperawatan ditindaklanjuti dengan pendampingan kepada seluruh perawat dalam pendokumentasian asuhan keperawatan. Pada tahap selanjutnya kepala bidang keperawatan berusaha untuk tidak terlibat secara langsung dalam kegiatan dan menyerahkan kegiatan kepada perawat yang sudah dipercayainya mampu melaksanakan kegiatan tersebut.

Kepala bidang keperawatan saat ini bertugas hanya sebagai konsultan bagi perawat.Berdasarkan teori dari Lippits, kegiatan yang dilakukan oleh kepala bidang keperawatan berada pada fase perubahan a. Menentukan masalah b. Mengkaji motivasi dan kapasitas perubahan c. Menyeleksi tujuan perubahan d. Memilih peran yang sesuai e. Mengakhiri bantuan 30. Seorang perawat memarahi rekan perawat yang lainnya dikarenakan tindakan keperawatan yang dilakukan rekannya tersebut dianggap salah.

Dikarenakan hal tersebut timbullah konflik antara kedua perawat tersebut. Langkah yang dilakukan oleh salah satu perawat adalah dengan jalan, berusaha untuk menjauhi perawat yang memarahinya. Mekanisme penanganan konflik yang digunakan oleh perawat tersebut adalah : a. Kompromi b.

Negosiasi c. Kompetisi d. Akomodasi e. Menghindar 31. Di ruangan intensif, seorang perawat merawat 1 orang pasien secara holistik pada dinas pagi, kegiatan yang dilakukannya seluruh kegiatan apapun yang dibutuhkan oleh pasien tersebut.

Keesokan harinya perawat tersebut merawat pasien lainnya sama seperti pasien sebelumnya. Kemungkinan metode penugasan yang digunakan oleh perawat tersebut a. Tim b. Primer c. Kasus d. Fungsional e. Modular 32. Di salah satu ruang rawat dengan jenis perawatan penyakit dalam, terdapat 18 orang perawat pelaksana dan 1 orang kepala ruangan.

lanugo pada bayi baru lahir

Jenjang pendidikan dan lama kerja serta keahlian dari perawat di ruangan tersebut bervariasi.Ruangan akan mencoba menerapkan model asuhan keperawatan profesional. Metode yang cocok untuk kondisi tersebut di atas adalah : a.

Metode kasus b. Perawatan tim c. Perawatan primer d. Manajemen kasus e. Metode fungsional 33. Seorang perawat ditunjuk oleh rumah sakit untuk menjalankan model keperawatan primer, dalam melaksanakan kegiatannya perawat tersebut melakukan asuhan keperawatan kepada pasien kelolaannya.ada saat pasien mengalami panas, tindakan apa yang seharusnya dilakukan oleh perawat primer tersebut a.

Meminta pendapat dokter tentang tindakan yang harus dilakukan b. Berdiskusi dengan dokter tentang obat yang akan diberikan c. Memberikan obat sesuai permintaan dokter d.

Menghubungi dokter untuk pemberian obat e. Meminta kepada perawat pelaksana untuk langsung memberikan obat 34. Hasil analisis kelemahan didapatkan bahwa ruangan mengalami kekurangan tenaga keperawatan dan tenaga keperawatan yang adapun dengan tingkat pendidikan D3 Keperawatan dan SPK.

Dilain fihak pada aspek eksternal 35. 36. 37. 38. 39. didapatkan data bahwa ruangan tersebut sering digunakan oleh institusi pendidikan untuk proses belajar di lapangan. Rencana strategis yang sesuai dengan kekuatan dan peluang di atas adalah a.

Melibatkan mahasiswa sebagai perawat pembantu dalam melaksanakan asuhan keperawatan b. Meminta kepala bidang keperawatan untuk menambah jumlah tim keperawatan c. Meningkatkan tingkat pendidikan perawat pelaksana d.

Membuat surat persetujuan bersama untuk meningkatkan jumlah perawat e. Mengajukan pertambahan jumlah tenaga kepada kepala rumah sakit Hasil perawatan didapatkan bahwa seorang pasien mengalami keadaan yang sangat kompleks, perawat yang merawat pasien tersebut merasa bingung untuk menentukan intervensi yang akan dilakukan.

Pada saat operan dilaporkan kegiatan dari kondisi pasien tersebut, dan disepakati untuk melakukan kegiatan ronde keperawatan. Tindakan awal untuk pelaksanaan ronde keperawatan adalah a. Meminta persetujuan dari pasien dan keluarga untuk berdiskusi di depan pasien b. Menjelaskan kondisi riil pasien secara langsung c. Meminta kepala ruangan untuk mendampingi saat dilakukan intervensi d.

Berdiskusi langsung didepan pasien e. Menjelaskan kepada kepala ruangan dan tim tentang kondisi pasien Perawat di ruangan sedang melakukan kegiatan timbang terima yang dilanjutkan dengan diskusi kasus di ruangan. Pada saat berdiskusi timbullah perdebatan antar satu perawat dengan perawat yang lain, dimana ada perawat yang mendominasi dari setiap diskusi.

Kegiatan yang termasuk dalam perilaku asertif a. Menjadi pendengar yang atentif b. Ikut berbicara saat orang lain berdebat c. Memberikan masukan dengan penuh percaya diri d. Mementingkan keberhasilan tanpa melihat proses e. Menunjukkan kemampuan dalam tindakan Perawat A dan B mengalami konflik yang berhubungan dengan pekerjaannya. Perawat A pada awalnya tidak mengetahui bahwa rekannya memusuhi dirinya dan dia melaksanakan tugas sesuai dengan kegiatan yang biasa dilakukannya dikarenakan dia merasa konflik yang ditimbulkan sangat tidak penting dan jika dia masuk ke dalam konflik tadi malah bisa menyebabkan penurunan kinerjanya.

Mekanisme penanganan konflik yang dilakukan perawat A adalah a. Penghindaran b. Akomodasi c. Kolaborasi d. Konfrontasi e. Kompromi Pada satu ruangan untuk penanganan pasien di Ruang Bedah dibentuk suatu tim beranggotakan Perawat Primer, dokter, ahli gizi, fisioterapi dan farmasi yang bekerja bersama untuk menangani pasien tertentu.

Dalam hal ini sudah dibuat aturan bersama diantara anggota tim kesehatan di atas untuk pengelolaan pasien.Jenis model asuhan keperawatan profesional yang diterapkan lanugo pada bayi baru lahir ruangan bedah tersebut a.

Manajemen kasus b. Metode kasus c. Metode Fungsional d. Metode Tim e. Keperawatan Primer Kepala bidang keperawatan merencanakan akan menerapkan pengelolaan model asuhan keperawatan secara tim kepada satu ruang rawat, saat akan diterapkan timbul penolakan dari kepala ruangan yang menganggap metode tim itu menyita waktu dan hanya menambah beban kerja saja. Mekanisme perubahan paling tepat untuk mengurangi faktor penghambat tersebut dalam jangka waktu pendek, diantaranya dengan cara a.

Menempatkan perawat ahli untuk menjadi pengganti kepala ruangan b. Sharing pemikiran kepada kepala ruangan 40. 41. 42. 43. 44. c. Menyekolahkan kepala ruangan ke jenjang lebih tinggi d. Membuat kursus pelaksanaan model asuhan keperawatan e. Melibatkan kepala ruangan dalam pengambilan keputusan Seorang supervisor (penyelia) melakukan kegiatan supervisi dengan mengitari seluruh ruangan yang menjadi tanggung jawabnya. Pada saat masuk ke satu ruangan didapatkan perawat sedang tertidur di ruangan dan tidak ada yang terjaga untuk mengobservasi pasien.

Teknik supervisi yang dilakukan oleh supervisor tadi jika menggunakan pendekatan kemanusiaan adalah a. Menuliskan dalam laporan tentang kejadian tertidurnya perawat b.

Membangunkan perawat dan memberi pengarahann kepada perawat tersebut c. Melaporkan kepada unit yang berhubungan dengan etika d. Menghukum perawat sesuai dengan kadar kesalahannya e. Memberikan penghargaan kepada perawat lain yang tidak tertidur Kepala bidang keperawatan merencanakan akan menerapkan pengelolaan model asuhan keperawatan secara tim kepada satu ruang rawat, saat akan diterapkan timbul penolakan dari kepala ruangan yang menganggap metode tim itu menyita waktu dan hanya menambah beban kerja saja.

Kepala ruangan tersebut malah pada akhirnya berkonflik dengan kepala bidang keperawatan. Kepala bidang keperawatan menganggap bahwa pelaksanaan model tersebut penting untuk dilakukan segera, dan jika tidak dilakukan akan menyebabkan asuhan keperawatan kepada pasien menjadi terkendala, mekanisme konflik yang tepat dilakukan oleh kepala bidang keperawatan adalah a. Menghindarkan konflik dengan kepala ruangan dan meminta kepala ruangan tetap melaksanakan asuhan keperawatan b.

Mengundang seluruh kepala ruangan dan melakukan diskusi pemecahan masalah bersama c. Meminta kesediaan kepala ruangan untuk tetap melakukan kegiatan asuhan keperawatan dengan model yang ditentukan oleh kepala ruangan d. Menggantikan kepala ruangan dengan perawat lain yang mempunyai pemahaman yang sama dengan kepala bidang keperawatan e.

Membuat kebijakan secara tertulis berikut hukuman bagi yang tidak melaksanakan model yang telah ditetapkan oleh rumah sakit Satu ruang rawat dengan metode tim, dimana untuk tim 1beranggotakan 7 orang perawat (termasuk ketua tim), saat ini untuk dinas pagi yang bertugas adalah perawat A,B,C,D.

Jika terdapat 15 orang pasien maka pasien yang nomor 10 dirawat oleh perawat: a. Ketua tim b. Perawat A dan B c. Perawat C dan D d. Hanya perawat A e. Seluruh perawat yang berdinas pagi Saat merawat pasien dengan penyakit TBC perawat menegakkan diagnosa keperawatan Bersihan jalan nafas tidak efektif yang berhubungan dengan peningkatan produksi sekret ditandai klien mengeluh sesak, RR 32x/menit, pernafasan cuping hidung.

Ketidakseimbangan nutrisi : kurang dari kebutuhan tubuh yang berhubungan dengan peningkatan produksi sekret ditandai klien mengeluh nafsu makan menurun, BB turun 4 Kg selama 1 bulan terakhir, porsi makan klien 3 sendok.

Melihat dari kasus di atas terdapat suatu a. Kurang memenuhi kaidah PES b. Etiologi dari kedua diagnosa sama c. Batasan karakteristik untuk diagnosa kedua tidak terlihat d. Diagnosa keperawatan No. 1 seharusnya memakai faktor risiko e. Label pada diagnosa lanugo pada bayi baru lahir terbalik Pasien (25 tahun) datang ke rumah sakit A dengan keluhan Keluar darah pada hidung, mencret (BAB >10 x dalam 1 hari).

Hasil pemeriksaan fisik didapatkan :  Pemeriksaan Tanda Vital : T = 40°C, P = 120 x/menit, R = 20 x/menit, S = 90/60 mmHg.  TB = 165 cm, BB = 60 Kg.  Minum Peroral = 500 cc/24 jam, Muntah = + 50 cc, BAK = 400 cc/menit 45.

lanugo pada bayi baru lahir. 47. 48. 49. 50. Saat ini klien akan diberikan obat yaitu Amoxicillin 250 mg, Infus RL = 2 liter/24 jam (makro = 20) Dengan kondisi hipertermi, berapa penambahan cairan yang dibutuhkan Tn. X. a. 37,5 cc b. 500 cc c. 900 cc d. 1200 cc e. 1500 cc Seorang pasien 67 tahun dirawat di ruang kritis setelah pelaksanaan operasi aneurisma arteri abdominalis, pemasangan NGT sudah dilepas dan sekarang dicoba untuk makan makanan lunak, empat hari setelah pembedahan, pasien mengeluhkan nyeri yang tak tertahankan pada area abdomennya, dan saat buang air besar fesesnya berwarna merah gelap.

Apa yang harus dilakukan pertama kali oleh perawat a. Auskultasi bising usus b. Pasang kembali NGT c. Periksa feses dan darah d. Kolaborasikan dengan dokter e. Lakukan enema Di Ruang Perawatan Penyakit Dalam dewasa, dengan kapasitas 50 tempat tidur. BOR (tingkat Hunian) dalam 3 bulan terakhir 80%; sebaran tingkat ketergantungan sebagai berikut : Tingkat ketergantungan mandiri 30%, ketergantungan sebagian 50% dan ketergantungan total 20% dari BOR. Untuk meningkatkan kualitas pelayanannya ruang rawat berencana mengaplikasikan model asuhan keperawatan professional.

Untuk dapat mengetahui kondisi internal ruang rawat yang akan dijadikan dasar penentuan jenis model yang cocok, analisis yang dilakukan berupa a. Analisis kekuatan yang ada di ruang rawat b. Menggali potensi pelaksanaan kegiatan c.

Menggali peluang dan kebijakan dari rumah sakit d. Mengkaji tantangan yang muncul dari aplikasi model e. Telaah hambatan pelaksanaan model asuhan yang sudah ada Ns.X bekerja di unit hemodialisa, memiliki keterampilan, pengalaman dan pengetahuan dalam rangka mencapai tujuan unit hemodialisa, dan ditunjuk oleh organisasi Rumah Sakit untuk memimpin, mengatur, mengelola, mengembangkan kegiatan dan mengelola unit lanugo pada bayi baru lahir karena sudah bekerja selama 3 tahun.

Apakah peran yang akan dilakukan oleh Ns. X? a. Supervisor b. Owner c. Manajer d. Leader e. Follower Ns. X, menyusun rencana aktivitas dengan membuat suatu strategi untuk tujuan jangka pendek dan lanugo pada bayi baru lahir panjang pada unit hemodialisa. Apakah fungsi manajemen yang sedang dilaksanakan oleh Ns. X? a. Mengendalikan (Controlling) b. Pengkoordinasian (Coordinating) c.

Pendayagunaan (Empowering) d. Pengorganisasian e. Perencanaan (Planning) Ns. Y, lulus satu tahun yang lalu dari pendidikan diploma keperawatan dan langsung diterima sebagai pegawai tenaga di Rumah Sakit karena keterbatasan sumber daya khususnya sebagai ketua tim, tetapi ia mempunyai keinginan yang kuat untuk belajar dan sangat bersemangat. Pengalamannya sangat minimal, Ns. Y ditunjuk sebagai ketua tim yang beranggotakan empat orang, Ns dengan latar belakang pendidikan diploma, bekerja sebagai tenaga Ns kontrak selama 3 tahun.

Model kepemimpinan manakah yang sebaiknya digunakan oleh Ns. Y saat membimbing staffnya? a. Autokratis b. Demokratis c. Ditaktor d. Laissez faire Ns. Y, melewati jalan tol setelah mengantar pasien ke Rumah Sakit, terjadi tabrakan dua pengendara motor. Satu pengendara mengalami luka parah pada ektremitas kiri bawah dan tampak kesakitan.

Sedangkan satu pengendara lagi 51. 52. 53. 54. 55. 56. 57. mengalami perdarahan dan tidak sadarkan diri. Korban harus segera ditangani untuk menghentikan pendarahan. Pendekatan apakah yang paling tepat untuk mengambil keputusan apabila saudara berada pada kondisi diatas? a. Autokratis b. Demokratis c. Ditaktor d. Laissez faire Ns. A, mengadukan seorang dokter kepada kepala ruangan karena dianggap telah melakukan penghinaan terhadapnya. Ns. A, karena dokter bersikap bahwa dirinyalah yang paling benar.

Apa strategi penyelesaian masalah yang sebaiknya digunakan dalam menyelesaikan konflik tersebut? a. Akomodasi, kolaborasi b. Kolaborasi, menghindar c. Menghindar, kompetisi d. Negosiasi, smoothing e. smoothing, akomodasi Seorang kepala ruangan menjadi mediator dalam konflik antara ners dan dokter yang bekerja diruangan yang dipimpinnya. Apa jenis kegiatan yang sedang dilakukan oleh kepala ruangan? a.

Perencanaan b. Pengorganisasian c. Pengarahan d. Pengendalian e. Pengajaran Seorang kepala ruangan membagi jumlah perawat yang bekerja disetiap shift berdasarkan tingkat ketergantungan pasien yang berada diruang rawat. Apa metode pembagian tugas yang digunakan perawat dalam melakukan pembagian kerja diruang rawat tersebut. a. Depkes b. Douglas c. Gillies d. Hurchinsan e. Minetti Pada sebuah ruangan Rumah Sakit setiap perawat memiliki tugas masing-masing. Ada perawat yang pekerjaannya khusus melakukan injeksi, memberikan penkes, dan melakukan askep.Apa metode penugasan yang digunakan oleh ruang rawat tersebut?

a. Metode alokasi pasien b. Metode fungsional c. Metode modulan d. Metode primer e. Metode tim Dalam rangka meningkatkan kualitas layanan askep, kepala ruangan menugaskan perawat diruangannya untuk mengikuti pelatihan intensive wound care/luka. Apa tahapan manajemen yang sedang dilakukan oleh kepala ruangan? a. Pengarahan b. Pengawasan c. Pengendalian d. Pengorganisasian e. Perencanaan Ns. N, kepala ruangan HCU, mengatakan kepada bawahannya. Ns. N, membuat semua keputusan untuk bagiannya dan semua bawahan.

Apakah gaya kepemimpinan yang diterapkan oleh kepala bangsal tersebut? a. Demokratis b. Laissez-faire c. Autokratis d. Situasional e. Fungsional Perawat menyatakan bahwa ada keributan yang meningkat antara staf, karena keletihan yang disebabkan banyaknya pasien dalam satu bangsal dan kekurangan staf.

Apakah tindakan yang paling utama atau prioritas untuk kondisi diatas? a. Mengembangkan rencana dan menerapkannya b. Memulai interaksi kelompok 58. 59. 60. 61. 62. 63. c. Mengidentifikasi kekuatan eksternal dan internal d.

Menganalisis hasil keseluruhan keributan e. Mengintervensi bantuan pada medis Ruang medical surgical terdiri dari beraneka ragam perawat dalam memberikan asuhan keperawatan. Perawat ruangan dibagi dengan komposisi tenaga professional, tehnikal dan pembantu dalam satu kelompok kecil yang saling membantu.

Metode apa yang digunakan oleh ruang perawat diatas? a.

lanugo pada bayi baru lahir

Fungsional b. Penugasan c. Kasus d. Metode tim e. Keperawatan primer Seorang paienn mengeluh tiap 5 menit memanggil perawat untuk mendengarkan permintaannya.Apa metode pembagian tugas yang digunakan perawat dalam melakukan pembagian kerja diruang rawat tersebut.

a. Depkes b. Douglas c. Gillies d. Hurchinsan e. Maxwell Direktur keperawatan RS dalam rapatnya membahas metode asuhan keperawatan. Supervisor dan incharge mengadakan suatu komunikasi mengdiskusikan metode asuhan keperawatn yg dipakai dengan berpendapat: Supervisor: Metode keperawatan primer adalah model pemberian asuhan keperawatan yg terbaik, terdiri dari perawat yg berpendidikan S2, S1 & profesi ners (paling banyak) dan Diploma plg sedikit.

Incharge: Sangat setuju dgn pendapat supervisor. Karena perawat akan berupaya meningkatkan kemampuannya dan lebih bertanggung jawab terhadap pelayanan asuhan keperawatn yg diberikan.Apakah pola komunikasi yang terjadi antara supervisor dan incharge. a. Komunikasi antara pimpinan dengan pimpinan b. Komunikasi antara pimpinan dengan bawahan c. Komunikasi antara bawahan dengan bawahan d. Komunikasi antara bawahan dengan pimpinan e.

Komunikasi antara Direktur dengan pimpinan Ns. X, menangani beberapa pasien dalam tanggung jawabnya sebagai perawat di shift pagi. Salah satu pasiennya sering mengeluh, dan setiap 5 menit si pasien akan pencet bell dan memanggil ns X untuk mendengarkan keluhannya dan permohonannya. Ns X, mulai terasa terganggu karena tugas melayani pasien yg lain sbg tanggung jawabnya terbengkalai. Supervisor keperawatan menegur dan marah kepada Ns X, karena mengetahui pasien yang lain terbengkalai. 5 menit kemudian terdengar bell, memanggil Ns X untuk mendengarkan keluhan pasien tersebut.

Apakah respon yang paling tepat saat anda menjawab panggilan pasien tersebut? a. Maaf ya bu, Saya sedang sibuk. b. Maaf, saya tidak bisa menemui ibu. c. Maaf, setelah 15 menit baru saya bisa menemui ibu. d. Maaf, saya punya banyak pasien yang perlu dirawat, apa yg plg penting yg bisa saya lakukan? e. Maaf ya bu< saya sudah 4x menemui ibu, saya harus menemui pasien yg lain dulu. Ns Y, sedang mengerjakan charting yang sangat penting untuk ditulis.

Beberapa teman anda tanpa diduga datang mengunjungi anda di bangsal, sedangkan saat itu anda benar benar ingin menyelesaikan pekerjaan anda. Apakah respon anda kepada teman teman anda? a. Menyambut kedatangan teman anda dan minta maaf untuk kesibukannya. b. Menyambut kedatangan teman anda dan membiarkan mereka melihat lihat. c. Menyambut kedatangan teman anda dengan marah, karena teman anda tidak memberitahu. d. Menyambut kedatangan teman anda dengan menjelaskan dimana anda sdg sibuk dan mengatur kembali waktu pertemuannya.

e. Menyambut kedatangan teman anda tetapi pekerjaan anda tetap diteruskan. Di Bangsal Paviliun, kebanyakan staff perawatnya di usia 50 tahun keatas, percaya diri, sekali kali agresif.

Ns Z, adalah unit manager muda di bangsal pavilium tersebut, merasa tidak nyaman dan percaya dia adalah kambing hitam dari segala sesuatu yang tidak beres di departemennya. Apakah tidakan yang tepat dilakukan oleh Ns Z? a. Mencari bantuan dari direktur keperawatan. b. Terus bekerja secara independen. c. Mengabaikan perasaannya.

d. Pindah dari bangsal paviliun. e. Mengidentifikasi sumber konflik dan memahami poin gesekan 64. Fungsimanajemen yang sedangdilakukanolehkepalaruangantersebutdiatas, adalah… a. Perencanaan b. Pengorganisasian c. Pengarahan d. Pengawasan e. Penilaian 65. Apakahmetodepenugasanasuhan keperawatan yang digunakan diruangrawattersebut ? a. Metode tim b. Metode kasus c.

Metode primer d. Metode moduler e. Metode fungsional 66. Bagiankepegawaian RS, merekrutperawatbaruuntukruangrawatinap ICUKualifikasiperawatadalah : Pendidikan D3 Keperawatan, memilikisertifikatpelatihan ICU. Apakah tujuan perlunya kualifikasi tersebut?

a. Memudahkan koordinasi kegiatan b. Memudahkan dalam spesialisasi kerja c. Mengelola sumber daya yang potensial d. Memprediksi jumlah tenaga yang trampil e. Meningkatkan standar mutu keperawatan 67. Seorang perawat Ners telah bekerja di ruangan selama 15 tahun.

Perawat tersebut berperan juga sebagai instruktur klinik bagi mahasiswa praktik. Perawat tersebut memiliki kebiasaan datang terlambat, sering tidak masuk tanpa alasan yang jelas. Apakah yang harus dilakukan oleh kepala ruangan tersebut ?

A. Melakukan pengajuan untuk dilakukan rotasi B. Melakukan penggantian tugas bimbingan mahasiswa C. Melakukan komunikasi peningkatan motivasi D. Melakukan teguran secara lisan maupun tertulis E. Melakukan aturan kedisiplinan 68. Seorang laki-laki berusia 15 tahun dibawa ke UGD oleh temannya karena mengalami kecelakaan saat pulang sekolah. Hasil pengkajian didapatkan tekanan darah 120/80 mmHg, nadi 80 x/menit, pernafasan 18 x/menit, suhu 37 derajat celcius, terdapat fraktur tertutup 1/3 radius tibia.

Oleh dokter akan dilakukan pemasangan gips. Apakah yang harus dilakukan perawat untuk meminta persetujuan tindakan (informed consent ) ? A. Meminta persetujuan temannya B. Meminta persetujuan polisi yang mengantar C. Menghubungi segera kedua orang tuanya D.

Langsung melakukan tindakan E. Menunda melakukan tindakan sampai orang tuanya datang 69. Seorang kepala ruangan penyakit bedah sedang mengitung kebutuhan perawatberdasarkan derajat ketergantungan menurut Douglas, pasien pada hari itu15 orang dengan klasifikasi 6 pasien minimal care, 7 pasien partial care dan 2 pasien total care.Berapakah perawat yang dibutuhkan untuk jaga pagi pada hari itu ?

A. 2 orang perawat B. 3 orang perawat C. 4 orang perawat D. 5 orang perawat E. 6 orang perawat 70. Seorang laki-laki berusia 25 tahun dirawat di ruang bedah karena menjalani fraktur femur terbuka. Perawat yang bertanggung jawab mempersiapkan obat dan langsung ke pasien untuk melakukan perawat luka tanpa memberi tahu terlebih dahulu. Hal tersebut diketahui kepala ruangan.Apakahyang harus dilakukan oleh kepala ruanganterhadaperawattersebut ? A. Menyarankan untuk mencuci tangan terlebih dahulu B.

Menegur perawat pelaksana tersebut. C. Menjelaskan tentang infeksi nosokomial D. Menjelaskan pentingnya cuci tangan E. Menjelaskan standar prosedur ganti balutan 71. PerawatRoni, adalahseorangners, ditunjukuntukmemimpin, mengatur, mengelola, mengendalikandanmengembangkanruanganrawatinapklinikamanahkarenadianggapmemilikipengalaman, pengetahuan, danketerampilandalamrangkamencapaitujuanklinikamanahyaknimenjadiklinik yang terdepandanterpercayabagimasyarakat.

Apakahperanyang sedangdilakukannersRoni? a. Follower b. Supervisor c. Leader d. Manajer e. Owner 72. Perawat Dina berupayamengantisipasikecenderungan di masa yang akandatangdanmenentukanstrategisertataktik yang tepatmelaluipenetapantujuanjangkapendekdanjangkapanjangpadaruangrawat yang iapimpin.

Apakahfungsimanajemen yang sedangdilaksanakanolehPerawat Dina? a. lanugo pada bayi baru lahir b. Pengorganisasian c. Pendayagunaan d. Menggerakkan e. Mengendalikan 73. Ruang Topaz RSU sumbersehat terdiri dari perawat yang berbeda – beda dalam memberikan asuhan keperawatan, perawat ruangan dibagi dengan komposisi tenaga professional, tekhnikaldanpembantudalamsatugrupkecil yang salingmembantu.Metode apa yang digunakan oleh ruang perawatan diatas ?

a. Fungsional. b. Penugasan/kasus. c. Metodetim. d. Keperawatan primer. e. All out nursing 74. Andaberadadalammobil ambulance bersamadua orang staff andadalamperjalananpulangsetelahmengantarpasienkerumahsakitrujukan. Saatmelewatijalan X, terjaditabrakan yang melibatkanduapengendara motor. Satupengendaramengalamilukaparahpadaekstremitaskananbawahdannampakkesakitan.

Sedangkansatupengendaralagimengalamiperdarahandantidaksadarkandiri. Korbanharussegeraditanganiuntukmenghentikanperdarahan. Apabilasaudaraberadapadakondisidiatas, pendekatanapakah yang paling tepatsaatmengambilkeputusan? a.

Diktaktor b. Autokratis c. Demokratis d. Laissez faire e. Modifikasi 75. NersYanto ditugaskan untuk mengelola unit trauma centerdi sebuah rumah sakit. Nersyantomelihatbahwabanyak staff yang ada yang memilikikemampuandanpengalaman yang cukupbaikdalampelayanan trauma center, iajugayakin bahwa semua anggota staf membantu dalam pengambilan keputusan dan pengembangan tujuan unit. Apa gaya kepemimpinan yang diterapkan nersYanto? a. Demokratis 76. 77. 78. 79. 80. 81. 82. b. Laissez-faire c. Otokratis d.

Situasional e. Amanah Melanjutkan proyek pekerjaan anda sementara teman-teman anda sedang menikmati hidangan yang disajikan? a. Menangguhkan proyek anda, menyambut kedatangan mereka dan minta maaf untuk ruangan yang berantakan b. Menyambut kedatangan mereka untuk kemudian membiarkan teman-teman anda asyik menonton Film yang anda putar c.

Dengan keras marah pada teman-teman anda karena tidak melepon lebih dulu d. Menjelaskan bahwa anda sedang mengerjakan proyek penting dan mengatur kembali waktu bertemu yang tepat bagi semuanya Perawat “X” adalah Unit Manager muda Bangsal Pediatric. Kebanyakan perawat stafnya senior, sangat artikulatif, percaya diri dan kadang-kadang agresif. Perawat “X” merasa tidak nyaman percaya bahwa dia adalah kambing hitam dari segala sesuatu yang tidak beres di departemennya.

Apakah tindakan yang tepat dilakukan oleh Perawat “X” ? a. Mengidentifikasi sumber konflik dan memahami poin gesekan b. Mengabaikan apa yang dirasakannya dan terus bekerja secara independen c. Mencari bantuan dari Direktur Keperawatan d. Pindah dari bangsal dan memulai suatu pekerjaan baru yang lain. e. Ruang X terdiri dari perawat yang berbeda – beda dalam memberikan asuhan keperawatan, perawat ruangan dibagi dengan komposisi tenaga professional, tekhnikal dan pembantu dalam satu grup kecil yang saling membantu.

Metode apa yang digunakan oleh ruang perawatan diatas ? a. Fungsional. b. Penugasan/kasus. c. Metode tim. d. Keperawatan primer. Perawat “X” adalah kepala ruang di ICU mengatakan, "Saya tidak punya waktu untuk membicarakan masalah ini dengan Anda sekarang. Lihat saja di kantor saya nanti "saat staf bertanya apakah mereka bisa bicara tentang suatu masalah. Manakah dari strategi resolusi konflik yang Perawat “X” gunakan?

a. mengurangi komponen emosional dalam konflik b. pendekatan yang kompetitif atau negosiasi c. penarikan kepentingan dengan mengacuhkan kepentingan kelompok lain d. menentukantujuanbersamadanbekerjasamadalammencapaisuatutujuan Di ruang penyakit dalam terdapat konflik antara perawat senior dan perawat honor. Tugas dan tanggung jawab semua dilimpahkan kepada perawat honor. Hal ini diketahui oleh kepala ruang sehingga perawat senior dan honor dikumpulkan di ruang rapat. Tetapi perawat honor menolak untuk ikut rapat karena takut dan lebih memilih untuk pasrah terhadap perlakuan perawat senior.

Apakah strategi yang telah diambil oleh perawat honor terhadap penyelesaian konflik yang terjadi? a. Kompetisi (competition) b. Kompromi (compromi) c. Menyelesaikan masalah (fight) d. Menghindari masalah (flight) Pasien tabrak lari mengalami fraktur terbuka pada kaki kiri. Pasien dilarikan ke rumah sakit kemudian ditangani oleh 3 perawat.

Perawat A bertugas untuk tindakan perawatan luka, perawat B bertugas memberikan obat-obatan, dan perawat C bertugas untuk penerimaan dan pemulangan pasien.Apakah metode keperawatan yang diterapkan di rumah sakit tersebut? a. Metode kasus b. Metode fungsional c.

Metode primer d. Metode tim Walaupun Ns Z merupakan perawat baru di ruang Asoka, tetapi kinerja dan ketekunan dalam bekerjanya terampil sehingga kepala ruang memberikan apresiasi atas kinerja dan karirnya.

Termasuk ke dalam pilar nilai-nilai profesional manakah perilaku kepala ruang ke Ns.Z? a. Management approach b. Compensatory reward c. Professional relationship d. Management quality 83. Ketika memberikan perkuliahan, dosen di STIKes X akan di supervisi oleh pihak yayasan untuk melihat kesinambungan antara satuan acara pembelajaran dengan materi ajar yang diberikan.

Apakah sasaran yang ingin dicapai dari supervisi yang dilakukan? a. Pelaksanaan tugas sesuai pola b. .Struktur dan hirarki sesuai rencana c. tugas dan wewenang harus sesuai d. .Sistem dan prosedur tidak menyimpang 84. Hasil pengkajian dari panti sosial didapatkan hasil bahwa untuk menginformasikan panti sosial tersebut melalui majelis talim dan brosur tentang keberadaan panti sosial tersebut sehingga masyarakat mengetahui keberadaan panti sosial.

Manakah yang termasuk unsur-unsur manajemen yang terkandung dalam kasus di atas? 85. 86. 87. 88. 89. a. Man b. .Methods c. Materialis d. .Market Ns B merupakan perawat kontrak di ruang anak lanugo pada bayi baru lahir rumah sakit. Jumlah perawat di ruang tersebut berjumlah 11 dengan kapasitas tempat tidur 30. Ns B sering dinas sore dan malam dengan lanugo pada bayi baru lahir pasien yang selalu penuhsedangkan jumlah perawat jaga 3 orang. Jarak rumahnya 25 km sehingga sering terlambat dan tidak ikut operan jaga.

Apakah yang tepat untuk dilakukan pada kasus manajemen konflik di atas? a. Memahami situasi dan kondisi sehingga membiarkan keterlambatan Ns B b. Menyarankan kepada Ns B agar mencari kost di dekat RS agar tidak terlambat c. Menschedule ulang shift Ns B sehingga dalam sehari hanya ikut shift sekali d. Memberikan sangsi yang tegas kepada Ns B Setelah visite dokter, klien D 50 tahun di rawat inap penyakit dalam dinyatakan boleh pulang.

Perawat S yang bertanggung jawab kepada klien D dari awal masuk RS sampai pulang melihat catatan perkembangan klien D selama di rawat di RS.

Apakah metode keperawatan yang diterapkan di rawat inap penyakit dalam ? a. Metode kasus b. Metode fungsional c. Metode primer d. Metode tim Klien S, 40 tahun berobat ke rumah sakit dengan keluhan nyeri dada dan batuk yang tak kunjung sembuh.

Dokter menyarankan untuk cek laboratorium untuk memastikan penyakit yang dideritanya. Pemeriksaan laboratorium di RS harus menunggu karena banyak pasien yang datang, akhirnya klien S memeriksakan diri ke laboratorium yang berada tidak jauh dari RS tersebut.Apakah analisa SWOT yang terkait dengan keberadaan laboratorium yang tidak jauh dari RS?

a. Strength b. Weakness c. Oppurtunity d. Threat Dua hari yang lalu di RS “X”, tepatnya di ruang Melati telah dilakukan rapat bulanan yang dipimpin oleh kepala ruang Melati.

Rapat ini diadakan untuk mengevaluasi tindakan yang telah dilakukan perawat selama 1 bulan terakhir. Dalam memimpin rapat, kepala ruang menyampaikan hasil analisa masalah dan mengusulkan tindakan kepada perawat yang lain. Kemudian kepala ruang meminta saran dan kritik perawat lain dan keputusan akhir ada pada kelompok. Apakah gaya kepemimpinan yang diterapkan oleh kepala ruang tersebut? a. Partisipatif b. Otoriter c. Laissez faire d. Demokratis Tn. S adalah direktur muda yang memimpin RS “X”.

Setiap 3 bulan sekali, akan dilakukan evaluasi kepemimpinan yang dinilai dari karyawan dan hasilnya bernilai positif terhadap kinerja bawahannya. Tn.S dapat melakukan pendekatan kepada bawahannya dan membina hubungan yang baik.

Apakah upaya preventif yang dilakukan Tn.S dalam upaya melakukan pendekatan kepada karyawannya? a. b. c. d. Tn. S memberikan motivasi kepada karyawannya Tn.S memantau dan mengetahui perkembangan karyawannya Tn.S melakukan perubahan atau perbaikan untuk meningkatkan kinerja karyawannya Tn.

S mengenali karakteristik bawahannya Soal komunitas 1. Perawat X ditugaskan ke daerah dengan penduduk yang meyakini kalau sakit tidak perlu ke palayanan kesehatan tapi harus pergi ke dukun untuk di jampe-jampe dan dimandikan. Manakah langkah pertama yang perlu dilakukan perawat X sesuai dengan teori perubahan terencna?

a. Menciptakan hubungan dengan sistem klien b. Mendiagnosis masalah, kebutuhan atau tujuan sistem klien c. Menumbuhkan rasa kebutuhan dan keinginan untuk berubah d. Mentransformasi rencana perubahan menjadi perubahan aktual e. Stabilisasi hasil perubahan pada sistem klien 2. Berdasarkan laporan, populasi vektor terutama lalat meningkat dengan tajam di Desa X. Kondisi lingkungan Desa X padat penduduk rumah berdempetan dalam gang sempit, sampah menumpuk di ujung-ujung gang disertai bau yang tidak sedap, tempat penampungan sampah sementara tidak tertutup.

Manakah pengendalian vektor yang paling tepat untuk mengtasi kasus diatas ? a. Pengendalian secara kimiawi dengan insektisida b. Pengendalian secara genetika dengan sterilisasi lalat jantan c. Pengendalian secara biologis menambah predator vektor.

d. Pengendalian secara mekanis membersihkan lingkungan. e. Pengendalian secara kimiawi dengan fogging 3. Di sebuah perusahaan X, 90% karyawan bagian produksi mengeluhkan tangannya sering terciprat minyak dari penggorengan.

Alat perlindungan diri tidak disediakan oleh pihak perusahan sebagaiman mestinya. Apa tindakan prioritas yang harus diambil oleh perawat kesehatan kerja? a. Memberikan penyuluhan fungsi Alat perlindungan diri b. Mendemonstrasikan penggunaan Alat perlindungan diri c. Menyediakan alat perlindungan diri bagi karyawan d.

Advokasi pada pihak perusahaan untuk penyediaan alat perlindungan diri e. Memberikan edukasi terhadap pihak perusahaan 4. Hasil skrining kesehatan gigi di SD Karangnunggal pada bulan januari, menunjukan 78% siswa kelas 1-3 mengalami karies gigi. Apakah tindakan pertama yang perlu diambil oleh perawat kesehatan sekolah pada siswa a. Penkes manfaat oral hygiene b. Mendemonstrasikan oral hygiene c. Skrining kesehatan gigi secara rutin d. Rujuk ke puskesmas e.

Advokasi penyediaan alat oral hygiene di sekolah 5. Semua pekerja di bagian sablon pada Home Industri X, mengeluhkan sering mengalami sesak nafas dan batuk. Padahal Home Industri X sudah Menyediakan APD berupa masker, namun APD tersebut jarang digunakan oleh pekerja. Apakah tindakan pertama yang harus diambil oleh perawat kesehatan kerja, sesuai kasus diatas?

a. Penyuluhan Fungsi Alat Perlindungan Diri b. Memasang papan himbauan pengguanaan APD c. Demonstrasi penggunaan Alat perlindungan diri d. Memberikan Pengobatan bagi pekerja e. Advokasi 6. Pada home industry X untuk mendirikan balai pengobatan Terjadi 15 kasus kaki gajah di wilayah binaan puskesmas X.

Puskesmas x memprogramkan pemberian obat anti folaria. Minggu pertama pemberian obat di Desa 1 seluruh masyarakat desa 1 meminum obat (100%), minggu ke 2 pemberian obat di desa 2, 65% masyarakat desa 2 menolak meminum obat karena mendapat informasi dari warga desa 1 setelah meminum obat menjadi pusing dan mual.

Apakah tindakan prioritas yang harus dilakukan oleh perawat? a. Pendidikan kesehatan tentang keteraturan pengobatan b. Pemeriksaan darah tepi terhadap seluruh warga c. Melakukan sweeping terhadap warga desa 2 d. Pendidikan kesehatan tentang penanggulangan efek samping obat e. Mendemonstrasikan cara meminum obat 7. Berdasarkan laporan di kecamatan X terdapat sekelompok remaja laki-laki yang sering meminum minuman keras dan memakai zat adiktif di kecamatan tersebut adalah para remaja yang sudah pernah mendapatkan penyuluhan tentang bahaya minuman keras dan zat adiktif.

Apa rencana prioritas yang akan anda lakukan untuk kasus diatas? a. konseling terhadap remaja yang diindikasikan sebagai pengguna b.

Minta bantuan kepolisian untuk menangkap pengguna c. penyuluhan kepada seluruh siswa tentang zat adiktif d. melakukan pengkajian kembali dan merevisi rencana asuhan e. negosiasi dengan para remaja untuk menghentikan kebiasaannya 8. 95% kepala keluarga laki-laki di desa X adalah perokok. 98% dari kepala keluarga perokok memiliki kebiasaan merokok di dalam rumah. Apakah tindakan prioritas yang perlu dilakukan perawat? a. Pendidikan kesehatan tentang bahaya rokok b. Anjurkan merokok di area bebas rokok c.

Pendidikan kesehatan tentang bahaya merokok didalam rumah d. Anjurkan mengurangi merokok e. Konseling tentang bahaya merokok 9. Berdasarkan laporan angka kejadian diare di SD X tinggi, dari hasil pengkajian didapatkan data PHBS siswa tidak baik, salah satu data yang didapat, hampir seluruh siswa tidak mencuci tangan menggunakan sabun sebelum makan serta tidak terdapat fasilitas untuk mencuci tangan di SD tersebut.

Apakah tindakan prioritas yang perlu dilakukan perawat? a. Pendidikan kesehatan tentang PHBS b. Advokasi kepada sekolah untuk menyediakan tampat cuci tangan c.

Pemberian obat diare d. Mengajarkan 6 langkah cuci tangan e. Memberikan Konseling untuk seluruh siswa SD di Desa X 10. Angka kejadian ISPA 40%, Diare10% dan DBD 10 kejadian. Kondisi Lingkugan tampak kumuh, sampah menumpuk di beberapa sudut perkampungan, genangan air tampak pada pot-pot dan kaleng bekas minuman terdapat jentik – jentik nyamuk.

apakah tindakan prioritas dalam menghadapi masalah tersebut? a. Melakukan pendidikan kesehatan/penyuluhan b. Melakukan foging terhadap lingkungan c. Bersama-sama warga membersihkan lingkungan d. Membentuk Pokjakes kebersihan lingkungan di Desa X e.

Berkolaborasi untuk menyelesaikan masalah dengan dinas terkait 11. Posyandu Y berada di RW X, wilayah binaannya mencakup 2 RWyaitu RW X dan RW Z.

pada tahun 2013 Tingkat partisipasi warga RW Z ke posyandu < 20 %. Warga RW Z mengeluhkan jarak ke Posyandu Y yang terlalu jauh. apakah tindakan prioritas dalam menghadapi masalah tersebut? 12. 13.

14. 15. 16. 17. a. Menjadi inisiator dan fasilitator untuk pembentukan posyandu di RW Z b. Membangun Posyandu di RW Z c. Menganjurkan Warga RW Z untuk hadir ke posyandu Y d.

Memindahkan lokasi posyandu Y ke RW Z e. Memberikan warga RW Z penkes pentingnya ke posyandu Hasil windshield survey Puskesmas X terhadap Desa Y, di dapatkan lanugo pada bayi baru lahir 50% rumah memiliki ventilasi < 10% luas lantai. Apakah rencana tindakan prioritas yang perlu dilakukan perawat terhadap kondisi tersebut? a. Menganjurkan membuat ventilasi baru b. Advokasi dana bantuan pembuatan ventilasi c. Penyuluhan untuk membuka pintu dan jendela setiap hari d. Penyuluhan untuk sering lanugo pada bayi baru lahir di luar rumah e.

Melakukan skrining penyakit pernafasan pada warga desa Y Warga Dusun X memiliki kebiasaan melarang wanita hamil memakan ikan. Larangan tersebut sudah ada sejak lama dan selalu diikuti oleh para wanita hamil di dusun X tersebut. Apakah tindakan pertama yang anda lakukan sebagai perawat komunitas di dusun tersebut? a. Tetap melestarikan kebiasaan tersebut b. Melakukan pengkajian dengan pendekatan teori model perubahan perilaku c.

Menerima budaya tersebut dengan memodifikasi d. Merubah budaya tersebut e. Melakukan kolaborasidengan pihak lain yang berwenang perawat X berencana akan melaksanakan windshield survey, data pertama yang ingin di dapatkan adalah data sub sistem lingkungan.

Manakah metode yang paling tepat untuk mendapatkan data tersebut? a. Sensus b. Wawancara tokoh masyarakat c. Observasi d. Studi Data sekunder e. Wawancara aparatur pemerintah Kesehatan masyarakat memiliki beberapa tahap, termasuk mengumpulkan data dan pemantauan status kesehatan penduduk yang merupakan fungsi inti dari kesehatan masyarakat. Tahap di atas merupakan fungsi dari: a.

Pengkajian b. Pencegahan c. Jaminan d. Kebijakan pengembangan Menyediakan ketersediaan layanan kesehatan pribadi utama bagi orang yang tidak menerima perawatan kesehatan merupakan salah satu fungsi inti dari kesehatan masyarakat. Tahap di atas merupakan fungsi dari: a. Pengkajian b. Pencegahan c. Jaminan d. Kebijakan PengembanganManakah dari pernyataan berikut yang benar berkaitan dengan fokus penduduk di keperawatan kesehatan masyarakat? a. Lanugo pada bayi baru lahir diberikan kepada populasi resiko tinggi b.

Pemberian perawatan langsung terbatas pada tindakan pencegahan seperti pemberian imunisasi c. Perhatian diberikan pada penduduk atau masyarakat secara keseluruhan, terlepas dari apakah mereka melakukan atau tidak mengakses sistem perawatan kesehatan d. 18. 19. 20. 21. 22. Hanya penduduk di luar pengaturan kelembagaan yang dianggapSpesialisasi dalam keperawatan kesehatan masyarakat memiliki beberapa hambatan.

Hambatan untuk spesialisasi di keperawatan kesehatan masyarakat mencakup semua hal berikut kecuali satu.Identifikasi yang bukan merupakan hambatan? a. Keyakinan bahwa perawatan oleh perawat langsung hanyalah peran seorang perawat.

b. Struktur dan peran yang membatasi praktek. c. Keterbatasan pengetahuan tentang metode ilmu kesehatan masyarakat dan populasi-orientasi. d. Kurangnya keterampilan dalam strategi kesehatan preventif.

Berikut ini adalah contoh dari hubungan antara karakteristik sosial, politik, dan ekonomi dari peradaban dan kesehatan kecuali satu. Identifikasi hubungan yang salah. a. Orang Mesir menggunakan apa yang mereka pelajari dari pengamatan untuk mengembangkan persiapan farmasi yang berguna.

b. Bangsa Roma memandang kesehatan dari sudut pandang sosial dan masyarakat dan membangun saluran air dan sistem pembuangan. c. Selama Abad Pertengahan ada kondisi sanitasi perumahan yang terlalu padat dan miskin, dan prevalensi kolera dan cacar meningkat.

sebagai hasilnya, kelompok agama mendirikan rumah sakit untuk merawat orang sakit. d. Renaissance membawa pengakuan baru dan nilai martabat manusia yang berakibat pada organisasi dari sistem kesehatan publik pertama.Seorang wanita 66 tahun pensiun dan tidak lagi memiliki asuransi kesehatan dari tempatnya kerja. Wanita ini tentunya harus memiliki jaminan untuk hari tuanya.

Manakah dari program-program berikut yang sesuai untuk kebutuhan asuransi kesehatannya? a. Medicare b. Medicaid c. Jaminan sosial d. Undang-undang Peluang Ekonomi Semua pernyataan tentang dampak teknologi terhadap perawatan kesehatan berikut adalah benar kecuali satu.

Identifikasi pernyataan yang salah. a. Dampak teknologi pada perawatan kesehatan semuanya positif. b. Kemajuan dalam bidang teknologi medis berada pada puncaknya dan kemudian akan menurun selama beberapa tahun berikutnya. c. Penggunaan teknologi komputer akan membuat perawatan kesehatan lebih hemat biaya daripada efisien.

d. Peralatan teknologi tinggi mahal, cepat ketinggalan jaman, dan seringkali memerlukan petugas yang sangat terlatih.Keperawatan primer yang berorientasi pada masyarakat adalah model keperawatan yang menyampaikan perawatan kesehatan yang mengintegrasikan aspek baik perawatan primer dan kesehatan masyarakat.

Mana dari berikut ini yang bukan lanugo pada bayi baru lahir perawatan primer yang berorientasi pada masyarakat? a. Pemberian perawatan kesehatan berfokus sepenuhnya pada publik dengan mengesampingkan perawatan primer.

b. Partisipasi aktif dari orang yang hidup di masyarakat ditekankan. c. Membangun konsensus di antara para pemimpin komunitas beragam penting dalam menangani kebutuhan kesehatan. d. Alokasi lebih banyak uang ke kepedulian masyarakat diasumsikan untuk pada akhirnya menghemat uang dan meningkatkan hasil.Sangatlah pentng bagi perawat kesehatan masyarakat untuk mempelajari tentang perawatan kesehatan dan cara menyampaikannya. 23. Banyaknya masalah yang terjadi di beberapa bagian dunia dapat mempengaruhi kesehatan dan perawatan kesehatan pada akhirnya.Karena itu perawat yang bekerja di komunitas internasional perlu menyadari bahwa: a.

Kesehatan secara langsung berkaitan dengan pembangunan ekonomi. b. Ketersediaan teknologi secara otomatis meningkatkan perawatan. c. Promosi obat-obatan untuk semua orang adalah penting terlepas dari tradisi lokal. d. Semua di atas 24.

Banyaknya masalah yang terjadi di beberapa bagian dunia dapat mempengaruhi kesehatan dan perawatan kesehatan, baik masalah populasi maupun ekonomi dari suatu lanugo pada bayi baru lahir.

Karena kesehatan dari suatu penduduk sangat berkaitan dengan perkembangan ekonominya. Pengaruh penghapusan hambatan politik dan ekonomi antara negara mencakup semua hal berikut kecuali: a. Stimulasi pertumbuhan ekonomi dan pembangunan. b. Peningkatan risiko terkena penyakit dan bahaya kesehatan lingkungan.

c. Penyebaran penyakit seperti AIDS dan tuberculosis. d. Penurunan pergerakan kelompok populasi dalam dan antar negara 25. Terdapat temuan baru kasus filariasis sebanyak 30 orang pada stadium 1 dan stadium 2 di wilayah kerja Puskesmas C Kabupaten T, Dinas Kesehatan melakukan pengobatan masal pada semua warga.

Apakah upaya kesehatan yang dilakukan oleh dinas kesehatan? a. Health promotion b. General and specific protection c. Early diagnosisi Prompt treatment d. Dissability limitation e. Rehabilitation 26. Hasil survey komunitas di Kelurahan A. ditemukan 30% ibu rumah tangga mengalami obesitas. Apakah upaya prevensi tersier yang dapat dilakukan oleh perawat kesehatan komunitas terhadap kelompok obesitas tersebut? a. Membuat kelas makan sehat b. Menjelaskan tentang makanan sehat c.

Memberikan penjelasan tentang gaya hidup sehat d. Melakukan konseling tentang hidup sehat e. Kolaborasi dengan ahli gizi dalam upaya perubahan perilaku makan 27. Laporan dinas kesehatan X. terdapat 1% penderita Tuberkulosis. Hasil Survey di Kelurahan Y. wilayah kerja Puskesmas N. terdapat 2% penderita Tuberkulosis dengan karakteristik lingkungan yang kotor, sumber air bersih kurang baik dan kepedulian pemerintahan setempat yang kurang baik.

Apakah masalah keperawatan yang prioritas untuk kasus di atas? a. Resiko terjadi peningkatan kasus Tuberkulosis di Kelurahan Y b.

Tingginya kasus Tuberkulosis di Kelurahan Y c. Resiko terjadi kasus diare di Kelurahan Y d. Rendahnya sanitasi lingkungan di Kelurahan Y e. Kurangnya perilaku hidup bersih dan sehat di Kelurahan Y 28. Klien perempuan berusia 58 post stroke sejak 1 bulan yang lalu.

Klien mengalami kelumpuhan pada ektremitas atas dan ekstrimitas bawah kanan, sehingga tidak dapat mandiri untuk pemenuhan kebutuhan dasar dalam keehariannya. Apakah tindakan keperawatan yang paling tepat bagi Klien tersebut? a. Melatih pergerakan sendi b. Menemaninya untuk istirahat c.

Membatu semua aktivitas klien d. Mengompres hangat daerah ektremitas e. Mengompres dingin daerah ekstrimitas 29. Puskesmas Ageung mempunyai 4 wilayah binaan. Salah satu wilayah binaan Puskesmas Ageung merupakan wilayah yang kumuh dan padat penduduk. Masyarakat di wilayah tersebutsering menyimpan sampah di depan rumah hingga ada petugas sampah yang mengambil sampah tersebut, jika petugas yang mengambil sampah tidak datang, masyarakat membuang sampah ke kali.

Berdasarkanpengkajian petugas kesehatandi wilayah tersebut terdapat 220 kasus penyakit ISPA. Apakah penyebab tingginya virulensi agent penyebab ISPA pada kasus di atas? A. Kesadaran orang tua B. Kesadaran masyarakat C. Sanitasi lingkungan yang kurang D. Tingkat imunitas penduduk yang rendah E. Jumlah penduduk di lingkungan yang padat 30. laki – laki berusia 22 tahunseorang mahasiswa keperawatan di suatu perguruan tinggi di bandung yang sedang melaksanakan praktek residensi komunitas di desa Ceria dan akan melaksanakan kegiatan pemberdayaan masyarakat dengan mengundang masyarakat dalam rangka pemecahan masalah penyakit ISPA di desa Ceria.

Termasuk tahap apakah dalam keperawatan komunitas pada kasus diatas ? a. Pengkajian b. Perencanaan c. Implementasi d. Evaluasi e. Diagnosa keperawatan 31. Di Desa Ceria, dalam 5 tahun terakhir kejadian Kehamilan dibawah umur 20 tahunmemiliki jumlah yang sangat tinggi, bulan Juli 2012terdapat 34 perempuan hamil di bawah umur 20 tahun, 8 diantaranya meninggal ketika persalinan dan 5 diantaranya mengalami abortus.

Prevalensi kasus Bulan Juli sudah melewati prevalensi kehamilan di bawah umur tahun sebelumnya. Apakah masalah keperawatan komunitas utama sesuai dengan kasus diatas A. Tingkat kepekaan yang rendah B. Kondisi lingkungan yang jelek C. Tingkat pendidikan yang rendah D. Sosial ekonomi masyarakat rendah E. Tidak adanya kepedulian masyarakat 32.

Di Desa U, sebagian besar warga dirumahnya memilikiusaha pembuatan bantal dengan bahan dasarkapuk yang pegawainya adalah keluarga sendiri, Ketika membuat bantal sebagian besar pegawai tidak menggunakan masker kaena mereka merasa tidak nyaman. ,Pegawai sudah pernah mendapatkan sosialisasi dari tenaga kesehatan tentang penggunaan alat pelindung diri ketika bekerja seperti masker tapi karena tidak biasa menggunakannya pegawai tersebut malas untuk menggunakan masker.

Tindakan yang akan dilakukan melihat kondisi di atas : a. Anjurkan warga untuk pindah pekerjaan b. Anjurkan warga untuk menghentikan usahanya c. Anjurkan warga untuk menjaga memeriksakan kesehatannya d. Bekerjasama dengan pihak lurah agar pegawai menjadi menuru e. Lakukan pendidikan kesehatan secara berkala tentang proses pemanfaatan masker 33. Hasil pengkajian mahasiswakeperawatan perguruan tinggi negeri di Bandung yang sedang melaksanakan praktek profesi ners di salah satu RW, ditemukan data penyakit ISPA pada balita sebanyak 20% dari total balita 40 orang, penyakit rematik pada lansia sebesar 30 % dan hypertensi 20 % dari total 50 orang lansia, Diagnosa keperawatan komunitas berdasarkan data di atas ?

a. Peningkatan penyakit pada lansia 34. 35. 36. 37. b. Terjadi penurunan derajat kesehatan pada masyarakat c. Peningkatan angka kejadian penyakit infeksi pada anak d. Resiko terjadinya peningkatan penyakit degeneratif pada lansia e.

Potensial terjadinya peningkatan derajat kesehatan pada lansia Desa T merupakandesa yang sangat fanatic terhadap agama, yang menjadi panutan jalannya kegiatan masyarakat di desa tersebut adalah tokoh agama yang tinggal diwilayah desa T. Suatu hari di Desa T ada kejadian luar biasa penyakit DBD. Petugas kesehatan akan melaksanakan asuhan keperawatan komunitas di Desa tersebut. Petugas kesehatan harus mampu melakukan komunikasi theurapeutik.

Apakah yang perlu dilakukan perawat tersebut pada fase pra interaksi? a. Pertemuan dengan tokoh Agama b. Pendataan keluarga sesuai format c. Pengkajian langsung pada keluarga yang bermasalah d. Pencarian data primer masyarakat tentang kesehatan yang dialami e. Survei wilayah yang akan digunakan seperti sumber daya, sumber dana, dan keamanan Hasil pengkajian di desa H diwilayah RW 01 jumlah penduduk sebanyak 150 jiwa, masyarakat RW 01 sebagian besar melakukanaktivitas sehari hari seperti mandi, menggosok gigi, serta mencuci pakaian semua dilakukan di sungai, hasil pengkajian sebagia besar 40 % masyarakat sering mengalami penyakit gatal gatal (borok).

Apakah rencana tindakan keperawatan pada kasus diatas ? a. Pembuatan MCK khusus untuk RW 01 b. Pendidikan kesehatan tentang hidup sehat c. Pembinaan sanitasi kepada kepala keluarga d. Promosi kesehatan kepada kepala keluarga e. Pendidikan kesehatan tentang penyakit gatal Seorang mahasiswa yang sedang praktek profesi ners di Desa Dsedang melakukan upaya peningkatan kesehatan gigi pada anak usia sekolah di SD K.

dengan cara memberikan penyuluhan cara menggosok gigi yang benar. Termasuk rencana tindakan keperawatan apakah pada kasus diatas ? A. Promosi kesehatan B. Preventif penyakit dan injuri C. Pemeriksaan kesehatan berkala D. Mengikuti aturan manajemen perusahaan E. Perencanaan program kesehatan kerja Perawat K melakukan pengkajian kepada warga RW 02 di wilayah desa R setelah mendapatkan laporan dari seorang kader bahwa ada 3 orang warganya terkena penyakit aneh kakinya membesar dan sering sakit di malam hari, Perawat K memberikan obat anti filariasis kepada seluruh warga Desa T karena setelah dikaji lanugo pada bayi baru lahir orang warga tersebut mengalami penyakit filariasis Apakah tujuan perawat memberikan obat anti filariasis kepada seluruh warga?

Pilihan jawaban: a. Mengobati virus yang datang b. Mencegah supaya tidak tertular c. Memberikan obat gratis kepada warga d. Mengobati seluruh warga karena menular e. Memberikan ketenangan supaya warga tidak cemas 38.

Puskesmas J melakukan survey di wilayah Deemenunjukkan bahwa Angka kejadian diare dalam 3 bulan terakhir 75% anak anak mengalami diare.

Setelah dilakukan pengkajian di wilayah tersebut sebagian warga menggunakan sumber air berasal dari sungai dari desa tetangga Apa masalah keperawatan yang paling tepat untuk kasus diatas ? a. Tingginya kejadian diare di Desa Y. b. Tingginya sanitasi lingkungan di Desa Y.

c. Rendahnya sanitasi lingkungan di Desa Y. d. Resiko tinggimeningkatnya kasus sumber air kotor di Desa Y 39. Perawat N (25 tahun) sedang melakukan pengkajian komunitas dengan menggunakan metoda Roda pengkajian komunitas sebagai mitra mengidentifikasi subsistem pelayanan kesehatan dan sosial sebagai faktor pendukung kemitraan dalam komunitas. Salah satu identifikasi yang dikaji dalam pelayanan kesehatan dan sosial adalah ?

a. Kualitas udara b. Rumah singgah c. l apangan kerja d. Tempat khusus untuk berkumpul warga e. Afiliasi partai apa yang paling berpengaruh 40. Perawat komunitas Y (25 tahun) memberikan perhatian terhadap lanugo pada bayi baru lahir faktor lingkungan meliputi fisik, biologi, psikologis, sosial, dan kultural serta spritualterhadap kesehatan masyarakat dan memberi prioritas pada strategi pencegahan, peningkatan dan pemeliharaan kesehatan dalam mencapai tujuan.

Seorang perawat melakukan tugas keperawatan keluarga dengan menyepakati tujuan akhir keperawatan untuk memandirikan keluarga dalam upaya kesehatan terkait lima tugas keluargayang dilakukan perawat tersebut adalah aplikasi dari teori dan model keperawatan? A. D.E. Orem B. Betty Neuman C. Neuman D. Adaptasi C. Roy E. Model imogene M. King 41. Diagnosis keperawatan komunitas dengan klien salah satu anggota keluarga yang sedang rehabilitasi penyalahgunaan/ ketergantungan zat” Harga diri rendah situsional berhubungan dengan ketidak mampuan keluarga terhadap stigma sosial yang melekat pada penyalahgunaan zat” dengan salah satu intervensi prioritasnya adalah observasi interaksi keluarga, lanugo pada bayi baru lahir orang terdekat/pendukung.

Salah satu rasionalisasi intervensi observasi interaksi keluarga, dinamika orang terdekat/pendukung adalah? a. Klien sering kehilangan penghargaan pada diri sendiri dan menyakini bahwa situasinya tidak ada harapan b.

Kegagalan dan harga diri rendah telah menjadi masalah untuk klien c. Keberadaan perawat menunjukan penerimaan terhadap individu klien d. Penyalahgunaan zat adalah adalah penyakit keluarga lanugo pada bayi baru lahir tindakan keluarga mempengaruhi penyakit klien e.

Berbagi masalah membantu mendorong pengungkapan dan rasa kekeluargaan 42. Perawat B (30 tahun) sedang mengkaji perubahan Fisik, Psikososial, Perkembangan kognitif, dan masalah kesehatan spesifik pada adolesens. Identitas di bawah ini yang bukan di lakukan dalam hal pengkajian perkembangan psikososial adolesens adalah: a.

b. c. d. e. Identitas Seksual Identitas Kelompok Identitas Keluarga Identitas Pekerjaan Identitas Focus Group discusion 43. Perawat berperan aktif dalam penanggulangan HIV/ AIDS di lingkungan sekitar tempat tinggal dalam rangka bersinergis dengan program millenium development Goals (MDGS).

Dari delapan program sasaran MDGS yang terikat waktu sampai 2015 adalah Kecuali? a. Mengakhiri kemiskinan dan kelaparan b. Pendidikan universal c. Kesehatan ibu d. Manajemen bencana e. Penanggulangan HIV/AIDS 44. Proses pencegahan suatu penyakit tidak dapat di pisahkan dari kondisi lingkungan dan sejarah terjadinya penyakit.

Mencegah berarti mengadakan inhibisi terhadap perkembangan suatu penyakit sebelum penyakit tersebut. Di bawah ini termasuk upaya pencegahan sekunder (Secondary prevention) pada fase preklinik dan klinik. A. B. C. D. E. Program Imunisasi penjernihan air minum Perbaikan status gizi masyarakat Penemuan penyakit kanker dini Pencegahan kecelakaan. 45. Peran Perawat adalah bentuk perilaku yang di harapkan dari perawat pada situasi sosial tertentu Perawat bekerja melalui tim profesi kesehatan lain berdiskusi atau tukar pendapat dalam penentuan bentuk pelayanan selanjutnya termasuk dalam menjalankan peran?

A. Peran Kolaborator B. Peran Konsultan C. Peran pembaharu D. Peran edukator E. Peran advokat 46. Perawat komunitas memberikan perhatian terhadap pengaruh faktor lingkungan meliputi fisik, biologi, psikologis, sosial, dan kultural serta spritualterhadap kesehatan masyarakat dan memberi prioritas pada strategi pencegahan, peningkatan dan pemeliharaan kesehatan dalam mencapai tujuan.

Seorang perawat melakukan tugas keperawatan keluarga dengan menyepakati tujuan akhir keperawatan untuk memandirikan keluarga dalam upaya kesehatan terkait lima tugas keluargayang dilakukan perawat tersebut adalah aplikasi dari teori dan model keperawatan?

a. D.E. Orem b. Betty Neuman c. Neuman d. Adaptasi C. Roy e. Model imogene M. King 47. Perawat memahami secara garis besar faktor-faktor yang mempengaruhi kesehatan baik individu, kelompok, maupun masyarakat dikelompokkan menjadi 4 (Blum, 1974.) Berdasarkan urutan besar pengaruhnya terhadap kesehatan adalah sebagai berikut kecuali ? A. lingkungan B. perilaku C. pelayanan kesehatan D. pendidikan kesehatan E. hereditas (keturunan) 48. Ketika perawat komunitas sedang melaksanakan pengkajian dengan menggunakan sekmen pengkajian model komunitas sebagai mitra mengidentifikasi subsistem lingkungan sebagai faktor pendukung kemitraan dalam komunitas.

Salah satu identifikasi yang dikaji dalam lingkungan adalah adalah ? A. Fasilitas pelayanan sosial B. Angka pengangguran C. Keadaan masyarakat D. Rumah singgah E. Bagaimana pemerintahan setempat di bentuk 49.

Perawat A (25 tahun) setelah melakukan beberapa proses menuliskan Diagnosis keperawatan” Ansietas( sedang ) berhubungan dengan ketidak mampuan menyesuaikan krisis situasi kanker pada komunitas” dengan perencanaan “dorong klien untuk mengungkapkan pikiran dan perasaan”. Rasionalisasi intervensi” dorong klien untuk mengungkapkan pikiran dan perasaan di bawah yang sesuai adalah”?

A. Membantu dalam identifikasi rasa takut dan kesalahan konsep berdasarkan pada pengalaman kanker B. Memberikan kesempatan untuk eksplorasi rasa takut yang realistis serta kesalahan konsep tentang diagnosis C. Memberikan keyakinan bahwa pasien tidak sendiri D. Penyimpangan sensori dapat terjadi nilai stimulasi sehingga memperberat perasaan ansietas E. Ketrampilan koping sering rusak setelah diagnosis terjadi 50. Perawat komunitas menuliskan Diagnosis keperawatan” Perubahan Nutrisi kurang dari kebutuhan berhubungan dengan ketidak tahuan terhadap status hipermetabolik berkenaan dengan kanker konsekwensi kemotherapi” Intervensi yang paling sesuai dengan diagnosa tersebut adalah?

A. B. C. D. E. 51. Pantau asupan makanan setiap hari Ukur tinggi, berat badan dan ketebalan lipatan kulit trisep Dorong pasien untuk makan diet tinggi kalori kaya protein Dorong penggunaan tehnik relaksasi, visualisasi, bimbingan imajinasi dan latihan sedang sebelum makan Dorong komunikasi terbuka mengenai masalah anoreksia Posyandu adalah suatu forum komunikasi, alih teknologi dan pelayanan kesehatan masyarakat oleh dan untuk masyarakat yang mempunyai nilai strategis dalam mengembangkan sumber daya manusia sejak dini.

Lima kegiatan posyandu (Panca krida posyandu) kecuali: A. B. C. D. E. 52. Kesehatan ibu dan anak Imunisasi Peningkatan Gizi Keluarga berencana Sanitasi dasar Strategi promosi kesehatan berdasarkan piagam Ottawa(Ottawa Charter) hasil konferensi promosi kesehatan internasional 1986 menghasilkan 5 butir strategi rumusan promosi kesehatan.

Dibawah ini merupakan 5 butir strategi rumusan promosi kesehatan kecuali: A. B. C. D. Kebijakan berwawasan kesehatan (Healty public policy Lingkungan yang mendukung (Suportive environment) Pengelolaan tempat-tempat umum (Public places) Reorientasi pelayanan kesehatan (Reorient health service) E. Ketrampilan individu (Personal skill) 53.

Seorang perawat sedang melaksanakan pengkajian di komunitas dengan menggunakan sekmen pengkajian model komunitas sebagai mitra mengidentifikasi subsistem komunikasi sebagai faktor pendukung kemitraan dalam komunitas Salah satu identifikasi yang dikaji dalam Komunikasi adalah adalah ? a. b. c. d. e. Perpustakaan yang tersedia Bentuk rekreasi utama Koran apa yang tersedia Kendaraan umum yang di pakai masyarakat Keterlibatan warga dalam pembuatan keputusan pemerintah daerah setempat 54.

di Desa X Angka kejadian ISPA 40%, Diare10% dan DBD 10 kejadian. Kondisi Lingkugan tampak kumuh, sampah menumpuk di beberapa sudut perkampungan, genangan air tampak pada pot-pot dan kaleng bekas minuman terdapat jentik – jentik nyamuk.

apakah tindakan prioritas dalam menghadapi masalah tersebut? a. Melakukan pendidikan kesehatan/penyuluhan b. Melakukan foging terhadap lingkungan c. Bersama-sama warga membersihkan lingkungan d. Membentuk Pokjakes kebersihan lingkungan di Desa X e. Berkolaborasi untuk menyelesaikan masalah dengan dinas terkait 55.

Posyandu Y berada di RW X, wilayah binaannya mencakup 2 RWyaitu RW X dan RW Z. pada tahun 2013 Tingkat partisipasi warga RW Z ke posyandu < 20 %. Warga RW Z mengeluhkan jarak ke Posyandu Y yang terlalu jauh. Pertanyaan soal: apakah tindakan prioritas dalam menghadapi masalah tersebut? 56. a) b) c) d) e) a. Menjadi inisiator dan fasilitator untuk pembentukan posyandu di RW Z b.

Membangun Posyandu di RW Z c. Menganjurkan Warga RW Z untuk hadir ke posyandu Y d. Memindahkan lokasi posyandu Y ke RW Z e. Memberikan warga RW Z penkes pentingnya ke posyandu Di Kelurahan X, dalam 5 tahun terakhir sudah 2 kali mengalami kejadian KLB Demam Berdarah (DBD), bulan Juli 2011 ditemui 25 kasus DBD, 15 warga dirawat di RS dan 5 diantaranya meninggal.

Prevalensi kasus Bulan Juli sudah hampir melewati prevalensi DBD tahun sebelumnya. Apakah masalah keperawatan komunitas utama sesuai dengan kasus diatas Kondisi lingkungan yang jelek Tidak ada voging Sosial ekonomi masyarakat rendah Tingkat pendidikan yang rendah Tingkat budaya yang rendah 57. Seorang Ibu singleparent lanugo pada bayi baru lahir 28 tahun,mempunyai dua orang anak usia prasekolah.

Ibu ini adalah seorang karyawan yang dibayar per jam oleh perusahaan dan memiliki asuransi kesehatan. Dia tidak mempunyai kendaraan dan sangat sulit mendapatkan transportasi umum. Pelayanan kesehatan yang dapat diperoleh hanyalah klinik yang buka pada saat dia bekerja. Manakah sistim pelayanan kesehatan yang tepat untuk ibu tersebut?

a. Kesediaan pelayanan kesehatan b. Kualitas dari pelayanan kesehatan c. Kurangnya pelayanan pencegahan penyakit d. Kurangnya tim medis yang berkualitas 58. Di suatu wilayahdengan jumlah jumlah penduduk 100 orang terdapat ibu hamil 25.4% dengan keluhan pusing 50%, mata berkunang-kunang 23%, kaki bengkak 17 %, dan sisanya masih memegang mitos tidak memakan makanan berprotein tinggi.

Apa diagnosa keperawatan yang paling tepat pada kasus tersebut? A. Resiko tinggi terjadinya gangguan tumbuh kembang pada janin berhubungan dengan pola makan yang tidak adekuat B. Resiko tinggi lanugo pada bayi baru lahir cacat pada bayi berhubungan dengan pola makan yang tidak sehat C.

Resiko tinggi terjadinya kematian janin berhubungan dengan kurangnya asupan nutrisi yang adekuat D. Resiko tinggi terjadinya perdarahan pada ibu hamil berhubungan dengan mitos yang salah tentang makanan ibu hamil E. Resiko penyulit kelahiran pada ibu hamil berhubungan dengan kurang terpaparnya informasi tentang kehamilan.

59. Di suatu wilayahdengan jumlah jumlah penduduk 100 orang terdapat ibu hamil 25.4% dengan keluhan pusing 50%, mata berkunang-kunang 23%, kaki bengkak 17 %, dan sisanya masih memegang mitos tidak memakan makanan berprotein tinggi, belum pernah mendapatkan informasi tentang kesehatan ibu hamil. Apa peran perawat yang paling tepat untuk mengatasi masalah tersebut?

A. Pemberi asuhan keperawatan B. Advokat C. Edukator D. Koordinator E. Kolaborator 60. Disuatu wilayah didapatkan hasil dikelilingi oleh sungai irigasi yang berfungsi untuk MCK masyarakat sekitarnya, selokan air mampet, sampah dibuang sembarangan, masyarakat memiliki kandang ternak yang tidak dipelihara, kondisi air minum berwarna dan berbau, mereka mengeluh jarang sekali ada petugas kesehatan, tidak ada pos yandu Apa tindakan yang harus dilakukan oleh perawat berdasarkan kasus tersebut?

A. Melakukan musyawarah masyarakat desa B. Melakukan penyuluhan PHBS C. Mengadakan pengobatan gratis dan D. Membangun MCK umum dengan bantuan dari LSM E. Memotivasi masyarakat untuk melakukan kerja bakti 61. Hasil pengkajian yang dilakukan suatu wilayah, didapatkan data : adanya peningkatan gangguan kesehatan dalam tiga bulan terakhir yang mencapai 70% kasus ISPA, dan 20% diare.

Berdasarkan observasi didapat saluran air banyak tergenang, berwarna hitam dan bau. Banyak sampah bertebaran dan terlihat lalat banyak. Letak RW 01 berbatasan dgn pasar sehingga sampah terlihat menumpuk.

lanugo pada bayi baru lahir

Masalah lainnya adalah kualitas air yang tidak baik, berwarna dan berbau. Apa fungsi manajemen yang paling pertama dilaksanakan oleh perawat komunitas dalam kasus tersebut? A. Perencanaan B. Organisasi C. Penggerakan D.

Pengawasan E. Penilaian 62. Kasus : Di Kelurahan A Kec. Bdengan karakteristik masyarakat sbb; 78 % suku Sunda, 20 % suku Jawa dan 2 % suku lainnya, Tingkat pendidikan masyarakat 75 % tamat SD, 15 tamat SLTP, 8 % tamat SLTA dan 2 % PT., Status Sosek 20 % kurang, 60, menengah dan 20 % tinggi. Komposisi penduduk menurut Umur: 15 % bayi& balita, 20% usia sekolah, 20 % usia remaja, 30 % usia dewasa dan 25 % pra lansia dan lansia.Kebiasaan yang tidak sehat pada kelompok dewasa dan lansia, minum kopi 65 %, merokok 40 %, merokok dan minum kopi 35 %, minum teh manis 25 %.

Prosentase penduduk yang melakukan olahraga secara teratur 10 %, makan sayur dan buah 15 %. Rata-rata cakupan kegiatan posbindu 30 % (tiap bulan). Penyakit yang diderita kelompok dewasa – lansia : 25% hipertensi, 30% DM, 15% rematik, 30% ISPA dan Diare. Bagaimana perumusan keperawatanya ? a. Tingginya kejadian penyakit DM b. Potensial peningkatan kejadian penyakit DM c.

Risiko peningkatan kejadian penyakit tidak menular d. Potensial penurunan kejadian penyakit tidak menular e. Tingginya kejadian penyakit jantung dan pembuluh darah 63.

Kasus : Di Kelurahan A Kec. Bdengan karakteristik masyarakat sbb; 78 % suku Sunda, 20 % suku Jawa dan 2 % suku lainnya, Tingkat pendidikan masyarakat 75 % tamat SD, 15 tamat SLTP, 8 % tamat SLTA dan 2 % PT., Status Sosek 20 % kurang, 60, menengah dan 20 % tinggi.

Komposisi penduduk menurut Umur: 15 % bayi& balita, 20% usia sekolah, 20 % usia remaja, 30 % usia dewasa dan 25 % pra lansia dan lansia.Kebiasaan yang tidak sehat pada kelompok dewasa dan lansia, minum kopi 65 %, merokok 40 %, merokok dan minum kopi 35 %, minum teh manis 25 %.

Prosentase penduduk yang melakukan olahraga secara teratur 10 %, makan sayur dan buah 15 %. Rata-rata cakupan kegiatan posbindu 30 % (tiap bulan). Penyakit yang diderita kelompok dewasa – lansia : 25% hipertensi, 30% DM, 15% rematik, 30% ISPA dan Diare. Upaya preventif sekunder untuk kejadian penyakit jantung dan pembuluh darah serta DM pada msyarakat kelurahan A diantaranya . a. Melaksanakan penyuluhan kesehatan b.

Melakukan skrining gula darah dan tensi c. Membentuk kelompok kegiatan senam di posbindu d. Mengadakan pelatihan / penyegaran kader posbindu e. Memberikan Pendidikan kesehatan tentang PBHS di rumah tangga 64. Kasus : Di Kelurahan A Kec. Bdengan karakteristik masyarakat sbb; 78 % suku Sunda, 20 % suku Jawa dan 2 % suku lainnya, Tingkat pendidikan masyarakat 75 % tamat SD, 15 tamat SLTP, 8 % tamat SLTA dan 2 % PT., Status Sosek 20 % kurang, 60, menengah dan 20 % tinggi.

Komposisi penduduk menurut Umur: 15 % bayi& balita, 20% usia sekolah, 20 % usia remaja, 30 % usia dewasa dan 25 % pra lansia dan lansia.Kebiasaan yang tidak sehat pada kelompok dewasa dan lansia, minum kopi 65 %, merokok 40 %, merokok dan minum kopi 35 %, minum teh manis 25 %.

Prosentase penduduk yang melakukan olahraga secara teratur 10 %, makan sayur dan buah 15 %. Rata-rata cakupan kegiatan posbindu 30 % (tiap bulan). Penyakit yang diderita kelompok dewasa – lansia : 25% hipertensi, 30% DM, 15% rematik, 30% ISPA dan Diare. Upaya promotif yang dapat dilakukan untuk masyarakat di kelurahan A Kecamatan B diantaranya . a. Melaksanakan penyuluhan kesehatan b. Melakukan skrining gula darah dan tensi c. Membentuk kelompok kegiatan senam di posbindu d.

Mengadakan pelatihan / penyegaran kader posbindu e. Memberikan Pelayanan kesehatan/pengobatan sederhana 65. Kasus : Di Kelurahan A Kec. Bdengan karakteristik masyarakat sbb; 78 % suku Sunda, 20 % suku Jawa dan 2 % suku lainnya, Tingkat pendidikan masyarakat 75 % tamat SD, 15 tamat SLTP, 8 % tamat SLTA dan 2 % PT., Status Sosek 20 % kurang, 60, menengah dan 20 % tinggi. Komposisi penduduk menurut Umur: 15 % bayi& balita, 20% usia sekolah, 20 % usia remaja, 30 % usia dewasa dan 25 % pra lansia dan lansia.Kebiasaan yang tidak sehat pada kelompok dewasa dan lansia, minum kopi 65 %, merokok 40 %, merokok dan minum kopi 35 %, minum teh manis 25 %.

Prosentase penduduk yang melakukan olahraga secara teratur 10 %, makan sayur dan buah 15 %. Rata-rata cakupan kegiatan posbindu 30 % (tiap bulan). Penyakit yang diderita kelompok dewasa – lansia : 25% hipertensi, 30% DM, 15% rematik, 30% ISPA dan Diare. Bagaimana Modifiable factors pada msyarakat kelurahan A ? a. Umur b. gender c. genetik d. pendidikan e. obesitas, merokok 66. Kasus : Di Kelurahan A Kec.

Bdengan karakteristik masyarakat sbb; 78 % suku Sunda, 20 % suku Jawa dan 2 % suku lainnya, Tingkat pendidikan masyarakat 75 % tamat SD, 15 tamat SLTP, 8 % tamat SLTA dan 2 % PT., Status Sosek 20 % kurang, 60, menengah dan 20 % tinggi. Komposisi penduduk menurut Umur: 15 % bayi& balita, 20% usia sekolah, 20 % usia remaja, 30 % usia dewasa dan 25 % pra lansia dan lansia.Kebiasaan yang tidak sehat pada kelompok dewasa dan lansia, minum kopi 65 %, merokok 40 %, merokok dan minum kopi 35 %, minum teh manis 25 %.

Prosentase penduduk yang melakukan olahraga secara teratur 10 %, makan sayur dan buah 15 %. Rata-rata cakupan kegiatan posbindu 30 % (tiap bulan). Penyakit yang diderita kelompok dewasa – lansia : 25% hipertensi, 30% DM, 15% rematik, 30% ISPA dan Diare. Apakah masalah yang menjadi penyebab penyakit jantung dan pembuluh darah serta DM a. Umur b. Genetik c. Kegemukan d. Ras dan jenis kelamin e. gaya hidup, pola makan, pola aktifitas 67. Di desa Munjul Kec.

Bungur, pada bulan Maret 2012 didapatkan data sebagai berikut; 95 % suku Sunda, 3 % suku Jawa dan 2 % lainnya, Tingkat pendidikan msyarakat 75 % tamat SD, 15 tamat SLTP, 8 % tamat SLTA dan 2 % PT., Status Sosek 25 % kurang, 65, menengah dan 10 % tinggi. Terdapat 1500 bayi dan balita dan 5 % balita dengan BGM dan ada 15 orang bumil dan 46,6 % dengan risiko tinggi. Penyakit yang banyak diderita sebulan terakhir pada balita, ISPA 30 %, diare 20 %, pada kelompok anak sekolah dan remaja, TB 1 %, DBD 1,5%, Diare 10 %.

Pada Kelompok Dewasa TB 1,5%, Hipertensi 10 %, rematik 15 %, DM 2 %. Pada kelompok pra lansia – lansia: 25 % jantung dan hipertensi, 18 % rematik, 5 % DM, 5 % TB. Data PHBS: 15% penduduk olah raga secara teratur, 20 % penduduk makan sayur dan buah setiap hari, dan 30 % remaja – lansia tidak merokok. Apakah prioritas Masalah Keperawatan pada kasus tersebut?

a. b. c. d. e. Gizi pada balita penyakit menular penyakit tidak menular kehamilan risiko tinggi perilaku hidup bersih dan sehat Soal KMB 1. Seorang laki-laki berusia 52 tahun dirawat di ruang Interna dengan keluhan sesak napas. Hasil pengkajian menunjukkan data bahwa pasien merasa sesak bila udara dingin, terdengar wheezing dan ronkhi, pergerakan cuping hidung, tampak kelelahan, berkeringat dingin, gelisah, kurang nafsu makan, BB : 60 kg, TB : 160 cm, Tekanan Darah 140/90 mmHg, Frekuensi nadi 108 x/menit, Frekuensi Napas 28 x/menit dan Suhu 36,40C.

Apakah masalah keperawatan yang tepat pada kasus di atas ? a. Gangguan Nutrisi b. Intoleransi Aktifitas c. Pola napas tidak efektif d. Bersihan jalan napas tak efektif e. Gangguan pertukaran gas (difusi) 2. Seorang laki-laki berusia 52 tahun dirawat di ruang Interna dengan keluhan sesak napas. Hasil pengkajian menunjukkan data bahwa pasien merasa sesak bila udara dingin, terdengar wheezing dan ronkhi, pergerakan cuping hidung, tampak kelelahan, berkeringat dingin, Tekanan Darah 140/90 mmHg, Frekuensi nadi 90 x/menit, Frekuensi Napas 28 x/menit dan Suhu 39,40C, Hasil AGD : PH 7,38, PCO2 45 mmHg, PO2 75 mmHg, HCO3 23 mmol/L dan Be +2.

Apakah tindakan yang tepat pada kasus di atas ? a. Berikan posisi semi fowler b. Pemberian oksigenasi dengan nasal canule c. Pemberian oksigenasi dengan simple mask d. Pemberian oksigenasi dengan rebreathing mask e. Pemberian oksigenasi dengan non rebreathing mask 3. Seorang anak perempuan berusia 5 tahun di rawat di ruangan anak, dari hasil pemeriksaan diketahui bahwa riwayat batuk berdahak sejak 1 bulan yang lalu, nafsu makan menurun, berkeringat malam, kehilangan berat badan 2 kg sejak sakit, Suhu 380C, pasien tinggal di daerah padat penduduk.

Apakah tindakan yang tepat untuk mencegah penyebaran di komunitas pada kasus di atas ? a. Tempatkan pasien di ruangan terpisah b. Gunakan masker pada orang yang sehat c.

Identifikasi resiko penularan pada orang lain d. Bersihkan secret dengan suction jika memungkinkan e. Berikan pendidikan kesehatan tentang tekhnik membuang sputum yang benar pada pasien dan keluarga 4. Seorang anak perempuan berusia 5 tahun di rawat di ruangan anak, dari hasil pemeriksaan diketahui bahwa riwayat batuk berdahak sejak 1 bulan yang lalu, nafsu makan menurun, kelelahan, berkeringat malam, kehilangan berat badan 2 kg sejak sakit, Suhu 380C, pasien tinggal di daerah padat penduduk.

Apakah diagnosa keperawatan utama pada kasus di atas ? a. Hipertermi b.d inflamasi b. Intoleransi aktifitas b.d fatigue c. Bersihan jalan napas tidak efektif b.d penumpukan secret d. Ketidakseimbangan nutrisi kurang dari kebutuhan tubuh b.d batuk produktif e. Resiko penyebaran infeksi b.d kurangnya pengetahuan untuk mencegah paparan dari kuman 5. Seorang anak perempuan berusia 5 tahun di rawat di ruangan anak, dari hasil pemeriksaan diketahui bahwa riwayat batuk berdahak sejak 1 bulan yang lalu, nafsu makan menurun, kelelahan, berkeringat malam, kehilangan berat badan 2 kg sejak sakit, Suhu 380C, pasien tinggal di daerah padat penduduk.

Apakah intervensi keperawatan yang tepat pada kasus di atas ? a. Lakukan suctioning b. Lakukan fisioterapi dada c. Ajarkan pasien tehnik batuk efektif 6. 7. 8. 9. 10. d. Atur posisi pasien dengan kepala lebih rendah e. Anjurkan pasien untuk minum dengan air hangat Seorang pasien perempuan berusia 50 tahun, dirawat di ruang penyakit dalam. Dari hasil pengkajian diketahui bahwa pasien bekerja di pabrik tekstil sejak 30 tahun yang lalu, lingkungan rumah pasien berada di kawasan pabrik, nyeri dadapunggung dan lengan dengan skala nyeri 3-4, batuk-batuk kadang berdarah, sesak napas.

Hasil rontgen diketahui pada paru tampak bayangan menyerupai kurva, dengan permukaan lateral lebih tinggi dari pada medial.

Apakah tindakan yang tepat pada kasus di atas ? a. Lakukan suctioning b. Lakukan fisioterapi dada c. Ajarkan pasien batuk efektif d. Lakukan pemasangan Water Sealed Drainage e.

Atur posisi pasien dengan kepala lebih rendah Seorang pasien perempuan berusia 50 tahun, dirawat di ruang penyakit dalam. Dari hasil pengkajian diketahui bahwa pasien bekerja di pabrik tekstil sejak 30 tahun yang lalu, lingkungan rumah pasien berada di kawasan pabrik, nyeri dadapunggung dan lengan dengan skala nyeri 3-4, batuk-batuk kadang berdarah, sesak napas.

Telah dilakukan pemasangan Water Sealed Drainage. Apakah posisi yang tepat pada pasien yang terpasang Water Sealed Drainage pada kasus di atas ? a. Atur posisi pasien dengan posisi supine b. Atur posisi pasien dengan posisi fowler c. Atur posisi pasien dengan posisi semi fowler d. Atur posisi pasien dengan kepala lebih rendah e. Atur posisi pasien SIM kearah daerah yang di Water Sealed Drainage Seorang pasien perempuan berusia 50 tahun, dirawat di ruang penyakit dalam.

Dari hasil pengkajian diketahui bahwa pasien bekerja di pabrik tekstil sejak 30 tahun yang lalu, lingkungan rumah pasien berada di kawasan pabrik, nyeri dadapunggung dan lengan, batuk-batuk kadang berdarah, sesak napas, suhu 38,50C, pemeriksaan rontgen : permukaan cairan yang terdapat dalam rongga pleura membentuk bayangan seperti kurva dengan permukaan daerah lateral lebih tinggi dari bagian medial.

Apakah tindakan diagnosa yang tepat pada kasus di atas ? a. Resiko tinggi infeksi b.d inflamasi b. Nyeri akut b.d inflamasi parenkim paru c. Pola napas tidak efektif b.d penurunan ekspansi paru d.

Kerusakan pertukaran gas b.d penurunan recoil paru-paru e. Bersihan jalan napas tidak efektif b.d penumpukan sekret Seorang remaja wanita dirawat di ruang interna dengan keluhan sesak napas, batuk berdahak sejak 3 minggu yang lalu, pasien sedang menjalani pengobatan OAT. Apakah tindakan yang tepat untuk mengeluarkan secret saat edukasi pasien pulang lanugo pada bayi baru lahir kasus di atas ?

a. Ajarkan pasien tindakan postural drainage b. Ajarkan pasien untuk tekhnik batuk efektif c. Ajarkan pasien dalam penggunaan nebuleizer d. Ajarkan pasien untuk melakukan fisioterapi dada e. Anjurkan pasien untuk rutin meminum obat mucolitik Seorang anak laki-laki berusia 2 tahun diantar oleh ibunya ke UGD dengan keluhan tersedak saat makan permen pasien batuk, gelisah dan memegang leher, suara menghilang,sukar bernapas. Apakah tindakan yang dilakukan pada kasus di atas ?

a. Laringoskopi b. Trakheostomi 11. 12. 13. 14. 15. 16. c. krikotiromi d. Sweaping finger e. Heimlich maneuver Seorang perempuan usia 35 tahun datang ke UGD dengan keluhan buang air besar encer sejak pagi tadi, antara 10-12 kali, mual, muntah dan tidak mau makan.

Hasil pengkajian turgor buruk, kulit kering, lemah, tekanan darah 100/60 mmHg, frekuensi nadi 100 x/menit, frekuensi napas 28 x/menit, suhu 380 C. Apakah masalah keperawatan yang tepat pada kasus diatas ? a. Hipertermia b. Intoleransi aktivitas c. Defisit volume cairan d. Gangguan integritas kulit e. Ketidakseimbangan nutrisi: kurang dari kebutuhan Seorang perawat di ruang perawatan penyakit dalam laki-laki sedang melakukan pemeriksaan fisik teknik perkusi, dilakukan pada right midklavikula line dimulai dari bunyi tympani abdomen lalu maju ke atas kemudian didapatkan bunyi dullness dan membuat tanda pada bunyi tersebut, Sedang melakukan pemeriksaan apakah perawat tersebut?

a. Usus halus b. Lambung c. Hepar d. Ginjal Seorang Laki-laki usia 18 tahun datang ke UGD dengan keluhan nyeri pada Right upper abdomen quadrant, mual, muntah, skleranya berwarna kuning, kulitnya berwarna kuning, pasien mengatakan sering buang air kecil, konjungtiva berwarna merah muda, tekanan darah 150/100 x/menit, frekuensi nadi 80 x/menit, frekuensi respirasi 24x/menit dan suhu 37,9 derajat celcius.

Pemeriksaan laboratorium apa yang tepat untuk kasus di atas? a. Hemoglobin, trombosit, dan eritrosit b. Leukosit dan eritrosit c. Ureum dan kreatinin d. SGOT dan SGPT Seorang perawat melakukan pemeriksaan tanda-tanda vital yang dilakukan setiap pagi, ketika memeriksa pasien Agus, perawat melihat banyak gelembung udara (air buble) pada selang infuse. Tindakan apa yang tepat dilakukan segera oleh perawat pada kasus diatas?

a. Menyelesaikan pemeriksaan tanda-tanda vital b. Melakukan flashing/memasukkan cairan NaCl 0,9 sampai gelembung udara ke luar c. Mengklem infus kemudian melakukan ‘ tik ‘ sehingga gelembung udara naik ke mikro/makro drip pada infuse set d. Memasukan jarum pada karet sehinga udara keluar Ketika perawat Rani sedang dines pagi, ada seorang pasienya yang mengeluh nyeri pada daerah luka operasi.

Apa yang paling tepat di lakukan oleh perawat Rani ? a. Memberikan analgetik kepada pasien kemudian mengukur pain score b. Menanyakan kepada pasien area nyeri dan penyebabnya c. Mengukur tanda-tanda vital dan pain score kemudian memberitahukan kepada dokter d. Mengukur pain score kemudian menganjurkan pasien untuk melakukan teknik relaksasi untuk mengurangi nyeri yang di rasakan pasien Seorang laki-laki usia 48 tahun yang sudah dirawat 5 harihasil pemeriksaan fisik lanugo pada bayi baru lahir terdapat asites, hal ini terkait dengan diagnose penyakit yang dideritanya yaitu sirosis hepatis, dokter yang merawatnya sudah 17.

18. 19. 20. 21. melakukan abdominal parasintesis.didapatkan T/D: 190/100mmhg, Hb: 11 mg persen. Apa penyebab asites pada kasus diatas ? a. Kadar trombosit yang rendah b. Kadar albumin yang kurang dari nilai normal c. Kadar hemotakrit yang tinggi d. Hipertensi Portal Seorang pasien laki-laki usia 31 tahun yang sedang di rawat di ruang bedah laki-laki mengeluh perut kembung 2 hari setelah operasi, tidak ada nafsu makan, mual dan ada sedikit nyeri pada ulu hati. Pada pemeriksaan fisik perut membuncit dan pada perkusi terdengar hiperesonan.

Apakah Intervensi keperawatan yang tepat pada pasien tersebut diatas ? a. Menganjurkan klien untuk membatasi makan b. Menyarankan pasien untuk mengunyah makanan dengan mulut tertutup c.

Menyarankan pasien untuk tidak mengkonsumsi permen karet d. Menganjurkan pasien untuk mobilisasi Seorang remaja usia 15 tahun yang sudah dirawat di ruang internis perempuan, dengan riwayat diet yang tidak terkontrol mengeluh mual dan kembung sejak 3 hari yang lalu, berat badan pasien sebelum sakit 60 kg dan setelah melakukan diet 50 kg.

Pendidikan kesehatan apa yang tepat diberikan pada pasien diatas? a. Menjelaskan pasien untuk napas dalam untuk mengurangi mual b. Menjelaskan pasien untuk membatasi aktivitas untuk mengatasai mual c. Menjelaskan pasien untuk tidak melakukan diet tidak terkontrol d. Menjelaskan pada pasien tentang diet yang baik dan benar Seorang bapak dengan usia 30 tahun datang ke poli internis dengan keluhan berat badan yang berlebih, saat diperiksa berat badannya adalah 90 kg, dan Tinggi badanya 165 cm, setelah konsultasi dengan dokter kemudian direncakan akan dilakukan tindakan liposuction (sedot lemak).

Berapakah nilai BMI pada pasien tersebut diatas? a. 25, 2 b. 26, 3 c. 27, 2 d. 28, 5 e. 29, lanugo pada bayi baru lahir Seorang ibu usia 35 tahun yang sedang dirawat di ICU dengan diagnosa keperawatan ketidakseimbangan nutrisi kurang dari kebutuhan sedang diberikan makanan cair melalui NGT oleh seorang perawat, pada tahap awal perawat melakukan aspirasi untuk mengetahui efektivitas penyerapan, kemudian memasukan makanan yang telah disiapkan pada spuit. Setelah makanan berada pada spuit langkah apa yang tepat dilakukan.

a. Mendorong makanan dengan pendorong spuit b. Membiarkan makanan turun dengan sendirinya c. Memposisikan spuit setinggi 10 cm diatas dada d. Mengoyang-goyang spuit sehingga obat tercampur dengan baik Seorang laki laki, usia 25 tahun dirawat diruang bedah post op appendiktomy hari ke 2,mengeluh mual. Pasien terpasang drain dengan output 100cc. Keadaan balutan luka kotor berwarna kecoklatan dan basah. Pasien terpasang infus RL 20 tts/menit. Apakah tindakan yang tepat untuk kasus diatas? a.

Perawatan luka b. Perawatan infus c. Perawatan drain d. Pemenuhan nutrisi e. Pemenuhan cairan 22. Seorang perempuan usia 20 tahun di rawat di Ruang penyakit dalam dengan keluhan nyeri ulu hati,mual dan muntah, cairan yang keluar berwarna merah kecoklatan.dan sesak. Hasil pengkajian adanya destensi abdomen,nyeri tekan abdomen, Tekanan Darah 100/70 mmHg, Nadi 88 X/mnt, Suhu 38 0 C,Respirasi 24X/mnt.

Apakah tindakan yang tepat pada kasus diatas? a. Pemasangan infus b. Pemasangan oksigen c. Pemberian kompres hangat d. Pemberian kompres dingin e. Pemasangan Nasogastric lanugo pada bayi baru lahir 23. Seorang laki-laki,usia 50 tahun,dirawat diruang penyakit saraf RS Cimahi, sejak 2 hari yang lalu dengan keluhan kepala pusing, mual, susah menelan, bicara rero. Hasil pengkajian didapatkan ekstremitas sebelah kanan lemah (kekuatan otot atas/bawah 4/4), Riwayat pasien menderita penyakit DM selama 5 tahun.

Pasien terpasang infus ditangan kiri Nacl 0.9 %. Apakah diagnosa keperawatan yang tepat pada kasus diatas? a. Intoleransi aktivitas b.d.penurunan kekuatan otot b. Gangguan Komunikasi Verbal b. d.kelemahan otot lidah c. Gangguan rasa nyaman nyeri b.d kurang suplai oksigen ke otak d.

Gangguan perfusi jaringan cerebral b.d penyempitan pembuluh darah e. Gangguan pemenuhan nutrisi : kurang dari kebutuhan b.d intake yang lanugo pada bayi baru lahir adequate 24.

Seorang laki-laki usia 40 Tahun dirawat di Ruang bedah, mengeluh nyeri jempol kaki kiri. Klien mengatakan punya riwayat penyakit DM turunan dari bapaknya. Hasil pengkajian kaki jempol kaki kiri luka berwarna hitam,banyak menggandung pus dan bau. Tekanan Darah 140/80 mmHg,Nadi 80 X/Mnt, Respirasi 23X/mnt,Suhu 380C. Hasil lab Lekosit 18.000mm3, gula darah PP 200 mg/dl,therapy insulin per oral.

Apakah tindakan yang tepat lanugo pada bayi baru lahir kasus diatas? a. Kompres hangat b. Kompres dingin c. Pemberian insulin d. Perawatan luka kering e. Perawatan luka lembab 25. Seorang laki-laki usia 40 Tahun dirawat diRuang bedah, mengeluh nyeri jempol kaki kiri. Pasien mengatakan nyeri seperti dituduk-tusuk dan menyebar.skala nyeri ( 6-7), Pasien mengatakan cemas dan punya riwayat penyakit DM turunan dari bapaknya.

Hasil pengkajian kaki jempol kaki kiri luka berwarna hitam TD 140/80 mmHg, Nadi 84 X/Mnt, Respirasi 23X/mnt,Suhu 380. Hasil laboratorium gula darah PP 200 mg/dl,therapy insulin per oral. Apakah diagnose keperawatan yang tepat pada dikasus diatas? a. Hipertermi b.d proses inflamasi b. Gangguan rasa aman : cemas b.d proses penyakit c. Resiko Penyebaran infeksi b.d jaringan sudah infeksi d.

Gangguan rasa nyaman : nyeri b.d inkontinuitas jaringan e. Perubahan nutrisi b.d gangguan keseimbangan pemberian insulin 26. Seorang laki-laki usia 40 Tahun dirawat diRuang bedah, mengeluh nyeri jempol kaki kiri.klien mengatakan nyeri dan menyebar.skala nyeri ( 2-3).Pasien mengatakan cemas dan punya riwayat penyakit DM turunan dari bapaknya.Hasil lanugo pada bayi baru lahir kaki jempol kaki kiri luka berwarna hitam,banyak pus dan bau,Tekanan Darah 140/80 mmHg, Nadi 84 X/Mnt, Respirasi 23X/mnt,Suhu 380.Hasil lab Lekosit 18.000mm3, gula darah PP 250 mg/dl,therapy insulin per oral.

Apakah diagnosa keperawatan yang tepat pada kasus diatas? a. Hipertermi b.d proses inflamasi b. Gangguan rasa aman : cemas b.d proses penyakit c.

Resiko Penyebaran infeksi b.d jaringan sudah infeksi 27. 28. 29. 30. 31. d. Gangguan rasa nyaman : nyeri b.d inkontinuitas jaringan e. Perubahan nutrisi b.d gangguan keseimbangan pemberian insulin Seorang laki-laki usia 40 tahun, datang ke igd dengan keluhan nyeri dada kiri menjalar ke pundak dan tangan kiri. Kejadian pasien sedang berolah raga,pasien memangang dada kiri dan jatuh pingsan selama 2 menit,pasien langsung dibawa ke RS terdekat.Sekarang pasien sedang dirawat sudah 2 hari yang lalu diruang penyakit dalam.

Jam 10.00 Wib pasien mengeluh nyeri dada, terasa berat ,baal ke tangan. Hasil pengkajian Tekanan Darah 130/80 mmHg. Respirasi 24X/Mnt,suhu 370C,Nadi 88 X/mnt.Hasil EKG saat masuk RS menunjukan adanya infark. Apakah tindakan kolaborasi yang tepat pada kasus diatas?

a. Pemberian oksigen b. Pemberian cairan infus c. Perekaman elektrokardiograpi d. Pemeriksaan analisa gas darah e. Pemindahan pasien keruang intensif Seorang perempuan usia 15 tahun,dirawat diruang penyakit dalam dengan keluhan sakit perut, mules,mual tak muntah, BAB cair.setiap hari BAB 4-5kali, feses cair, berlendir.

Sebelumnya pasien makan bakso pake sambel banyak karena klien suka makanan yang pedes. Hasil pengkajian Tekanan Darah 110/70 mmHg, Nadi 100x/Mnt, Respirasi 18X/mnt, Suhu 380,mukosa kering, turgor jelek. Apakah diagnose keperawatan yang tepat pada kasus di atas? a. Gangguan eliminasi : Diare b.

d adanya inflamasi b. Resiko integritas kulit b. d. peningkatan pola BAB c. Difungsi motilitas gastrointestinal b.d makanan kontaminan d. Resiko ketidakseimbangan elektrolit b.d defisensi volume cairan e. Ketidakseimbangan nutrisi : kurang dari kebutuhan tubuh b. d ketidakmampuan mencerna makanan Seorang laki-laki usia 18 tahun,datang igd ke RS dengan keluhan jatuh dengan posisi jatuhnya duduk ke tanah karena sedang naik motor bersama teman,dan pasien duduk dibelakang.

Pasien mengeluh sakit bagian pinggang. Hasil pemeriksaan,pasien terdapat luka lecet dibokong, kandung kemih penuh, terdapat adanya krepitasi pada tulang tibia kanan, Tekanan Darah 100/80 mmHg,Nadi 80X/mnt,Respirasi 24X/mnt,suhu 360C,pasien keringan dingin. Apakah tindakan keperawatan yang tepat pada kasus diatas? a. Perawatan luka b. Pemasangan gips c.

Pemasangan bidai d. Pemasangan infus e. Pemasangan polichateter Seorang laki-laki usia 45 tahun,datang ke poliklinik bedah untuk Kontrol dengan post op apendiktomy perforasi hari ke 7. Pasien mengatakan obat sudah habis, luka operasi terasa gatal,nafsu makan meningkat. Hasil pengkajian keadaan luka baik,tidak ada tanda- tanda peradangan. Apakah tindakan yang tepat untuk kasus diatas? a. Up hecting b. Perawatan luka c. Pemberian nutrisi d. Pemberian resep obat e. Pemberian pendidikan kesehatan Seorang pasien laki-laki usia 39 tahun dirawat di ruang penyakit dalam sejak 4 hari yang lalu.

Pasien mengatakan belum BAB sejak masuk rumah sakit. Hasil observasi menunjukkan tidak ada perdarahan yang keluar dari selang NGT, ekspresi pasien tampak tenang. TD 110/70 mmHg, Nadi 80 x/menit, RR 22 x/menit, Suhu 36 °C, akral 32. 33. 34. 35. hangat. Sampai saat ini pasien masih dipuasakan dan diijinkan untuk mulai makan besok pagi. Manakah jenis diet yang sesuai diberikan kepada pasien ? A. Tinggi protein, rendah lemak B. Tinggi kalori, rendah serat C. Rendah kalori, rendah lemak D. Makanan tinggi serat E.

Rendah protein, rendah serat Seorang laki-laki usia 52 tahun dirawat di ruang penyakit dalam. Keluhan pasien saat ini perut yang membesar dan merasa tidak nyaman. Hasil pengkajian menunjukkan data frekuensi napas 16 x/mnt, frekuensi nadi 115 x/menit, TD 100/70 mmHg, Suhu 37 °C.

Palpasi abdomen ; terdeteksi gelombang cairan. Pemeriksaan penunjang serum Na+ 155 mmol/L, albumin 2,6 g/dl. Dilakukan parasintesis dengan pengeluaran cairan peritoneum 6 liter. Apakah tindakan keperawatan yang tepat kepada pasien post parasintesis? A. Berikan posisi supine B. Tutup area luka penusukan C. Anjurkan pasien istirahat yang cukup D.

Kaji hipovolemia dan kehilangan elektrolit E. Lanjutkan memonitor tanda-tanda vital setiap 1 jam Seorang pasien laki-laki usia 40 tahun, datang ke UGD dengan keluhan sudah 3 hari muntah dan mual. Pemeriksaan fisik : TD 95/60 mmHg, frekuensi nadi 120 x/menit, frekuensi napas 26 x/menit, suhu 38,8°C. Perawat memberikan IV karena pasien mengalami defisiensi volume cairan. Cairan manakah yang tepat untuk pasien tersebut ?

A. Dextrose 5 % 500 ml sampai 1 liter B. Ringer’s lactate 1 sampai 2 liter C. Normal saline 4 sampai 5 liter D. Caian koloid 1 sampai 3 liter E. Manitol 10 % 500 ml Seorang pasien laki-laki usia 50 tahun, datang ke UGD dengan keluhan nyeri dada sebelah kiri sejak 1 jam yang lalu, nyeri menjalar ke punggung dan lengan kiri, mual, sesak napas, berkeringat dingin, lemah.

Hasil pemeriksaan fisik : TD 130/80 mmHg, frekuensi nadi 112 x/menit, frekuensi napas 23 x/menit, skala nyeri 10. Pemeriksaan penunjang EKG : Elevasi segment ST. Apakah masalah keperawatan yang tepat pada kasus diatas ? A. Perubahan pola napas B. Intoleransi aktifitas C. Gangguan rasa nyaman nyeri D. Ketidakseimbangan cairan dan elektrolit : kurang Lanugo pada bayi baru lahir. Ketidakseimbangan kebutuhan nutrisi : kurang dari kebutuhan tubuh Seorang pasien perempuan usia 60 tahun dirawat di ruang ICCU sejak 1 hari yang lalu.

Keluhan : lemah, batuk pada malam hari. Pemeriksaan fisik : TD 140/80 mmHg, frekuensi nadi 98 x/menit, frekuensi napas 26 x/menit. Pemeriksaan penunjang rongent dada : menunjukkan kardiomegali. Pasien direncakan akan dilakukan pemeriksaan ECHO. Diagnosis medis systolic heart failure. Apakah data yang dapat menunjang diagnosis dari hasil pemeriksaan ECHO ? A. Reduksi kekuatan pompapada ventrikel kiri dengan fraksi ejeksi kurang dari 40% B.

Meningkatnya tekanan pengisian ventrikel dengan fraksi ejeksi normal C. Ketidakmampuan ventrikel untuk relaksasi pada fase pengisian D. Meningkatnya tekanan arterial kiri E. Menurunnya tekanan arterial kanan 36. Seorang pasien perempuan usia 63 tahun dirawat diruang penyakit dalam sejak 2 hari yang lalu. Keluhan lelah apabila beraktifitas ringan, kaki bengkak, sakit kalau berjalan. Pemeriksaan fisik TD 130/90 mmHg, frekuensi nadi 113 x/menit, frekuensi napas 25 x/menit, suhu 35,8°C, edema ekstremitas grade 2.

Balance cairan 24 jam = + 500 cc. Pemeriksaan penunjang : rongent dada = kardiomegali, Diagnosis medis : CHF. Apakah diagnosa keperawatan yang tepat pada pasien tersebut ? A. Ketidakseimbangan cairan tubuh : berlebihan berhubungan dengan kurangnya output cairan Lanugo pada bayi baru lahir. Gangguan rasa nyaman : nyeri pada kaki berhubungan dengan penurunan sirkulasi darah C. Gangguan pemenuhan kebutuhan sehari-hari berhubungan dengan kelelahan D. Tidak efektifnya pola napas berhubungan dengan hiperventilasi E.

Intoleransi aktifitas berhubungan dengan kelelahan 37. Seorang pasien laki-laki usia 41 tahun datang ke UGD dengan keluhan dada berdebar debar, badan terasa lemah. Pemeriksaan fisik : TD 90/60 mmHg, frekuensi nadi 130 x/menit, pulsasi lemah,suhu 36,7 °C.

Pemeriksaan penunjang EKG = atrial fibrilasi. Diagnosis medis : Emboli paru. Manakah tanda dan gejala lainnya yang menunjang diagnosis medis tersebut?

A. Palpitasi, diaphoresis B. Frekuensi nadi ireguler, syncope C. Hipertensi, demam D. Hypoxia, dyspnea E. Bradycardia 38. Seorang pasien laki-laki usia 55 tahun, dirawat di ruangan penyakit dalam. Keluhan nyeri pada kaki, nyeri bertambah apabila sedang tidur, sering kram. Pemeriksaan fisik TD 100/60 mmHg, frekuensi nadi 70 x/menit pulsasi lemah, frekuensi napas 20 x/menit, suhu 36,2°C.

Diagnosis medi penyakit vaskuler perifer. Masalah keperawatan utama : gangguan perfusi jaringan perifer berhubungan dengan gangguan sirkulasi. Manakah implementasi yang tepat untuk meningkatkan suplai darah arteri ke ekstremitas A. Menurunkan ekstremitas dibawah jantung B. Meninggikan ekstremitas diatas jantung C. Mendorong latihan postural pasif D. Melarang berdiri diam dan duduk lama E. Mendorong pasien untuk berjalan 39. Seorag pasien perempuan usia 25 tahun, dirawat diruang penyakit dalam.

Keluhan berat badan menurun drastic sebanyak 20 kg dalam kurun waktu 1 bulan, sering terasa lapar, makan selalu banyak, lemah dan berdebardebar, susah tidur. Pemeriksaan fisik TD 120/95 mmHg, frekuensi nadi 110 x/menit, frekuensi napas 21 x/menit, suhu 37,7 °C. Pemeriksaan penunjang laboratorium : serum T3 = 200 ng/dL dan serum T4 15 ng/dL.

Apakah masalah keperawatan yang tepat ? A. Intoleransi aktifitas B. Gangguan pola tidur C. Gangguan rasa nyaman : nyeri dada D. Ketidakseimbangan cairan tubuh : kurang E. Ketidakseimbangan nutrisi dari kebutuhan tubuh = berkurang 40. Seorang pasien perempuan usia 35 tahun dirawat diruang penyakit dalam. Keluhan “ hilang nafsu lanugo pada bayi baru lahir, mual, muntah, bengkak pada kaki dan tangan, sakit kepala.

Pemeriksaan fisik : TD 100/70 mmHg, frekuensi nadi 113 x/menit, frekuensi napas 22 x/menit, suhu 35°C. Pemeriksaan penunjang laboratorium : serum Na+ 128 mmol/L, 41. 42. 43. 44. Na+ urin 150 mEq/L. Diagnosis medis : SIADH.

Masalah keperawatan : ketidakseimbangan volume cairan tubuh : berlebih. Apakah tindakan keperawatan yang tepat untuk restriksi cairan? A. Pasang kateter B. Kurangi intake garam C. Kaji edema setiap 6 jam D. Berikan cairan Ringer’s lactate E. Intake cairan dibatasi dengan diberikan 500 – 600 ml/24 jam Seorang Laki-laki, 54 tahun datang ke UGD dengan keluhan nyeri pada luka di jempol kaki kirinya.

Lukanya tampak bernanah, kotor, dan berbau. Klien tampak lemah dan mengatakan bahwa ia menderita penyakit kencing manis sejak setahun yang lalu. Hasil pemeriksaan fisik didapatkan : Tekanan Darah 140/90 mmHg, Nadi: 80 x/mnt, Frekuensi Nafas : 20 x/mnt, Suhu lanugo pada bayi baru lahir 37,5˚C. Pemeriksaan penunjang : Lab GDS 200gr/dl. Apakah tindakan keperawatan yang tepat untuk pasien tersebut ? A. Perawatan luka klien B. Pemberian cairan infus C.

Pembatasan diet kalori D. Pemeriksaan laboratorium lanjut E. Kolaborasi pemberian analgesik Seorang Laki-laki, 24 tahun datang ke UGD dengan keluhan nyeri pada bagian perut kanan bawah yang disertai mual, muntah dan penurunan nafsu makan.

Klien tampak meringis dan mengatakan nyerinya seperti ditusuktusuk, tidak hilang dengan beristirahat. Hasil pemeriksaan fisik didapatkan : Tekanan Darah 140/90 mmHg, Nadi: 90 x/mnt, Frekuensi Nafas : 26 x/mnt, Suhu : 37,7˚C. Pemeriksaan penunjang : Lab Leukosit 16000 µ/mm3.

Apakah masalah keperawatan utama pada pasien tersebut ? A. Nyeri akut B. Kecemasan C. Hiperthermia D. Defisit Volume Cairan E. Ketidakseimbangan nutrisi kurang dari kebutuhan tubuh Seorang Perempuan, 32 tahun dirawat di ruang penyakit dalam dengan keluhan nyeri pada lambung yang disertai mual dan muntah. Klien mengatakan ia selalu mengabaikan waktu sarapan paginya dan menyukai makanan pedas dan asam. Hasil pemeriksaan fisik didapatkan : Tekanan Darah 120/80 mmHg, Nadi: 78 x/mnt, Frekuensi Nafas : 20 x/mnt, Suhu : 37˚C.

Pemeriksaan penunjang : Lab Hb 10gr/dl, Serologi : Adanya H. Pylori. Manakah intervensi keperawatan yang tepat untuk pasien di atas ?

A. Pemberian cairan intravena B. Pemeriksaan Ultrasonografi C. Kolaborasi pemberian antasida D. Diet makanan dengan porsi sedikit tapi sering E. Menganjurkan untuk menghindari makanan pedas dan asam Seorang laki – laki, 24 tahun datang ke UGD dengan keluhan mual – muntah, tampak ada darah saat BAK, urin yang keluar sedikit – sedikit dan terasa panas.

Setelah dilakukan pengkajian, didapatkan data yaitu Tekanan darah : 110/70mmHg, Nadi : 88x/menit, suhu : 39˚C, hematuria, dysuria, nyeri pinggang dan saat di palpasi pasien mengeluh nyeri pada abdomen kuadran bawah. Hasil pemeriksaan Laboratoriim yaitu Leukosit 12000µ/mm3 dan terdapat protein :+3. Apakah diagnosa keperawatan berdasarkan prioritas pada pasien tersebut ?

A. Resiko infeksi berhubungan dengan resistensi urin B. Kekurangan volume cairan berhubungan dengan retensi urin C. Nyeri berhubungan dengan proses infeksi uretra dankandung kemih 45. 46. 47. 48. D. Perubahan pola eliminasi berhubungan dengan sering berkemih, urgensi E. Ketidak seimbangan nutrisi kurang dari kebutuhan berhubungan dengan mual - muntah Seorang laki - laki 46 tahun, dirawat di ruang penyakit dalam dengan keluhan pusing dan muntah.

Saat PerawatKmelakukan pengkajian didapatkan data bahwa pasien tampak lemah, masih pusing, nyeri pada kepala dan muntah 2x di RS, diawali ketika pasien selesai mengkonsumsi sate kambing, keluhan lain yaitu tegang pada leher, keringat dingin, dilakukan pemeriksaan Tekanan darah : 160/100 mmHg, Nadi :100 x/mnt. Pasien mengatakan sudah satu tahun terakhir tekanan darah pasien berkisar 140 - 180/110 mmHg, pasien juga mengatakan dalam sehari bisa menghabiskan 3 bungkus rokok dan salah satu orang tuanya juga memiliki riwayat tekanan darah tinggi.

Apakah pokok bahasan yang tepat untuk pendidikan kesehatan pada klien tersebut ? A. Hipertensi B. Pola hidup sehat C. Bahaya merokok D. Diet rendah garam E. Konsumsi makanan Seorang laki – laki, umur 55 tahun, dirawat di ruang jantung dengan keluhan sesak nafas selama 10 menit dirumah. Saat dikaji oleh perawat didapatkan data : pasien masih sesak dengan frekuensi pernafasan 28x/menit, tampak asites dan edema tungkai, terpasang Oksigen 5 liter/mnt. Hasil pemeriksaan diagnostik yang dilakukan adalah : Foto RO : tampak cardiomegali, oedema paru dan pemeriksaan darah : CK-MB73 u/L.

Apakah diagnosa keperawatan yang utama pada pasien tersebut ? A. Intoleransi aktivitas B. Kelebihan volume cairan C. Penurunan curah jantung D. Gangguan pertukaran gas E. Perfusi jaringan kardiopulmonal tidak efektif Seorang perempuan berumur 60 tahun dirawat di ruang syaraf sejak 2 hari yang lalu dengan keluhan utama kelemahan pada bagian tubuh sebelah kiri.

Keadaan umum tampak sakit berat. Pasien mengeluh selalu pusing disertai mual,muntah. Semua aktivitas dibantu oleh keluarga dan perawat. Pasien mengatakan dua hari lalu pasien terjatuh saat ke kamar mandi dan langsung tidak sadarkan diri selama 1 jam, setelah dibawa ke RS pasien baru sadarkan diri. Pasien memiliki riwayat hipertensi sejak 5 tahun yang lalu.

Hasil observasi didapatkan : Tekanan darah: 160/110 mmHg, Nadi : 96x/menit, Suhu : 36˚C, Frekuensi nafas : 22x/mnt. IMT = 25,78 kg/m². Hasil CT-Scan : Kesan : hematom dan edema perifokal di thalamus kanan. Diet yang diberikan adalah : diet rendah garam dan rendah lemak.

Apakah intervensi yang tepat untuk pasien tersebut ? A. Ubah posisi pasien tiap 2-4 jam B. Kolaborasi pemberian antistroke C. Lakukan pemasangan dan perawatan NGT/sonde D. Latihan rentang gerak pasif pada semua extremitas E.

Letakkan kepala pada posisi agak ditinggikan 15˚ - 45˚ Seorang perempuan berusia 35 tahun dirawat di ruang paru dengan keluhan sesak nafas. Klien mengatakan bahwa ia memiliki riwayat asma. Setelah pengkajian didapatkan data yaitu tekanan darah : 120/80mmHg, Nadi : 85 x/menit, frekuensi nafas : 28x/menit. Adanya retraksi otot-otot bantu nafas dan pernafasan cuping hidung, bibir tampak sianosis, capillary refill > 3detik. Perawat memasangkan Oksigen 5 liter/menit sesuai instruksi dokter.

Apakah intervensi keperawatan pada pasien tersebut agar kemungkinan dari kekambuhan asmanya bisa dikontrol? A. Kolaborasi pemberian vasodilator B. Menghindari faktir pencetus asma 49. 50. 51. 52. 53. C. Pendidikan kesehatan tentang asma D. Mengkaji pengetahuan klien tentang asma E.

Menganjurkan pasien untuk mengubah pola hidupnya Seorang perempuan berumur 25 tahun dirawat di ruang bedah, post operasi appendicitis hari ke 5 dan diperbolehkan pulang oleh dokter yang menanganinya. Klien mengatakan keadaannya sudah mulai membaik. Saat dikaji luka operasi tampak kering, bersih, dan area insisi menutup rapat. Lanugo pada bayi baru lahir sudah melakukan aktivitas sehari-harinya secara mandiri. Apakah discharge planning yang tepat untuk pasien tersebut ? A. Perawatan luka B. Pola hidup sehat C.

Pembatasan aktivitas D. Membatasi konsumsi makanan pedas E. Diet tinggi kalori dan tinggi protein Seorang laki – laki berumur 54 tahun dirawat di ruang syaraf dengan keluhan utama kelemahan pada bagian tubuh sebelah kiri.

Keadaan umum tampak lemah dan semua aktivitas dibantu oleh keluarga dan perawat. Pasien mengalami penurunan kesadaran. Memiliki riwayat hipertensi sejak 3 tahun yang lalu. Hasil observasi didapatkan : Tekanan darah: 150/110 mmHg, Nadi : 96x/menit, Suhu : 36˚C, Frekuensi nafas : 22x/mnt. Dokter menginstruksikan untuk dilakukan pemasangan NGT untuk memenuhi kebutuhan nutrisi pasien. Apakah langkah selanjutnya setelah selang NGT dimasukkan sesuai dengan pengukuran yang telah anda lakukan ?

A. Memastikan NGT masuk ke lambung B. Mengaspirasi NGT dengan spuit 10cc C. Menutup selang NGT dengan Spuit 10cc D. Memfiksasi selang NGT di hidung pasien E. Memasukan cairan Nacl 0,9% melalui NGT Seoranglaki-lakiusia 44 th di bawake IGD dengankondisitidaksadar.

Dari pengkajian di peroleh data bunyinafas stridorkarenalidahterjatuh, tidakadatanda trauma cervikal : 100/80 mmHg, nadi: 88x/menit, pernafasn : 20 x/menit. Bagaimanatindakan yang harusdilakukanuntukmembukajalannafaspadaklientersebut a.

Posisikan kepala hiper ektensi b. Manufer heimlich c. Cross finger d. Jaw thrust e. Pemasangan Oropharingeal airway Seorang laki-laki berusia 45tahun datang ke RS dengan keluhan sesak nafas. Dari hasil pengkajian diperoleh data batuk berdahak, hasil auskultasi suara nafas ronkhi di dadakanan, TD : 110/70 mmHg, N: 84x/menit, pernafasan 26 x/menit, suhu : 36°C.Telah diposisikan semi fowler sesak berkurang namun sekret susah dikeluarkan.

Apakahtindakan yang harusdilakukan ? a. Kolaborasi pemberian bronkhodilator b. Kolaborasi O2 c. Postural drainase d. Mengobservasi status respirasi e. Mengauskultasi suara nafas Seorang laki-laki berusia 43 tahun di antarke IGD oleh keluarganya dengan keluhan sesak nafas. Dari hasil pengkajian diperoleh data pasien suara nafas whezing, TD : 120/70 mmHg, N: 74x/menit, pernafasan 28x/menit, suhu : 36°C.

Riwayat penyakit dahulu Asma Bronkhiale Apakah tindakan keperawatan yang pertama harus segera dilakukan untuk mengatasi masalah di atas?

a. Posisikan pasien semi fowler b. Kolaborasi pemberian O2 54. 55. 56. 57. 58. c. Kolaborasi pemberian bronkodilator d. Mengajarkan batuk efektif e. Mengkaji status respirasi Seorang laki laki usia 56 tahun dirawat dengan keluhan sesak nafas. Dari hasil pengkajian di dapatkan data nyeri dada pada saat bernafas tekanan darah 110/70 mmHg, Nadi 64 x/menit, pernafasan 30 x/menit.

Pasien sudah dianjurkan untuk tidur dengan posisi semi fowler namun sesaknya belum berkurang. Apakah tindakan selanjutnya yang harus dilakukan ? a. Mengkaji status respirasi b.

Kolaborasi pemberian O2 c. Mengajarkan batuk efektif d. Kolaborasi pemberian bronkodilator e. Menganjurkan untuk minum air hangat Seorang laki-laki berusia 43 tahun datang ke IGD dengan keluhan sesak nafas. Darihasil pengkajian diperoleh data batuk berdahak, nyeri dada saat bernafas, suara nafas wheezing, pernafasan lanugo pada bayi baru lahir hidungdan tampak lemas tekanan darah : 110/70 mmHg, N: 84x/menit, pernafasan 28 x/menit, suhu : 36°C.

Apakah masalah keperawatan yang utama muncul? a. Bersihan jalan nafas tidak efektif b. Pola nafas tidak efektif c. Gangguan pertukaran gas d. Intoleransi aktifitas e. Nyeri akut Seorang laki-laki berusia 43 tahun datang ke IGD dengan keluhan sesak nafas. Dari hasil pengkajian diperoleh data batuk berdahak, nyeri dada saat bernafas, suara nafas wheezing, pernafasan cuping hidungdan tampak lemas tekanan darah : 110/70 mmHg, N: 84x/menit, pernafasan 28 x/menit, suhu : 36°C.

Apakah masalah keperawatan yang utama muncul? a. Bersihan jalan nafas tidak efektif b. Pola nafas tidak efektif c. Gangguan pertukaran gas d.

Intoleransi aktifitas e. Nyeri akut Duahari yang lalu Tn. U, umur 60 tahun, barusajapulangdirawatdariRumahSakitInsanidenganpenyakitGagalJantung. SelanjutnyaPerawatNn. Q melakukankunjunganrumahke Tn. U untukmengevaluasiperkembangakesehatannya. Apakahjenis diet yang perludisampaikankepada Tn. U dankeluargauntukmencegahterjadinyaseranganulangpenyakittersebut? a. Diet tinggikalori b. Diet tinggi protein c. Diet rendahgaram d. Diet lunak e. Diet tinggikalsium Ibu N, usia 25 tahundatangkeRumahSakitPerdanadengankeluhanmerasalemah, letihdanlesu.

Hasilpemeriksaandarahmenunjukanbahwaerytrosit 3,5 jt /mm³, leukosit 4500 /mm³, danHb 9 gr%. Apakahtindakankolaboratif yang tepatuntukmeningkatkankadarHbpaseintersebut a. Pemberiancairan intravenous b. Pembatasanaktivitas c. Kemoterapi d. Transfusi Red Blood Cell 59.

60. 61. 62. 63. e. Exchange transfusion Seorang perempuan 65 tahun dirawat diruang penyakit dalam perempuan dengan diagnosa CKD. Saat dikaji pasien mengeluh nyeri perut sebelah kiri, mual, dan muntah sudah 3 kali.

Hasil pemeriksaan fisik ditemukan data tekanan darah: 180/100 mmHg, nadi: 88 kali/menit, frekuensi nafas: 26 kali/menit, suhu: 36oC. Hasil pemeriksaan laboratorium didapatkan data Hb: 7,10 gr%, Hematokrit: 21 %, Leukosit: 7600 cell/mm3, kreatinin: 10,3, Ureum: 72.

Berdasarkan gejala klinis, menurut saudara apa penyebab pasien mengalami gejala mual muntah ? A. Tekanan darah yang tinggi B. Kadar Hb yang rendah C. Kadar ureum yang tinggi D. Hematokrit yang rendah E. Kadar kreatinin yang tinggi Seorang keluarga pasien melapor pada perawat bahwa cairan infusnya sudah habis. Namun karena perawat sedang mengerjakan sesuatu dia menyuruh keluarga pasien tersebut menunggu saja di kamar.

Sekitar 30 menit ditunggu perawat belum datang, akhirnya disusul kembali. Ternyata perawat tersebut lupa. Saat di lihat ternyata cairan sudah habis dan udara sudah masuk ke pembuluh darah pasien. Aspek etik apa yang dilanggar oleh perawat tersebut? A. Justice B. Fidelity C. Autonomy D. Beneficience E. Non Maleficience Seorang wanita berumur 61 tahun dirawat dengan diagnosis stroke hemorhagic.

Klien mengalami penurunan kesadaran (GCS 11). Hasil pemeriksaan tanda vital didapatkan tekanan darah 240/150 mmHg, nadi 96 kali/menit, pernafasan 16 kali/menit, dan suhu 38,7 oC. Klien mengalami paralisis, kesulitan mengunyah dan menelan, serta bicara pelo. Intervensi keperawatan yang harus dilakukan pertama kali untuk mencegah kematian adalah?

A. Memasang NGT untuk mencegah aspirasi B. Memberikan terapi oksigen 4 liter melalui nasal kanul C. Kolaborasi pemberian manitol 3x150 cc D. Kolaborasi pemberian antihipertensi secara agresif E. Pemberian cairan intravena NaCl 0,9% 20 tetes/menit Seorang laki-laki berusia 57 tahun dirawat dengan diagnosis efusi pleura.

Hasil pengkajian didapatkan pasien mengeluh sesak nafas yang bertambah jika posisi berbaring. Hasil pemeriksaan fisik didapatkan tekanan darah 120/80 mmHg, suhu tubuh 36,5 oC, pernapasan 30 kali/menit, nadi 88 kali/menit.

Klien tampak sianosis, dan kelelahan. Hasil pemeriksaan analisa gas darah didapat FiO2 92%, PCO2 40,8 mmHg, PaO2 360,1 mmHg. Dokter menginstruksikan untuk diberi terapi oksigen. Berdasarkan hasil pemeriksaan, terapi oksigen apa yang tepat diberikan pada pasien tersebut? A. Nasal kanul B. Masker sederhana C. Kateter kanul D. Masker rebreathing E. Masker non-rebreathing Seorang wanita berumur 30 tahun datang ke poli kulit dengan keluhan gatal-gatal dan pedih pada wajah.

Hasil pemeriksaan ditemukan lesi pada pipi, dagu, hidung, dan dahi, dengan karakteristik tidak berbatas tegas, berisi 64. 65. 66. 67.

cairan dan meluas ke daerah sekitarnya. Saat anamnesa klien mengatakan baru saja menggunakan suatu cream wajah yang baru dibeli. Apa diagnosa keperawatan utama yang dapat di angkat pada kasus tersebut? A. Gangguan rasa nyaman: nyeri b.d iritasi kulit B. Gangguan rasa nyeman: gatal b.d reaksi alergi C. Gangguan integritas kulit b.d proses inflamasi D. Gangguan body image b.d luka pada wajah E. Kurang pengetahuan b.d kurangnya informasi Seorang perempuan berumur 36 tahun dirawat di ruang perawatan dengan diagnosa HIV-AIDS.

Saat ini kondisi klien mengalami penurunan kesadaran akibat meningitis. Klien mengalami diare kronis yang sudah parah. Hasil pengkajian ditemukan luka lecet pada daerah anal dan pinggang, kulit dan membran mukosa kering.

Tanda vital : tekanan darh 90/60 mmHg, pernafasan 28 kali/menit, nadi 104 kali/menit, suhu 38,2oC. Klien tampak kotor dan bau. Apa masalah keperawatan utama pada pasien tersebut? A. Gangguan integritas kulit B. Gangguan personal hygiene C. Gangguan nutrisi kurng dari kebutuhan D. Gangguan suhu tubuh: hipertermia E.

Gangguan keseimbangan cairan dan elektrolit Seorang laki-laki berumur 34 tahun dirawat di RS tempat anda bekerja. Dari hasil pemeriksaan diketahui bahwa pasien HIV+.

Keluhan saat ini pasien sulit untuk makan, karena nyeri saat mengunyah dan menelan, sesak nafas dan batuk disertai dahak yang kental yang sulit untuk dikeluarkan. Pasien selalu ditemani tunangannya. Saat tunangannya sedang tidak berada disamping pasien, perawat mendapat pesan dari pasien agar merahasiakan segala sesuatu yang berkaitan dengan penyakitnya, karena tunangannya tidak tahu bahwa dia HIV+.

Bagaimana sikap perawat terhadap permintaan tersebut? A. Perawat merahasiakan status penyakit klien pada tunangannya sesuai dengan permintaan klien B. Perawat merahasiakan namun nanti akan memberitahu tunangan klien tertular supaya unangannya mengetahui C.

Perawat memberitahu tunangan klien dan mencoba membujuk untuk tidak mau dinikahi klien D. Perawat menanggapi dengan acuh tak acuh karena perawat merasa banyak pekerjaan yang lebih penting dibanding mengurusi urusan klien E. Perawat akan mempertemukan pasien dengan tunangannya kemudian akan menjelaskan tentang penyakit dan cara penularannya Seorang perempuan berumur 29 tahun, baru melahirkan dengan sectio secaria atas indikasi solusio plasenta.

Tiga hari masa perawatan klien mengeluh lemas, sakit pada persendian dan perut sakit. Hasil pengkajian ditemukan petekie, dan ekimosis pada bekas tusukan infus dan suntikan. Berdasarkan gejala tersebut, maka kemungkinan apa yang dialami klien? A. Koagulasi intravaskuler diseminata B. Perdarahan intra abdomen C. Trombositopenia D. Lanugo pada bayi baru lahir E. Hipoplatelet Seorang laki-laki berumur 52 tahun dirawat dengan keluhan ada benjolan di telapak kaki kiri. Benjolan dari bekas luka yang tidak sembuh-sembuh.

Benjolan semakin membesar, mengeras dan dirasakan semakin nyeri. Setiap klien membersihkan luka darah banyak keluar. Klien didiagnosa menderita kanker sel skuamosa. Lapisan kulit apa yang mengalami keganasan?

A. Epidermis B. Dermis 68. 69. 70. 71. 72. C. Subkutis D. Seluruh lapisan kulit E. Stratum basal saja Seorang wanita remaja usia 16 tahun datang ke poli kulit dengan keluhan wajah berjerawat. Wajah terdapat lesi berupa bintik-bintik kecil yang mengandung nanah, kemerahan menyebar pada area pipi, dagu dan dahi.

Keluhan tersebut muncul sejak klien mengalami menstruasi pertama. Semakin lama jerawatnya semakin banyak. Sudah dilakukan berbagai pengobatan, namun belum membuahkan hasil. Klien mengatakan malu dan minder terutama saat bertemu dengan teman-temannya. Masalah keperawatan psikososial apa yang muncul pada kasus tersebut? A. Gangguan body image B. Gangguan harga diri rendah C. Gangguan identitas diri D. Gangguan konsep diri E. Gangguan fungsi peran Seorang laki-laki berusia 50 tahun dirawat di ruang penyakit dalam dengan diagnosa CHF.

Pasien mengeluh sesak nafas. Oleh dokter pasien mendapat terapi diuretik dan instruksi pemasangan dower kateter. Setelah perawat menjelaskan tentang tujuan pemasangan dower kateter, pasien menolak untuk dilakukan tindakan tersebut. Tindakan apa yang dilakukan perawat selanjutnya? A. Menyediakan urinal B.

Memasang kondom kateter C. Memberikan informed consent D. Menyuruh keluarga untuk membujuk pasien E. Menjelaskan kembali tujuan pemasangan dower kateter Seorang laki-laki berusia 35 tahun dirawat di ruang penyakit dalam dengan diagnosa TBC aktif. Klien mengeluh sesak nafas dan batuk produktif. Hasil pemeriksaan fisik ditemukan suara ronchi di seluruh lapang paru, dan stridor di area bronkhus.

Tanda vital: tekanan darah 125/80 mmHg, frekuensi nadi 89 kali/menit, frekuensi nafas 30 kali/menit, suhu 38 oC.

Hasil foto ronsen ditemukan adanya gambaran bercak putih terutama di kedua apex paru. Apa tindakan keperawatan untuk kasus di atas? A. Mengatur posisi tidur semi fowler B. Melakukan postural drainage C. Melakukan klapping dada D.

Menganjurkan pasien melakukan batuk efektif E. Kolaborasi pemberian obat mukolitik dan bronkodilator dengan nebulazer Ny. N 45 tahun dirawat di ruang penyakit dalam dengan keluhan utama sesak. Saat dikaji RR 30 kali per menit, N 70 kali per menit S 36,5 0 C dan TD 140/100 mmHg.

TB : 156 cm dan BB 40 kg. Perawat akan memberikan terapi oksigen dengan menggunakan Nasal canule. Berapakah oksigen yang harus diberikan pada pasien tersebut? a. 1 liter b. 2 liter c. 3 liter d. 4 liter Seorang pasien laki-laki 56 tahun datang dengan keluhan sulit BAK dilakukan pemasangan kateter urine. Perawat yang akan melakukan pemasangan kateter melakukan fiksasi dengan memasukan aquadest hingga kateter terfiksasi dan tidak mudah lepas.

Berapakah jumlah cairan yang harus dimasukan oleh perawat? a. 1-5 cc b. 10-20 cc c. > 30 cc 73. 74. 75. 76. 77. 78. d. > 40 cc Seorang pasien laki-laki 56 tahun datang dengan keluhan sulit BAK dilakukan pemasangan kateter urine.

Perawat yang akan melakukan pemasangan kateter melakukan fiksasi dengan memasukan aquadest hingga kateter terfiksasi dan tidak mudah lepas. Berapakah jumlah lanugo pada bayi baru lahir yang harus dimasukan oleh perawat? a. 1-5 cc b.

10-20 cc c. > 30 cc d. > 40 cc Pasien dengan status kesadaran koma, dilakukan pemenuhan kebutuhan nutrisi melalui Nasogastric Tube. Pada saat melakukan pemasangan perawat melakukan tes apakah selang sudah masuk dengan benar ke lambung. Bagaimanakah cara yang dapat dilakukan perawat untuk melakukan tes tsb? a. Auskultasi di bagian abdomen sambil memasukan udara melalui spuit 50 cc b. Auskultasi di bagian dada sambil memasukan udara melalui spuit 50 cc c.

Perkusi di bagian abdomen sambil memasukan udara melalui spuit 50 cc d. Perkusi lanugo pada bayi baru lahir bagian dada sambil memasukan udara melalui spuit 50 cc Seorang laki-laki mengalami kecelakaaan sehingga mengalami cedera patah tulang pada tangan sebelah kanan, dengan perdarahan hebat. Hasil pemeriksaan TTV : Td 90/70 mmHg, Nadi lemah 60 kali permenit, terdapat sianosis pada daerah perifer. Gangguan rasa nyaman nyeri b.d proses kerusakan jaringan akibat diskontinuitas jaringan.

Apakah Daignosa utama yang muncul pada kasus tersebut ? a. Gangguan mobilisasi fisik b.d penurunan fungsi akibat deformitas b. Gangguan sirkulasi sistemik dan perifer b.d perdarahan c. Ansietas b.d kurang informasi mengenai kondisi penyakit d.

Gangguan rasa nyaman nyeri b.d proses kerusakan jaringan akibat diskontinuitas jaringan Seorang laki-laki mengalami kecelakaaan sehingga mengalami cedera patah tulang pada tangan sebelah kanan, dengan perdarahan hebat. Hasil pemeriksaan TTV : Td 90/70 mmHg, Nadi lemah 60 kali permenit, terdapat sianosis pada daerah perifer.

Gangguan rasa nyaman nyeri b.d proses kerusakan jaringan akibat diskontinuitas jaringan. Apakah Daignosa utama yang muncul pada kasus tersebut ?

a. Gangguan mobilisasi fisik b.d penurunan fungsi akibat deformitas b. Gangguan sirkulasi sistemik dan perifer b.d perdarahan c. Ansietas b.d kurang informasi mengenai kondisi penyakit d. Gangguan rasa nyaman nyeri b.d proses kerusakan jaringan akibat diskontinuitas jaringan Seorang laki-laki 50 tahun denagn diagnosis Congestive Heart Failure.

Setelah dilakukan transfusi darah sebanyak 2 labu selama kurang lebih 2 jam pasien mengeluh sesak dan nampak gelisah. Hasil auskultasi menunjukkan adanya crackles pada bagian basal paru kanan dan kiri. Apakah kondisi yang menyebabkan sesak pada pasien tsb?

a. Kekurangan oksigen b. Kelebihan cairan transfuse c. Kekurangan mobilisasi d. Kelebihan sel darah merah Seorang pasien mengeluh sesak disertai batuk episodic yang terjadi saat malam dan pagi hari saja. Hasil pengkajian riwayat kesehatan menunjukan adanya alergi yang diderita pasien terhadap cuaca dingin.

Hasil pengkajian fisik didapatkan data : RR 30 kali per menit, adanya retraksi otot asesoria dan pernafasan cuping hidung serta didapatkan bunyi wheezing. Apakah kondisi yang terjadi pada pasien lanugo pada bayi baru lahir berdasarkan tanda dan gejala yang terjadi ? a. PPOK b. Rhinitis 79. 80. 81. 82. 83. 84. c. Asma Bronkiale d. Efusi Pleura Seorang pasien mengeluh sakit kepala hebat, disertai pandangan mata yang buram sejak 1 minggu yang lalu.

Hasil pemeriksaan TIO didapatkan 26 mmHg. Hasil pemeriksaan funduskopi didapatkan sudut mata melebar. Apakah diagnose keperawatan utama pada kasus diatas ? a. Gangguan persepsi sensori b.d penurunan lapang pandang b. Risiko jatuh b.d penurunan fungsi penglihatan c. Gangguan rasa nyaman : nyeri b.d peningkatan TIO d. Risiko penyebaran infeksi Seorang pasien usia 50 tahun dirawat di RS, mengeluh sesak, batuk berdahak.

Hasil pemeriksaan fisik bibir dan kuku nampak sianosis, RR 32×/menit dan dangkal, menggunakan otot bantu pernafasan, nafas pursed lip breathing. Pasien didiagnosis PPOK. Apakah tindakan perawat untuk pemenuhan rasa nyaman ? a. Modifikasi lingkungan b.

Posisi semi/high fowler c. Distraksi d. Guided Imagery Seorang laki-laki usia 30 tahun dirawat ke Rumah Sakit dengan keluhan 1 mg yang lalu mengalami diare,Hasil pemeriksaan fisik: TD: 90/70 mmHg, denyut nadi : 100x/mnt,SH: 37,5 o C,frekuensi pernafasan 22x/mnt, KU lemah, nafsu makan menurun, muntah (+).Hasil laboratorium Hb 9 gr%, Leukosit 11.000/ul, Kreatinin 2 mg/ dl, BUN 30 mg dl.

Apakah Masalah keperawatan utama pada pasien diatas ? A. Hipertermi b/d proses infeksi B. Deficit volume cairan b/d diare C. Defisit perawatan diri bd kelemahan D. Perubahan nutrisi bd kehilangan nafsu makan E. Potensial Injuri bd penurunan produksi sel darah Merah Seorang wanita 20 Thn dirawat di RS. Hasil pemeriksaan fisik: kesadaran lanugo pada bayi baru lahir, keadaan umum lemah, kadang-kadang terjadi kejang, kaku kuduk (+), tanda brudzinsky (+), pernapasan cepat dan dangkal, suhu 380C, tekanan darah 90/60 mmHg, nadi : 88 x/m, klien diinfus 2A 15 tts/m, O2 : 4 ltr/m.

Keluarga mengatakan sebelumnya klien sering mengeluh sakit kepala, klien pernah menderita TBC paru namun pengobatanya tidak tuntas. Diagnosa medis : Meningitis. Apakah Masalah keperawatan utama pada pasien diatas ?

A. Hipertemi B. Resiko injury C. Deficit volume cairan D. Perubahan perfusi jaringan serebral E. Tidak efektifnya pola nafas Seorang wanita 60 tahun. Dirawat di RS. Keluhan utama nyeri jari kaki sebelah kiri ,skala nyeri 2(0-4) Pemeriksaan fisik, TD 100/80 mmhg, Nadi 74x /menit, frekuensi pernapasan 24x /menit, Suhu 37 oc. Terdapat lesi dijari kaki sinistra,tanda – tanda infeksi(+),hasil laboratorium : GDS : 407mg/dl,leukosit : 17.500/ul.diagnosa medis :DM tipe II dengan gangren.

Apakah intervensi keperawatan utama pasien di atas? A. Observasi skala nyeri B. Lakukan perawatan luka C. Ajarkan teknik relaksasi D. Atur posisi klien senyaman mungkin E. Ajarkan klien tentang latihan kaki Seorang laki-laki 21 tahun. Dirawat di RS, sudah 3 hari.

Keluhan utama sesak nafas,tidak nafsu makan. Pemeriksaan fisik, TD 180/130 mmhg, Nadi 65x /menit, Frekuensi Napas 35x /menit, Suhu 360C,konjungtiva 85.

86. 87. 88. pucat. Hasil laboratorium: HB: 7,7g/dl, Ureum: 268mg/dl,Creatinin: 11,08mg/dl. Diagnosa medis: CKD. Apakah diagnosa keperawatan utama pada pasien di atas?

A. Intolerasi Aktivitas berhubungan dengan oksigenasi jaringan yang tidak adekuat B. Gangguan perfusi jaringan berhubungan dengan suplai O2 kejaringan menurun C. Penurunan curah jantung berhubungan dengan beban jantung yang meningkat. D. ketidakseimbangan nutrisi kurang dari kebutuhan tubuh b/d intake yg tidak adekuat E. Ansietas b/d hospitalisasi Seorang perempuan 60 tahun.

Dirawat di RS. Keluhan utama Bab cair sehari lebih dari 4x,lemas, tidak nafsu makan. Hasil pemeriksaan fisik: TD : 100/60mmHg, Denyut nadi : 90x/mnt, Suhu : 37,8oC, RR 20x/mnt, turgor kulit jelek, membrane mukosa kering. Hasil Laboratorium : Kalium:3,01,Ht:34%,Leukosit : 25.000/ul. Klien mengatakan cemas dengan kondisinya. Apakah diagnosa keperawatan prioritas yang muncul pada pasien di atas? A. Hipertermia b/d proses infeksi B.

Cemas berhunbungan dengan prognosis penyakit C. Perubahan pola eliminasi BAB (diare) b/d inflamasi D. Kekurangan volume cairan dan elektrolit b/d output yang berlebih Seorang laki-laki 50 tahun. Dirawat di RS.

Keluhan utama ada benjolan dilipatan paha sebelah kiri, berdiameter 4cm,pasien, benjolan tambah membesar jika klien beraktivitas. Hasil pemeriksaan fisik: TD:100/60mmHg, Denyut nadi : 80x/mnt,SH: 36,o C,RR:20x/. klien dijadwalkan operasi, pasien tampak tegang menghadapi operasi, klien mengatakan takut dengan tindakan operasi yang akan dilaksanakan.

Lanugo pada bayi baru lahir Tindakan keperawatan prioritas untuk mengatasi cemas pada pasien di atas? A. Menganjurkan klien untuk rilek B. Mengobservasi tanda – tanda vital C. Mengkaji Tingkat kecemasan pasien D. Memberikan penjelasan mengenai prosedur operasi E. Menjawab semua pertanyaan yang ditanyakan pasien Seorang laki - laki 30 tahun.

Dirawat di RS. Keluhan utama sesak nafas dan batuk berdahak Hasil pemeriksaan fisik: TD:100/60mmHg, Denyut nadi : 70x/mnt, Suhu: 38,o C,RR:30x/mnt,bunyi nafas : Ronchi.

Hasil Laboratorium : Kalium:3,01,Ht:34%,Leukosit : 22.800/ul. Diagnosa medis; Bronchopneumonia. Apakah diagnosa keperawatan prioritas yang muncul pada pasien di atas? A. Hipertermi b/d proses inflamasi B. Intoleransi aktifitas b/d insufisiensi oksigen C. Cemas b/d kurangnya pengetahuan tentang penyakit D. Pola nafas tidak efektif b/d proses inflamasi dalam alveoli E. Bersihan jalan nafas tidak efektif b/d peningkatan produksi sputum Seorang laki - laki 20 tahun.di bawa ke IGD RS.

dengan keluhan panas sejak 5 hari yang lalu,pusing,mual,lemes.Hasil pemeriksaan fisik: TD:100/60mmHg, Denyut nadi : 886x/mnt,SH: 38,o C,RR:20x/mnt,akral hangat,BB:50kg TB: 165cm .Hasil Laboratorium : Widal (+),Leukosit : 11.800/ul.Diagnosa medis; Thypoid.

Apakah masalah keperawatan prioritas yang muncul pada pasien di atas? A. Nyeri B. Cemas C. Hipertermi Hirmi D. Intoleransi aktivitas E. Nutrisi kurang dari kebutuhan tubuh 89. Seorang perempuan 70 tahun. Dirawat di RS. Keluhan utama sering pusing dan tidak bisa tidur. Hasil pemeriksaan fisik: TD:180/100mmHg, Denyut nadi : 84x/mnt,SH: 36,o C,RR:24x/mnt :.Diagnosa medis; Hipertensi. Apakah topic penyuluhan prioritas pada pasien di atas? A. Penyakit hipertensi.

B. Cara penanggulangan penyakit hipertensi C. Intoleransi aktifitas berhubungan dengan insufisiensi oksigen untuk aktifitas sehari-hari D. Hipertermi b/d inflamasi E. Cemas berhunbungan dengan prognosis penyakit 90. Seorang laki - laki 40 tahun. Dirawat di RS. Keluhan utama perut kembung, nyeri sampai uluhati, mual dan muntah, skala nyeri 2 dri 5 Hasil pemeriksaan fisik: TD:110/70mmHg, Denyut nadi : 80x/mnt,SH: 36,o C,RR:20x/mnt,nyeri tekan + :.Diagnosa medis; gastritis.

Apakah intervensi keperawatan yang prioritas pada pasien di atas? A. Kaji status nutrisi B. Beri Kompres hangat C. Anjurkan untuk relaksasi D.

Ciptakan lingkungan yang tenang E. Anjurkan untuk makan sedikit – sedikit 91. Seorang perawat melakukan pengkajian pada pasien yang didiagnosis gagal ginjal kronis, dari pengkajian ditemukan adanya penumpukan krital urea pada kulit pasien. Apaistilah yang dapatmenggambarkankeadaanpenumpukankristal urea pada kulitpasiengagalginjalkronis?

A. Uraemicfetor B. Uraemic frost C. Uraemicodors D. Uraemic color E. Uraemic factor 92. Tuan A usia 60 tahun memiliki tekanan darah 180/110 mmHg, pasien diberikan obat penurun tekanan darah dari golongan Angiotension-converting enzyme lanugo pada bayi baru lahir inhibitors per oral.

Setelahminumobattersebutpasienmengeluhjantungberdetakkencang, sesaknapasdanbatuk. Apa yang harusperawatlakukan pada pasienini? A. Memberikanpenyuluhantentangefeksampingobat B. Menganjurkanuntukberhentiminumobat C. Memberikanpenyuluhan cara meminumobat D. Mengajurkanuntukmenggantijenisobat E. Melakukanmonitoringtekanandarah 93. Mahasiswa melakukan pengukuran tekanan darah, hasil pengukran tersebut diberikan kepada perawat yang sedang jaga, akan tetapi perawat mendapati mahasiswa salah menggunakan “cuff/manset” yang terlalu besar (lebar) untuk pasien tersebut.

Apa pengaruhnya terhadap hasil pengukuran darah tersebut? A. Hasil pengukuran tekanan darah valid B. Hasil pengukuran tekanan darah lebih tinggi dari yang seharusnya C. hasil pengukuran tekanan darah menjadi lebih rendah dari yang seharusnya D. hasil pengukuran tekanan darah menjadi lebih tinggi 20% dari yang seharusnya E. hasil pengukuran tekanan darah tidak ada bedanya mau pakai manset yang berbeda 94. Perawat akan melakukan pengkajian pada pasien laki-laki 48 tahun dan keluarganya untuk mengetahui kebutuhan belajar tentang miokardial infark yang dialaminya 2 hari yang lalu.

Pada saat melakukan pengkajian, perawat menemukan bahwa ayah pasien meninggal pada usia 52 tahun yang disebabkan karena miokardial 95. 96. 97. 98. 99. infark. Area pengkajian mana yang akan mempengaruhi perencanaan pendidikan kesehatan untuk pasien dan keluarganya? A. karakteristik belajar B. karakteristik fisik C. karakteristik psikologi D. karakteristik sosial E. karakteristik kultural Perawat di ruangan bedah melakukan pengkajian termasuk melakukan review terhadap hasil tes laboratorium pada pasien preoperative.Hasil test apa yang harus mejadi perhatian dokter bedah segera?

A. Serum K+ 3.8 mEq/L B. Hemoglobin 15 g/dL C. Glukosa darah 100 mg/dL D. White blood cell (WBC) 18,500/μL E.

Rh positif Pasien yang menghadapi pembedahan biasanya merasa asing terhadap ruangan bedah, untuk mengurangi perasaan asing tersebut maka ruangan bedah harus dimodifikasi sedemikaian rupa supaya tidak “menyeramkan”.

Tujuan memodifikasi ruangan bedah adalah untuk meningkatkan? A. keamanan kelistrikan B. asepsis (medis dan pembedahan) C. kenyamanan dan privasi pasien D. komunikasi diantara tim bedah E. kecepatan penyembuhan Perawat akan melakukan pengangkatan NGT pada pasien pasca bedah, pengakatan ini didarkan bahwa pasien sudah dapat makan sendiri, akan tetapi pada saat proses pengangkatan pasien mengalami epistaksis.

apa yang harus dilakukan perawat? A. menjepit hidung dengan ibu jari dan telunjuk B. memposisikan pasien pada satu sisi C. menghiperektensikan leher D. memberikan es dibelakang leher E. lapor ke dokter penanggung jawab Pasien Tuan B didiagnosis miokard infark, pada saat dokter memberikan suntikan nitrogliserin melalui IV, pasien masih mengeluh bahwa nyerinya tidak hilang. obat apa yang kemungkinan harus diberikan pada pasien tersebut?

A. Morphin sulfate IV B. Calcium channel blockers C. IV amiodarone lanugo pada bayi baru lahir D. Angiotensin-converting enzyme (ACE) inhibitors E. Nirogliserin oral Seorang pasien masuk ke rumah sakit akan melakukan pemeriksaan karena nyeri dada, dari hasil lanugo pada bayi baru lahir menunjukan tidak mengalami perubahan serum cardiac markers 4 jam setelah kejadian.

Apa tindakan diagnostic test non invasive yang dapat dipergunakan untuk membedakan type angina dari tipe nyeri dada tersebut? A. EKG 12 lead B. Exercise stress test C. Coronary angiogram D. Transesophageal echocardiogram E. Photorontgent 100. Pasien wanita usia 62 tahun mengalami prehypertensi (142/90 mmHg) dan merokok 1 bungkus per hari. Dia tidak memiliki gejala CAD tapi kadar LDL 154 mg/dL (3.98 mmol/L).

Berdasarkan nilai tersebut apa rencana tindakan pertama untuk pasien tersebut? A. diet dan terapi obat B. olahraga dengan bimbingan C. diet dan berhenti merokok D. obat dan berhenti merokok E. olahragatanpabimbingan 101. Klien Usia 45 tahun datang ke emergensi dengan keluhan sesak, nyeri dada,dada berdebar, cepat lelah, banyak berkeringat dan badan lemas. Dari hasil pengkajian didapatkan data TD : 150/90 mmHg, Nadi : 88 x/mnt, RR : 30 x/mnt, GD : 170 mg/dl dan pada palpasi leher terdapat hipertiroid, hasil T3 dan T4 meningkat.

Apa Prioritas masalah keperawatan yang muncul pada klien di atas? a. Gangguan oksigenasi b. Resiko kekurangan caiaran c. Gangguan rasa nyaman : nyeri dada d. Gangguan pemenuhan ADL 102. Seorang wanita, usia 18 tahun, status belum menikah, mengeluh pada payudaranya keluar ASI. Pada saat dikaji tidak sedang masa hamil ataupun menyusui. Intervensi apakah yang dapat diberikan pada klien tersebut? a. Anjurkan klien untuk mengeluarkan ASI terus menerus b.

Beritahu klien untuk tidak mengeluarkan ASI c. Beritahu klien untuk melakukan diet rendah susu d. Observasi siklus menstruasi 103. Seorang pria, umur 39 tahun lanugo pada bayi baru lahir dengan keluhan badan terasa lemas, sering kencing, sering haus dan lapar terus. Klien mengatakan keluhannya baru terasa kurang lebih satu minggu yang lalu. Dari pemeriksaan fisik didapatkan BB terjadi penurunan ± 7 Kg, terdapat luka gangren dengan diameter 5 cm, keadaan luka kotor. Klien mengeluh nyeri pada lukanya.

Keluarga tidak ada yang mengalami DM. Dari hasil pemeriksaan laboratorium didapatkan GDS : 215 mg/dl, Glukosuria (+). DM : Diabetes mellitus. Apa Kemungkinan penyebab DM pada kasus di atas?

a. Obesitas b. Pankreatitis c. Herediter d. Gagal ginjal 104. Seorang pria, umur 39 tahun datang dengan keluhan badan terasa lemas, sering kencing, sering haus dan lapar terus. Klien mengatakan keluhannya baru terasa kurang lebih satu minggu yang lalu. Dari pemeriksaan fisik didapatkan BB terjadi penurunan ± 7 Kg, terdapat luka gangren dengan diameter 5 cm, keadaan luka kotor. Klien mengeluh nyeri pada lukanya. Keluarga tidak ada yang mengalami DM. Dari hasil pemeriksaan laboratorium didapatkan GDS : 215 mg/dl, Glukosuria (+).

Apa yang bukan penyebab luka gangren pada kasus di atas? a. Viskositas darah meningkat b. Vaskularisasi perifer meningkat c. Penurunan sensitifitas d. Neuropathi 105. Seorang pria, umur 39 tahun datang dengan keluhan badan terasa lemas, sering kencing, sering haus dan lapar terus.

Klien mengatakan keluhannya baru terasa kurang lebih satu minggu yang lalu. Dari pemeriksaan fisik didapatkan BB terjadi penurunan ± 7 Kg, terdapat luka gangren dengan diameter 5 cm, keadaan luka kotor. Klien mengeluh nyeri pada lukanya. Keluarga tidak ada yang mengalami DM. Dari hasil pemeriksaan laboratorium didapatkan GDS : 215 mg/dl, Glukosuria (+).Apa masalah keperawatan utama pada klien di atas? a. Gangguan nutrisi : methabolisme sel b. Gangguan integritas kulit c. Resiko injury d.

Resiko ketidakseimbangan cairan 106. Seorang perempuan berusia 65 thn (Ny.T), dirawat di ruang penyakit dalam dengan Keluhan utama : Luka di kaki kanan akibat tersandung batu sejak 2 bulan. Pasien kemudian merasakan kakinya bengkak, teraba panas, berdarah (+), nanah (+).

Hasil Pemeriksaan fisik : Keadaan umum: tampak sakit sedang, kompos mentis, TD : 120/70 mmHg, FN : 90 x/mnt, FP : 20 x/mnt, Suhu : 37,5 C, Tinggi badan : 153 cm, Berat badan : 51 kg, Mata: konjungtiva pucat, Ekstremitas : edema -/- baal(+). Pasien baru mengetahui menderita DM. GDS : 423 mg/dL, Hb : 7,8 Mg/dL, Leukosit 11000. Apa Penyebab utama Luka (ulkus diabetik) yang terjadi pada Ny. T? a. Hiperglikemia b. Neuropati c. Infeksi d. Hb rendah 107. Seorang perempuan berusia 65 thn (Ny.T), dirawat di ruang penyakit dalam dengan Keluhan utama : Luka di kaki kanan akibat tersandung batu sejak 2 bulan.

Pasien kemudian merasakan kakinya bengkak, teraba panas, berdarah (+), nanah (+). Hasil Pemeriksaan fisik : Keadaan umum: tampak sakit sedang, kompos mentis, TD : 120/70 mmHg, FN : 90 x/mnt, FP : 20 x/mnt, Suhu : 37,5 C, Tinggi badan : 153 cm, Berat badan : 51 kg, Mata: konjungtiva pucat, Ekstremitas : edema -/- baal(+). Pasien baru mengetahui menderita DM. GDS : 423 mg/dL, Hb : 7,8 Mg/dL, Leukosit 11000.

Komplikasi apakah yang tidak terjadi pada Ny. T di atas? a. Ulkus pedis b. Retinopati c. Infeksi d. neuropati/kerusakan saraf 108. Seorang perempuan berusia 65 thn (Ny.T), dirawat di ruang penyakit dalam dengan Keluhan utama : Luka di kaki kanan akibat tersandung batu sejak 2 bulan.

Pasien kemudian merasakan kakinya bengkak, teraba panas, berdarah (+), nanah (+). Pasien baru mengetahui menderita DM. GDS : 423 mg/dL, Hb : 7,8 Mg/dL, Leukosit 11000. Berdasarkan hasil pemeriksaan penunjang, apa diagnosa utama yang munglin muncul pada Ny.

T tersebut? a. Resiko komplikasi b.d hiperglikemia b. Gangguan nutrisi kurang dari kebutuhan b.d hiperglikemia c. Resiko gangguan perfusi jaringan b.d anemia d. Resiko defisit volume cairan b.d peningkatan output 109. Seorang perempuan berusia 65 thn (Ny.T), dirawat di ruang penyakit dalam dengan Keluhan utama : Luka di kaki kanan akibat tersandung batu sejak 2 bulan. Pasien kemudian merasakan kakinya bengkak, teraba panas, berdarah (+), nanah (+). Hasil Pemeriksaan fisik : Keadaan umum: tampak sakit sedang, kompos mentis, TD : 120/70 mmHg, FN : 90 x/mnt, FP : 20 x/mnt, Suhu : 37,5 C, Tinggi badan : lanugo pada bayi baru lahir cm, Berat badan : 51 kg, Mata: konjungtiva pucat, Ekstremitas : edema -/- baal(+).

Pasien baru mengetahui menderita DM. GDS : 423 mg/dL, Hb : 7,8 Mg/dL, Leukosit 11000. Apakah Prioritas penatalaksanaan apa yang dilakukan pada Ny. T? a. Debridement luka b. Pemberian insulin c. Perawatan luka dengan teknik septik dan antiseptik d. Amputasi digiti I pedis dextra 110. Seorang Laki-laki berusia 47 tahun berobat ke poli penyakit dalam dengan keluhan sering buang air kecil, lanugo pada bayi baru lahir terus, sering haus dan dalam 4 bulan terakhir ini Berat Badannya turun dari 70 Kg menjadi 59 kg.

Tinggi Badan : 157 cm. Pemeriksaan Gula darah puasa: 302 mg/dl. Klien dianjurkan untuk melakukan perencanaan makan dan olahraga.

Berapakah Kebutuhan kalori basal klien tersebut ? a. 1359 kalori b. 1539 kalori c. 1282 kalori d. 1228 kalori 111. Seorang laki- laki berusia 46 tahun, dirawat di ruang penyakit dalam, dengan keluhan nyeri pada tulang belakang, terutama saat tidur.

Hasil pengkajian ditemukan adanya perubahan bentuk punggung menjadi agak bungkuk (kiposis) serta berkurangnya kepadatan tulang. Apakah jenis latihan yang lebih efektifuntuk mengatasi masalah pada kasus diatas? a. senam b. jogging c. meditasi d. berenang e. bersepeda 112. Seorang pasien berusia 35 tahun, dirawat di ruang unit luka bakar hari ke -2, dengan luka bakar karena tersiram air panas.

Luka bakar mengenai daerah dada, perut dan kedua paha, luka tampak kemerahan dan melepuh, pasien mengeluh panas dan perih dipermukaan kulitnya. Apakah tindakan yang tepat dilakukan pada kasus diatas?

a. Menghitung luas luka bakar pasien b. Memasang dower kateter secara cepat c. Memasang infus pada tangan yang sehat d. Menganjurkan pasien untuk immobilisasi e. Merawat luka bakar dengan metode lembab 113. Seorang laki-laki berusia 54 tahun dirawat diruang penyakit dalam. Hasil pengkajian didapatkan riwayat terkurung dalam lift di gedung yang terbakar, luka bakar didaerah wajah yaitu hidung dan mulut, kumis terbakar, suara parau dan nafas pasien tampak sesak.

Lanugo pada bayi baru lahir masalah keperawatan prioritas yang dialami pasien tersebut? a. Nyeri akut b. Resiko infeksi c.

Gangguan jalan nafas d. Resiko syok hipovolemik 114. Seorang laki – laki usia 38 tahun, dirawat di ruang bedah. Hasil pengkajian ditemukan fraktur tertutup 1/3 distal tibia sinistra, tampak kemerahan dan bengkak yang berlebihan pada kaki yang fraktur, ujung jari tampak pucat,pasien tidak merasakan sensasi pada ujung jarinya. Apakah pengkajian neurovaskular yang dilengkapi pada kasus diatas?

a. Tipe fraktur b. Skala nyeri c. Denyut nadi d. Derajat fraktur e. Kekuatan otot 115. Seorang perempuan berusia 38 tahun dirawat diruang penyakit dalam, dengan keluhan mual dan gatalgatal pada kulit. Hasil pengkajian ditemukan riwayat muntah darah, jaundice, kulit tampak kuning keabu-abuan, kering dan kusam, kadar ureum 7.1 dl/gr. Apakah fungsi hati yang terganggu pada kasus diatas? a. detoksifikasi b. emulsifikasi lemak c.

metabolisme protein d. menginaktifkan hormon e. sintesis faktor pembekuan 116. Seorang laki-laki berusia 42tahun dirawat diruang penyakit dalam, dengan keluhan mual dan muntah darah. Hasil pengkajian ditemukan riwayat muntah darah 3 bulan yang lalu, jaundice, kulit tampak kuning, asites dan pasien tampak pucat.

Bagaimanakah patofisiologi terjadinya muntah darah pada kasus diatas? a. Pecahnya pembuluh darah vena esophagus b. Tekanan yang meningkat pada vena hepatica c.

Kolateral dari aliran ke hepar yang tersumbat d. Pengikisan dinding lambung oleh asam lambung e. Peningkatan tekanan hidrostatik di pembuluh darah 117. Seorang perempuan berusia 35 tahun dirawat diruang penyakit dalam, dengan keluhan perut bengkak dan tidak bisa buang angin, sejak 2 hari yang lalu. Hasil pengkajian ditemukan riwayat diurut pada bagian perut, distensi abdomen, bising lanugo pada bayi baru lahir 3 x/mnt, tekanan darah 110/70 mmHg, frekuensi nadi 84x/mnt, frekuensi napas 26 x/mnt, suhu 37.6o C.

Apakah tindakan yang tepat untuk mengurangi keluhan pasien pada kasus diatas? a. Pasien dipuasakan b. Pasang Nasogastrik tube c. Berikan posisi semi fowler d. Lakukan pemasangan infus e. Rencanakan untuk dioperasi 118. Seorang perempuan berusia 37 tahun, datang ke lanugo pada bayi baru lahir dengan keluhan nyeri pada punggung saat berdiri ataupun duduk.

Hasil pengkajian punggung tidak bisa tegak, selalu miring kekanan dan pinggul tidak sejajar. Apakah kelainan tulang belakang yang dialami oleh pasien tersebut?

a. kiposis b. skoliosis c. lordosis d. sway back e. hipolordosis 119. Seorang laki – laki berusia 45 tahundirawat di ruang penyakit dalam dengan keluhan sesak, mual dan tidak bisa tidur.

Hasil pengkajian didapatkan riwayat sirosis hepatis, asitesdengan lingkaran perut 108 cm, pasien tampak kurus dan lemah. Hasil pemeriksaan Tekanan darah 100/70 mmHg, frekuensi nadi 88x/mnt, frekuensi napas 28xmnt, S 37 o C.

Apakah masalah keperawatan yang tepat pada pasien tersebut? a. Intoleransi aktivitas b. Gangguan pola nafas c. Gangguan istirahat tidur d. Gangguan volume cairan : berlebih e. Ketidakseimbangan nutrisi : kurang dari kebutuhan 120. Seorang perawat sedang melakukan pengkajian reflex tendon, dengan cara menggoreskan ujung reflek hammer yang runcing pada telapak kaki pasien, sehingga muncul gerakan pada ujung jari pasien.

Apakah nama pengkajian yang dilakukan oleh perawat tersebut? a. Openheim b. c. d. e. Babinski Chaddok Gordon Archiles 121. Seorang perempuan 50 tahun mengalami penurunan kesadaran secara mendadak saat sedang bekerja di kantor, dirawat di Unit Stroke Rumah Sakit X. Hasil pemeriksaan di dapat kesadaran soporokoma, tekanan darah 200/140mmHg, Nadi 110x/menit, pernapasan 32x/menit. Apakah masalah keperawatan utama pada kasus di atas ?

A. Penurunan curah jantung B. Bersihan jalan napas C. Gangguan perfusi jaringan serebral D. Gangguan pertukaran gas E. Gangguan pola napas 122. Seorang laki-laki 52 tahun di rawat di Ruang Penyakit Dalam dengan keluhan.

tidur terganggu karena sesak napas, lemah, Tekanan darah 160 / 90 mmHg, Nadi 120 x /mnt, pernafasan 28 x / menit, kedua ekstremitas bawah edema +3, terdapat asites dan produksi urin 350 cc/24 jam. Apakah masalah keperawatan utama pada kasus di atas ? a. Ganguan pemenuhan kebutuhan istirahat tidur b. Intoleransi aktifitas c. Bersihan jalan nafas tidak efektif.

d. Kelebihan volume cairan.* e. Penurunan curah jantung 123. Seorang perempuan 28 tahun dibawa ke rumah sakit akibat kecelakaan lalu lintas Hasil pemeriksaan didapat klien mengalami perdarahan akibat fraktur terbuka femur, tekanan darah 90/50 mmHg, nadi 120x/menit, pernapasan 32 x/menit. Hb 8 g/dl. Jenis transfusi darah yang harus diberikan pada pasien tersebut adalah? APakah jenis transfusi darah yang harus diberikan pada pasien tersebut adalah…. A. Darah lengkap (whole blood)* b. Konsentrat Sel darah merah (Packed Red Blood Cells) c.

Konsentrat trombosit d. Plasma segar dibekukan ( fresh frozen plasma ) e. Konsentrat sel darah putih 124. Seorang perempuan dirawat di rumah sakit dengan keluhan sesak napas, lemah, letih dan lesu, Hasil pemeriksaan di dapat klien masih mengeluh sesak napas, konjungtiva pucat, tekanan darah 120/70 mmHg, nadi 110x/menit, pernapasan 30x/menit. APakah jenis transfuse yang sesuai untuk pasien ? a. Darah lengkap (whole blood) b.

Konsentrat Sel darah merah (Packed Red Blood Cells) c. Konsentrat trombosit d. Plasma segar dibekukan ( fresh frozen plasma ) e. Konsentrat sel darah putih 125. Seorang laki-laki 45 tahun di rawat di RS X dengan keluhan sesak napas, lemah dan bengkak pada kedua kaki. Hasil pemeriksaan fisik didapat edema tungkai derajat 3, distensi vena jugularis, asites dan ronkhi pada kedua lapang paru.

Tanda-tanda vital tekanan darah 160/95 mmHg, Nadi 90x/menit, pernapasan 35x/menit, Pasien Didiagnosa Gagal Jantung Kongestif dan mendapat terapi digitalis dan diuretik. Apakah pengkajian yang paling penting dilakukan sebelum pemberian obat digitalis ? a. Tingkat kesadaran b. Tanda-tanda vital terutama denyut nadi* c. d. e. Status cairan Produlksi urin Kadar glukosa darah 126.

Perawat memeriksa klien yang tergelincir dan jatuh saat naik tangga dan sekarang pergelangan kakinya bengkak dan nyeri saat digerakkan. Pada saat klien sedang menunggu untuk difoto pergelangan tangan, tindakan perawatan mana yang membantu mengurangi pembengkakan jaringan lunak?

a. Letakkan kompres panas pada pergelangan kaki b. Letakkan es ke pergelangan kaki c. Gerakkan kaki klien d. Istirahat kali klien 127. Sebelum klien pulang dari UGD, perawat mengajar cara merawat pergelangan kaki yang keseleo di rumah.

Perawat memberi penyuluhan perlunya menjaga perban. Kapan klien harus membalut ulang pergelangan kaki yang keseleo dengan perban elastis? a. Pada saat jari-jari kaki tampak merah muda b. Pada saat pergelangan kaki terasa nyeri c. Pada saat jari-jari kaki tampak bengkak d. Pada saat persendian terasa kaku 128. Klien kembali dari kamar operasi dengan tungkai digips, dan perawat membantu klien ketempat tidur.

Mana dari antara yang berikut ini diidentifikasi perawat sebagai prioritas tertinggi saat mencatat status sirkulasi pasca bedah ekstremitas yang baru digips?

a. Fungsi neurovascular memadai b. Rasa nyeri berkurang saat bergerak c. Tanda-tanda vital pada batas normal d. Tidak tampak cairan pada gips 129. Perawat curiga bahwa korban juga mungkin mengalami patah tulang belakang. Posisi mana yang paling sesuai pada saat mengangkat klien yang kemungkinan mengalami patah tulang belakang?

a. Tidur pada sisinya b. Telungkup c. Telentang d. Semi-fowler 130. Setelah pembedahan klien diajar untuk memakai stoking anti emboli setinggi paha. Kalimat mana dari perawat memberi keterangan terbaik tentang tujuan memakai stoking anti a. Stoking anti emboli mencegah darah menumpuk di tungkai b. Stoking anti emboli mengurangi aliran darah ke ekstremitas c.

Stoking anti emboli menjaga agar tekanan darah lebih rendah di tungkai d. Stoking anti emboli menjaga agar pembuluh darah menciut 131. Gips lengan akan dipasang pada klien dewasa dengan fraktur ganda pada radius. Setelah gips lengan dipasang, observasi keperawatan mana yang terbaik menandakan bahwa klien mungkin mengalami sindrom kompartmen?

a. Klien merasakan nyeri yang parah b. Tangan klien tampak merah c. Jari-jari kram d. Denyut nadi radial melonjak 132. Gips lengan akan dipasang pada klien dewasa dengan fraktur ganda pada radius.

Teknik mana yang terbaik yang dapat digunakan perawat untuk mengeringkan gips lengan yang basah ? a. Biarkan lengan yang digips itu terbuka b. c. d. Letakkan selimut panas pada gips Tiupkan panas pada gips pakai pengering rambut Letakkan lampu panas langsung diatas gips 133. Sebelum pembedahan fraktur pinggul, dipasang traksi Buck pada klien lansia. Teknik keperawatan mana yang terbaik saat merencanakan memasang traksi Buck? a. Balikkan klien dari satu sisi tempat tidur ke yang lainnya b.

Pakai seprai dari kaki tempat tidur sampai ke ujung atas c. Biarkan seprai bawah terpasang sampai pasca bedah d. Angkat klien dari tempat tidur dengan mekanisme mengangkat 134. Sebelum pembedahan fraktur pinggul, dipasang traksi Buck pada klien lansia. Teknik strategi mana yang terbaik untuk mengkaji sirkulasi tungkai yang dipasang traksi Buck? a. Amati apakah klien dapat menggoyangkan atau menggerakkan jari-jari kaki b. Raba pulsasi arteri dorsalis pedis c. Ukur tekanan darah klien dengan memakai manset pada di atas tungkai yang sakit d.

Tentukan apakah klien dapat merasa sensasi tajam dan tumpul 135. Dokter menganjurkan menaruh panas pada kedua tangan klien untuk mengurangi nyeri. Metode pemakaian panas mana yang terbaik perawat lakukan untuk klien tersebut? a. Pakai lilin panas b. Kompres hangat lembab c. Kompres panas listrik d.

Lampu panas infrared 136. Seorang bayi perempuan berusia 4 hari dengan berat badan 2700 gr datang ke UGD bersama ibunya dengan keluhan sesak nafas dan terlihat cianosis pada bibir dan telapak kakinya. Dari hasil pemeriksaan fisik didapatkan suhu tubuh 39,2 C, Frekuensi nafas 130x/mt, frekuensi nadi 87x/mt, terdapat retraksi dada dan pernafasan cuping hidung serta anak terlihat letargi. Ibu klien juga mengatakan bayi malas minum.

Manakah masalah keperawatan yang paling prioritas pada kasus diatas? a. Gangguan Thermoregulasi suhu tubuh b. Gangguan Pertukaran gas c. Gangguan Nutrisi kurang dari kebutuhan tubuh d. Gangguan perfusi jaringan serebral 137. Seorang perempuan berusia 28 tahun, baru melahirkan 24 jam yang lalu. Dari hasil pengkajian ditemukan data bahwa pasien mengeluh nyeri daerah perineum dan menahan BAK sejak melahirkan sehingga kandung kemih penuh.

Intervensi apakah yang dapat diberikan ? a. Membantu ibu ke kamar mandi, beri kesempatan ibu mendengar air mengalir b. Lakukan distraksi dan relaksasi untuk mengurangi nyeri c. Lakukan pemasangan chateter agar ibu segera BAK d. Berikan obat diuretik 2 x sehari e. Berikan analgetik dan antibiotik 138. Dokter merencanakan melakukan lumbal pungsi (spinal tap) untuk menentukan diagnosis meningitis.

Intervensi keperawatan manakah yang paling cocok dilakukan setelah lumbal pungsi a. Klien tidur posisi samping b. Bantu klien pada posisi duduk c. Jangan beri makan atau minum selama 1 jam d. Biarkan klien telentang tanpa bantal untuk beberapa jam 139. Intervensi keperawatan klien penderita encephalitis menunjukkan bahwa perawat harus memeriksa neurologi setiap 2 jam.

Jika klien tidak bereaksi kecuali dengan rangsangan nyeri, hasil pengkajian mana menunjukkan bahwa keadaan klien membaik? a. Pupil tidak bergerak jika dirangsang dengan cahaya b.

Pupil tidak seimbang saat dirangsang dengan cahaya c. Angka Glasgow Coma Scale 12 d. Pipi yang lanugo pada bayi baru lahir dengan saputangan menyebabkan klien menelan 140. Dokter mengorder selimut dingin untuk mengurangi demam klien meningitis. Pada saat melaksanakan order medis ini, tindakan keperawatan mana yang cocok?

a. Tutupi klien dengan selimut dingin b. Bungkus selimut dingin dengan kain pembungkus ringan c. Tambahkan cairan saline ke wadah cairan d.

Ganti es yang sudah meleleh secara berkala 141. Seorang perempuanberusia 28 tahun G2P2A0, pasca operasi Sectio Caesaria mendapatkan spinal anestesi. Dari hasil pemeriksaan di dapatkan Keadaan umum pasien lemah, TD : 130/80 mmHg, frekuensi Nadi : 78x/menit, frekuensi Respirasi : 18x/menit dan Suhu : 370C.

Setelah 2 jam di ruang recovery, pasiendi pindahkan ke ruang perawatan. Tindakan Perawatan apa yang tepat pasca operasi pertama tiba di ruang rawat? a. Pemantauan TTV tiap 1 jam b. Palpasi Fundus Uteri setiap 1 jam c. Mengusap Fundus uteri agar tetap nyaman tiap 1 jam d.

Istirahatkan pasien dengan tidur terlentang selama 24 jam e. Pemeriksaan perdarahan balutan luka dan perineal tiap 1 jam 142. Seorang perempuan berusia 32 tahun sedang hamil, datang ke ruang bersalinbersama suaminya mengeluh mules sejak 4 jam yg lalu, keluar cairan dari vagina yang berwarna coklat, setelah di periksa dalam (PD) cervik masih tebal, dan pembukaan baru satu jari longgar. Berada pada kala berapa proses persalinan pada kasus di atas ?

a. I fase Laten b. I fase Aktif c. II d. III e. IV 143. Seorang perawat A. 22 tahun yang baru bekerja di puskesmas 6 bulan yang lalu, sedang mengikuti perawat seniornya menolong persalinan, ketika kepala sudah kelihatanakan dimulainya fase ekstensi kepala janin,perawat senior meminta perawat A untuk membantu menolong persalinan dengan melakukan penahanan pada daerah symphisispubis untuk mencegah rupture.

Perawat A kelihatan ragu dan tidak kelihatan percaya diri, sehingga perawat senior mengambil alih kembali “Sambil berkata biar sama saya kembali”. Bagaimana tindakan perawat agar keterampilan dalam pertolongan persalinan meningkat sesuai kasus di atas ? a. Sering mengikuti proses persalinan b. Menjadi asisten dalam menolong persalinan lanugo pada bayi baru lahir.

Mengikuti pelatihan asuhan persalinan normal d. Melakukan pertolongan proses persalinan sesering mungkin e. Sering bertanya dan berdiskusi dengan perawat senior dalam menolong persalinan 144.

Seorang perempuan berusia 19 tahun, belum menikah datang ke Poliklinik Kebidanan setelah melakukan hubungan badan dengan pacarnya. Siklus menstruasi teratur 28 hari, mens terakhir 13 hari yang lalu, dia bertanya bagaimana cara mencegah terjadinya kehamilan. Pendidikan kesehatan apa yang perlu disampaikan? a. Gunakan Kondom b. Secepatnya dilakukan kuretasi c. Gunakan pil KB sebelum berhubungan d. Memastikan kembali bahwa dia tidak hamil e. Tidak melakukan hubungan badan sebelum menikah 145.

Perawat bertanya apakah klien sedang mempraktikkan pemeriksaan payudara sendiri (BSE), lalu dia menggunakan kesempatan menunjukkan tehnik yang benar. Klien katakana bahwa dia memeriksa payudaranya waktu mandi atau berbaring.

Dari posisi manakah perawat ajnurkan klien harus juga memeriksa payudara? a. Tekukkan pinggang b. Berdiri di depan cermin c. Lengkungkan punggung d. Bersandar dari samping ke samping 146. Seorang wanita berusia 40 tahun datang ke RS dengan keluhan sesak dan demam Sejak semalam sebelumnya, setelah dikaji tanda – tanda vitalnya : Frekwensi Nadi 85x/menit, frekwensi pernafasan 28x/menit, TD 100/80mmHg, Suhu 37,6 derajat celcius,badan pasien berkeringat.

Tindakan apa yang paling tepat dilakukan pada pasien? a. Kolaborasi infus b. Kolaborasi O2 c. Melakukan kompres d. Postural drainage e. Memposisikan semi fowler 145. Seorang laki-laki usia 45 tahun di ruang perawatan dengan keluhan batuk berdahak,setelah dikaji diperoleh data Nn A mengeluh sesak, mual, dan tidak nafsu makan, tanda-tanda vitalnya TD 100/80mmHg, frekwensi pernafasan 28 x/menit, frekwensi nadi 90 x/ menit, suhu 37.6 derajat celcius, suara nafas ronchi. Masalah keperawatan yang menjadi prioritas dari kasus di atas ?

a. Tidak efektifnya pola nafas b. Tidak efektifnya bersihan jalan nafas c. Gangguan pertukaran gas d.

Nutrisi kurang dari kebutuhan e. Hipertermi 146. Seorang laki-laki usia 46 tahun dirawat di RS dengan keluhan sesak dan batuk produktif, batuk dirasakan > 2 mg. sering berkeringat di malam hari. Mempunyai riwayat merokok. Dari hasil pemeriksaan didapat : suhu malam hari 40 derajat celcius, TD 90/60MmHg,frekwensi nafas 23X/menit, suara nafas ronchi. Data apa lagi yang harus di kaji pada pasien?

a. Periksa Tanda-tanda Vital b. kaji tanda dan gejala lainnya c. hasil pemeriksaan lab d. Pemeriksaan Radiologi (Thorax Foto) e.

Periksa kultur sputumnya :BTA 147. Seorang Anak Laki-laki Usia 7 tahun Datang ke RS diantar oleh orang tuanya dengan keluhan batuk produktif, dan demam. Menurut ibu pasien pada awalnya pasien mengalami gejala seperti influenza biasa, tetapi tak kunjung sembuh malah memburuk, hasil pemeriksaan diperoleh data batuk berdahakfrekwensi pernafasan 26 x/menit, lanugo pada bayi baru lahir nadi 80x/menit, suhu 40 derajat celcius.

Yang termasuk Data Objektif kasus diatas? a. Batukmenurut ibu pasien mengalami demam b. Frekwensi pernafasan 26x/menit, suhu 40 derajat celcius c. Keluhan batuk, frekwensi pernafasan 26x/menit d. Keluhan demam, frekwensi nadi 80x/menit e. Ibu pasien mengeluh anaknya demam dan batuk 148. Seorang perempuan usia 35 tahun dirawat dengan keluhan sesak nafas.

Dari hasil pengkajian di dapatkan data dada terasa berattekanan darah 110/80 mmHg, Nadi 80 x/menit, pernafasan 28 x/menit. Pasien sudah di implementasi dengan posisi tidur semi fowler, setelah di evaluasi sesaknya belum berkurang. Apakah tindakan selanjutnya yang harus dilakukan ? a. Mengkaji status respirasi b. Kolaborasi pemberian O2 c. Mengajarkan batuk efektif d.

Kolaborasi pemberian bronkodilator e. Menganjurkan untuk minum air hangat Soal Keperawatan Keluarga 1. Seorang perawat keluarga telah memberikan tindakan berupa pendidikan kesehatan tentang hipertensi, cara melakukan pemeriksaan mandiri untuk mendeteksi hipertensi, mengajarkan cara memasak menu hipertensi dan cara mengontrol emosi Manakah yang merupakan evaluasi struktur yang dilakukan perawat?

(Evaluasi kualitatif ada 3; evaluasi struktur, proses, dan hasil) a. Strategi yang dilakukan keluarga dalam mengontrol emosi b. Bahan dan tenaga yang diperlukan untuk pendidikan hipertensi c. Peningkatan pengetahuan keluarga terhadap penyakit hipertensi d. Penurunan tekanan darah pada keluarga yang menderita hipertensi e. Siapkan menu hipertensi dan cara mendeteksi hipertensi 2. Di sebuah keluarga Bp.N terdapat 4 orang anak perempuan dan seorang istri Ny. J, namun keempat anaknya telah menikah dan terpisah rumahnya dengan Bp.N.

Kondisi keluarga Bp. N dalam kondisi stroke dan mengalami kesulitan berjalan & berbicara ,sehingga dengan kondisi tersebut Bp.N tidak dapat bekerja lagi. Bp.N pernah dibawa ke puskesmas dan menjalani pengobatan. Namun setelah obatnya habistidak pernah dibawa lagi ke puskesmas. Ny.J tidak mengetahui apa yang harus dilakukan untuk memulihkan Bp.N ,sehingga Ny.J membiarkan Bp.N dalam kondisi kesulitan berbicara dan berjalan. Fungsi kesehatan keluarga mana yang mengalami gangguan pada keluarga Bp.

N a. Kemampuan Keluarga dalam merawat Bp.N b. Kemampuan Keluarga dalam mengenal masalah c. Kemampuan Keluarga dalam mengambil keputusan d. Kemampuan keluarga dalam Memodifikasi lingkungan e. Kemampuan keluarga dalam memanfaatkan pelayanan kesehatan 3. Satu keluarga terdiri atas seorang bapak tinggal dengan dua orang anak, masing masing berusia tujuh dan tiga tahun. Istri bapak tersebut meninggal satu tahun yang lalu karena menderita TB Paru. Apakah tahapan perkembangan keluarga tersebut diatas ?

A. Keluarga dengan anak todler B. Keluarga dengan anak balita C. Keluarga dengan anak sekolah D. Keluarga dengan anak remaja E.

Keluarga dengan anak usia dewasa 4. Ketika sedang melakukan kunjungan rumah dan mewawancarai seorang pasien, ditemukan data pasien sering mengeluh berkeringat pada malam hari, disertai batuk darah. Kemudian besok paginya keluarga membawanya ke Rumah Sakit.setelah dilakukan pemeriksaan lebih lanjut sputum BTA (+) dan rontgen thorak menunjukan terdapat bercak.

Kemudian pasien didiagnosis menderita penyakit TBC dan mendapat terapi Rifampisin, Etambutol dan Lanugo pada bayi baru lahir selama enam bulan Apa upaya preventif sekunder yang perlu dilakukan perawat pada saat kunjungan terhadap keluarga pasien tersebut supaya tidak terjadi komplikasi lebih lanjut ? a. Menjelaskan bagaimana cara minum obat dan lamanya pengobatan b. Memberikan penyuluhan tentang aktivitas yang dapat dilakukan c. Menganjurkan untuk mengkomunikasikan dengan suami d.

Menyarankan untuk menggunakan oksigen jika sesak e. Mnganjurkan untuk banyak minum jika batuk 5. Indonesia saat ini menjadi salah satu negara dengan kasus penderita TBC lima terbesar di dunia. Berbagai upaya telah dilakukan salah satunya dengan lanugo pada bayi baru lahir penangan pasien dengan metode DOT. Sebagai perawat keluarga, apa tindakan preventif primer yang tepat dilakukan a. Melakukan rehabilitasi pasien-pasien yang sedang lanugo pada bayi baru lahir TBC b. Memberukan penyuluhan pentingnya imunisasi pada balita sehat di posyandu c.

Melakukan sekrining pada pasien TBC diwilayah kerja puskesmas d. Melakukan Pengobatan lanugo pada bayi baru lahir TBC e. Merujuk pasien TBc dengan komplikasi 6. Seorang perawat bekerja disalah satu puskesmas dan mengelola salah satu keluarga yang menderita penyakit hipertensi di wilayah binaannya. Apakah peran educator yang semestinya dilakukan oleh perawat tersebut dalam menjalankan tugas terhadap keluarga binaannya tersebut?

a. Perawat memeriksa tekanan darah setiap kali kunungan b. Perawat memberikan obat yang secara rutin pada keluarga binaan. c. Perawat memberikan rujukan untuk berlobat lebih lanjut pada keluarga kerumah sakit d. Perawat mendiskusikan kasus keluarganya dengan ahli gizi e. Perawat melakukan penyuluhan tentang tenyakit hipertensi pada keluarga binaannya 7.

Seorang keluarga klien datang ke puskesmas, kemudian menginformasikan bahwa salah satu anggota keluarganya menderita kejang-kejang, setelah mengalami buang air besar yang sering bahkan disertai muntah. Kemudian perawat tersebut melakukan home visite dan memeriksanya. Kesimpulan muncul masalah keperawatan gangguan keseimbangan cairan elektrolit.

intervensi yang tepat terhadap masalah keperawatan tersebut sebelum dirujuk ke rumah sakit sebaiknya apa ? a. Memberikan obat anti diare b. Menelopon dokter c. Memberikan cairan melalui parenteral RL d. Merujuk pasien ke rumah sakit e. Memberikan oralit 8.

Ketika sedang melakukan kunjungan rumah kesalah satu keluarga binaan, perawat menemukan pasien dewasa dengan tanda dan gejala, tekanan darah 160/100 mmhg, nadi 90/ menit, kesadaran compos mentis berbaring di tempat tidur karena pasien mengeluh sakit kepala.

Menurut keluarga sudah seminggu mengalami keluhan sakit kepala. Kemudian perawat tersebut merujuk pasien untuk dibawa ke puskesmas atau dokter terdekat. Peran apa yang dilakukan oleh perawat keluarga tersebut ? a. Peran asuhan keperawatan b. Peran Advocat c. Peran lanugo pada bayi baru lahir d. Peran konselor e. Peran edukator 9. Berdasarkan hasil kunjungan pada beberapa keluarga, seorang perawat menemukan satu keluarga yang berbeda dengan keluarga yang lain yang pernah dikunjunginya, sehingga menjadikan suatu perhatian dan dijadikan keluarga binaan, karena salah satu anggota keluarganya ada yang menderita penyakit stroke.

Berdasarkan data yang diperoleh pasien tersebut terpasang NGT sudah tujuh hari., bahkan sampai tercium bau tidak sedap pada selang NGT tersebut. Tindakan apa yang semestinya dilakukan oleh seorang perawat tersebut ?

a. Melakukan informed consent lalu mengganti NGT b. Melakukan perawatan gigi dan mulut c. Melakukan bilas lambung d. Memberikan penyuluhan bagaimana cara perawatan NGT e.

Melakukan tindakan kolaborasi 10. Setelah melakukan evaluasi kunjungan rumah yang ke tiga kali oleh perawat puskesmas, pada salah satu keluarga yang menderita penyakit Stroke. Pasien lanugo pada bayi baru lahir kemajuan yang sangat baik, pasien dapat makan sendiri padahal tadinya dibantu oleh putra-putinya.

Pasien pun mengatakan terimakasih atas bantuannya telah memberikan perawatan sehingga dapat melakukan kembali aktivitas sendiri Upaya preventif apakah yang telah dilakukan perawat terhadap pasien stroke tersebut? a. Preventif primer b. Preventif sekunder c. Preventif tersier d. Rehabilitasi e. Promotif 11. Ners K. sedang melakukan kunjungan rumah pertama kalinya ke suatu keluarga. Pada saat kunjungan, tampak seluruh anggota keluarga sedang berkumpul. Apakah sebaiknya yang dilakukan perawat ketika melakukan kontrak awal?

a. Memperkenalkan diri, menanyakan nama anggota keluarga dan menjelaskan tujuan kunjungan b. Memperkenalkan diri dan melakukan orientasi terhadap lingkungan rumah keluarga. c. Saling berkenalan dengan anggota keluarga kemudian membuat perjanjian untuk pertemuan berikutnya. d. Meminta persetujuan kepada kepala keluarga agar perawat boleh ikut berkumpul dengan anggota keluarga.

e. Menghubungi kepala keluarga bahwa dikeluarganya akan diadakan pertemuan dengan tim kesehatan. 12. Seorang Ners akan melakukan kunjungan rumah ke salah satu keluarga, pada saat berkunjung ternyata kepala keluarga menyatakan menolak untuk ditemui dengan berbagai alasan.

Apakah yang sebaiknya dilakukan Ners tersebut? a. b. c. d. e. Langsung pergi meninggalkan rumah keluarga tersebut Membuat kontrak waktu dengan keluarga untuk kunjungan berikutnya Mengatakan pada keluarga bahwa perawat hanya sekedar ingin mampir Memberitahu keluarga behwa perawat akan kembali lagi dalam waktu yang belum ditentukan. Menginformasikan kondisi tersebut ke atasan atau kepala Puskesmas setempat 13.

Rumah Tn. D dihuni oleh istri dan kedua anaknya, ditambah mertua Tn.D yang tinggal menumpang karena sudah lansia Termasuk Tipe keluarga apakah Tn.D? a. Nuclear family b. Extended family c. Dyadic family d. Single parent family e. Semua jawaban benar 14. Keluraga Tn B. Memiliki satu anak berusia 3 bulan, istrinya melahirkan ditolong oleh paraji, anaknya belum pernah dibawa ke posyandu dan belum mendapatkan imunisasi Apakah masalah utama bagi keluarga Tn.B a.

Bayi belum mendapat imunisasi b. Pertolangan persalinan yang salah c. Kurangnya perawatan maternitas yang berpusat pada keluarga d. Keluarga berencana e. Peningkatan kesehatan 15. Sepasang suami istri baru menikah setahun dan belum memiliki anak. Mereka mulai merasakan adanya konflik karena perbedaan pendapat dan masalah dalam penyesuaian perkawinan. Apakah tugas perkembangan keluarga yang belum terpenuhi?

a. Merencanakan sebuah keluarga b. Memperluas hubungan dengan keluarga besar c. Membentuk keluarga muda sebagai suatu unit yang stabil d. Berhubungan secara harmonis dengan jaringan kekerabatan e. Membentuk pernikahan yang memuaskan bagi kedua belah pihak 16. Seorang laki-laki berusia 40 tahun tinggal bersama istri dan 2 orang anaknya.

Istrinya mengatakan bahwa suaminya sering marah-marah jika ada masalah.Anaknya juga sering menjadi sasaran kemarahannya. Apakah diagnosa keperawatan yang utama? a. Konflik peran orang tua b.

Perubahan dalam proses keluarga c. Risiko terhadap tindakan kekerasan d. Koping keluarga tidak efektif, menurun e. Koping keluarga tidak efektif, ketidakmampuan 17. Keluarga Tn. A usia 50 tahun tinggal serumah dengan isterinya Ny. Y usia 45 tahun dan anaknya Tn.

B usia 25 tahun, An T berusia 25 tahun dan menantunya Ny. R 23 tahun. Apakah tipe keluarnya Tn. A.? a. Nuclear family b. Extended family c. Dyad family d. Single parent family e. Cohabiting family 18. Hasil pengkajian didapatkan keluarga Tn.

R. Berusia 60 tahun, isterinya Ny. K 55 tahun, mempunyai anak 3 orang, anak pertama berusia 17 tahun, anak kedua berusia 14 tahun dan anak ketoga berusia 10 tahun. Apakah tahap perkembangan keluarga Tn. R.? A. Keluarga anak sekolah B. Keluarga anak remaja C. Keluarga usia dewasa D.

Keluarga usia pertengahan E. Keluarga usia lansia 19. Tn. X tinggal berdua dengan istrinya. Hasil pemeriksaan fisik anggota keluarga Tn. X, istri Tn X terdapat ulkus diabetic, mengeluh kram pada ekstremitas, sering BAK, lemah, letih, kulit tampak bersisik.

Tn X mengeluh nyeri pada lutut, penglihatan kabur Apakah sifat masalah keperawatan pada Tn. X.? A. Sejahtera B. Ancaman C. Aktual D. Krisis E. Potensial 20. Sepasang suami istri tinggal bersama 2 anaknya.

Anak pertamanya berjenis kelamin laki laki berusia 5 tahun dan anak keduanya berjenis kelamin perempuan berusia 2 tahun, keduaanak tersebut sangat sehat dan pintar Apakah tahap perkembangan keluarga tersebut? a. Keluarga baru menikah b. Keluarga usia pertengahan c. Keluarga dengan anak remaja d. Keluarga dengan anak preschool e. Keluarga dalam menikmati masa tua 21. Seorang laki laki 25 tahun mempunyai riwayat penyakit Epilepsi. Ketikapenyakitnya kambuh ibu dan keluarganya sudah terbiasa sehingga hanya membawa klien ke tempat tidur dan membiarkannya sampai kejang kejangnya berhenti dengan sendirinya dan langsung diberi obat sehingga klien kembali beraktivitas seperti biasanya.

Apakah prioritas utama diagnosis keperawatan yang muncul pada kasus diatas ? A. Kurangnya perawatan keluarga B. Tidak efektif peran keluarga C. Tidak efektif koping keluarga D. Kurangnya pengetahuan keluarga E. Ketidakmampuan merawat keluarga 22. Seorang laki laki 65 tahun tinggal bersama 6 anak, 6 menantunya dan 6 cucunya. Dirumah itu semakin ramai apabila menjelang sore hari karena ke enam cucunya sudah pulang sekolah.

Rumah Tn. D adalah sebuah rumah tua yang sudah dibangun sejak tahun 1986 Termasuk Tipe keluarga apakah kasus diatas? a. Nuclear family b. Extended family c. Dyadic family d.

Single parent family e. Semua jawaban benar 23. Seorang anak Y 9 tahun baru pulang setelah 5 hari di rawat di rumah sakit karena ISPA, anggota keluarga mengatakan Anak Y mengalami batuk selama 3 minggu tak kunjung sembuh, adik An Y semenjak 4 hari kemarin juga mengalami gejala yang sama dengan An Y yaitu sering batuk.

Berdasarkan hasil pengkajian kondisi rumah lembab dan kurang ventilasi Apakah masalah keperawatan utama pada klien tersebut diatas? a. gangguan pola nafas b. peran orang tua tidak efektif c. kurang pengetahuan tentang TBC paru d. resiko penularan pada anggota keluarga yang lain e.

kurang pengetahuan tentang kesehatan lingkungan 24. Seorang laki laki 24 tahun mengalami kecelakaan. Kulit bagian kakinya robek dan dilakukan hecting di RSUD terkenal di kota bandung, setelah pulang ke rumah klien dapat merawat luka di bagian kakinya sendiri dengan menggunakan bethadin supaya terhindar dari bakteri dari luar Kemungkinan masalah dapat diubah oleh klien ?

A. Tinggi B. Mudah C. Sebagian D. Rendah E. Tidak dapat dirubah 25. Ny A 56 tahun. 2 bulan kemarin baru saja pensiun. Suaminya sudah sudah 1 tahun yang lalu pension. Kegiatan sehari hari hanya diam dirumah dan menikmati masa tuanya di rumah bersama anak anak dan cucunya Tahap perkembangan keluarga Ny A ?

A. Keluarga usia lansia B. Keluarga anak remaja C. Keluarga anak sekolah D. Keluarga usia dewasa E. Keluarga usia pertengahan 26. Seorang lanugo pada bayi baru lahir 27 tahun baru saja melahirkan secara SC 1 bulan yang. Post melahirkan klien merasa perutnya sangat sakit dan keluar anah dari bekas luka operasinya.

klien pernah dibawa ke puskesmas dan menjalani pengobatan. Namun sakit dan pus diperutnya tak kunjung hilang.

Semenjak itu klien tidak pernah lagi ke puskesmas. klien untuk menutup bekas lukanya dengan daun sirihuntuk mengatasinya Fungsi kesehatan keluarga mana yang mengalami gangguan pada klien? a. Kemampuan Keluarga dalam merawat klien b. Kemampuan Keluarga dalam mengenal masalah c. Kemampuan Keluarga dalam mengambil keputusan d. Kemampuan keluarga dalam Memodifikasi lingkungan e. Kemampuan keluarga dalam memanfaatkan pelayanan kesehatan 27. Sebuah keluarga dimana pasangan suami isteri sama-sama melakukan pengaturan dan belanja rumah tangga dengan orang tua, sanak-saudara, atau kerabat dekat lainnya.

Disebut juga keluarga? A. Keluarga Tradisional B. Keluarga Inti C. Keluarga Besar D. Keluarga Moderen E. Keluarga Bersama 28. Seorang perawat membantu keluarga, untuk mengenali penyimpangan kesehatan dengan menganalisis data secara objektif serta membuat keluarga sadar tentang akibat masalah tersebut terhadap perkembangan anggota keluarga Termasuk peran perawat dalam keperawatan keluarga?

A. Pemberi Asuhan Keperawatan B. Coordinator perawatan kesehatan keluarga C. Fasilitator D. Pendidik E. Pemantau Kesehatan 29. Keluarga mensosialisasikan anak-anak, meningkatkan prestasi sekolah dan mengembangkan hubungan dengan teman sebaya yang sehat dan mempertahankan hubungan pernikahan yang memuaskan Termasuk pada tahap keluarga? A. Tahap I Keluarga Baru B. Tahap IV Keluarga dengan anak usia sekolah C. Tahap V Keluarga dengan anak remaja D. Tahap VI Keluarga dengan tahap pelepasan E.

Tahap VIII Keluarga dengan tahap usia lanjut 30. Sebuah keluarga memiliki 2 orang putri dimana putri pertama nya sudah bekerja diluar kota dan putri kedua nya melanjutkan pendidikan di perguruan tinggi di luar kota juga Termasuk tahap berapakah keluarga tersebut?

A. Tahap I Keluarga Baru B. Tahap IV Keluarga dengan anak usia sekolah C. Tahap V Keluarga dengan anak remaja D. Tahap VI Keluarga dengan tahap pelepasan E.

Tahap VIII Keluarga dengan tahap usia lanjut 31. Sebuah keluarga dimana salah satu pasangan memasuki usia pensiun sampai dengan dengan salah satu pasangan meninggal dunia Termasuk tahap berapakah keluarga tersebut? A. Tahap I Keluarga Lanugo pada bayi baru lahir B. Tahap IV Keluarga dengan anak usia sekolah C.

Tahap V Keluarga dengan anak remaja D. Tahap VI Keluarga dengan tahap pelepasan E. Tahap VIII Keluarga dengan tahap usia lanjut 32. Suatu keluarga tinggal di sebuah rumah terdiri dari kedua orang tua, anak-anak, kakek, nenek dan adik dari orang tua laki-laki Dari uraian diatas termasuk tipe keluarga? A. Keluarga besar (Ekstended Family) B.

Keluarga Inti (Nuclear Family) C. Keluarga bentukan kembali (dyadic family) D. Orang tua tunggal (single parent family) E. The single adult living alone 33. Perawat J (30 tahun) mendatangi sebuah keluarga yang memiliki anak pertama usia 2 tahun dengan keluhan anak nocturnal sepanjang hari. Apakah intervensi terpenting apa yang dilakukan perawat pada saat toilet training? a. b. c. d. e. Motivasi konsistensi, dan tindakan untuk tidak menghakimi anak Komunikasi dengan anak Mengkaji suport pendukung keluarga Mengadvokasi permasalahan keluarga Melibatkan seluruh anggota keluarga dengan potensi-potensi keluarga 34.

Seorang Perawat sedang memberikan asuhan keperawatan keluarga dengan stage Family retirement and old age dengan masalah Depresi ringan salah satu pasangan old age. perawat mengoptimalkan fungsi keluarga sebagai dasar kekuatan keluarga melalui pemenuhan kebutuhan psikososial, mengembangkan gambaran diri positif, peran dan kebutuhan kasih sayang sedikit banyak bisa mendukung keluarga dalam menyelesaikan masalah tersebut.

Fungsi keluarga apa yang sedang di optimalkan oleh perawat tersebut? a. Fungsi Afektif b. Fungsi Sosialisasi c. Fungsi ekonomi d. Fungsi perawatan kesehatan e. Fungsi Reproduksi 35. Dalam memberikan asuhan keperawatan keluarga sebaiknya perawat memahami tahap perkembangan keluarga apa yang di butuhkan oleh keluarga tersebut dengan mengidentifikasi kondisi keluarga Tugas perkembangan keluarga apa yang akan di terapkan pada kondisi keluarga yang di kunjungi dengan tahapan keluarga dengan anak pre-school a.

Membina hubungan dengan keluarga lain, teman dan sosial b. Adaptasi dengan adanya perubahan anggota keluarga, interaksi sosial, hubungan seksual & kegiatan c. Membantu anak bersosialisasi d. Mempertahankan hubungan dekat dengan keluarga e. Memperluas jaringan keluarga dari keluarga inti menjadi keluarga besar 36. Perawat dalam memberikan asuhan keperawatan keluarga untuk memenuhi kebutuhan dasar baik kebutuhan sosial, kebutuhan ekonomi maupun aktualisasi keluarga di masyarakat agar tercapai keluarga yang sejahtera di tuntut bisa mengantisipasi perbedaan status keluarga Indikator Keluarga dengan status kelompok sejahtera tahap 1 adalah?

a. Makan daging, ikan, telur, lauk pauk sekurang-kurangnya sekali dalm seminggu b. Makan dua kali sehari atau lebih c. Anggota keluarga sehat dalam 3 bulan terakhir sehingga dapat optimal fungsi masing-masing d. Luas lantai penghuni 8 m² per orang e. Rekreasi bersama keluarga dalam 6 bulan terakhir 37.

Saat perawat melakukan kunjungan rumah ke keluarga Bpk U (28 thn). Saat pengkajian Bpk U mengatakan, anak perempuannya (3 tahun) sering mengalami batuk dan pilek.

Hasil pemeriksaan fisik pada anak tersebut didapatkan data: frekuensi nafas 45 kali permenit, bunyi nafas ronkhi, tidak ada retraksi dinding dada, tampak ada sekret di lubang hidung.

Apakahlangkah perawat selanjutnya pada keluarga tersebut ? a. Melakukan pengkajiantugas perawatan keluarga. b. Menegakkan diagnosis keperawatan keluarga. c. Memberikan pendidikan kesehatan tentang ISPA. d. Merujuk keluarga ke pelayanan lanugo pada bayi baru lahir terdeka. e. Melakukan evaluasi tindakan keperawatan keluarga.

38. Saat perawat melakukan kunjungan rumah ke keluarga Bpk U (57 tahun), Bpk U mengeluhkan sering mengalami pusing. Bapak U mengatakan sudah lama dia mengidap hipertensi yaitu dari 5 tahun yang lalu. Hasil pemeriksaan di dapat: tekanan darah Bapak U 160/90 mmHg, nadi 70 kali permenit, frekuensi nafas 16 kali permenit. Klien dan keluarga mengatakan belum mengerti penyakitnya dan belum mengetahui cara mengatasi penyakitnya. Apakah masalah keperawatan prioritas pada keluarga Bapak U?

a. Resiko gangguan perfusi jaringan serebral pada keluarga Bpk U b. Nyeri pada keluarga Bpk U c. Kurang pengetahuan pada keluarga 39. Bpk U Seorang perawat bermaksud untuk melakukan asuhan keperawatan keluarga pada keluarga Bapak M (56 tahun). Ibu A (50 tahun), istri Bapak M mengeluhkan sudah batuk lebih dari 2 bulan. Klien dan keluarga mengatakan anggota keluarga lainnya yaitu An.J pernah mengalami TBC.

Pada pertemuan selanjutnya, saat akan melakukan asuhan keperawatan keluarga, An. J mengusir perawat dengan alasan tidak mau Ibu A dijadikan bahan percobaan perawat. Apa yang menyebabkan An.

J mengusir perawat? a. Lanugo pada bayi baru lahir A dijadikan bahan percobaan oleh perawat. b. An. J malu dengan penyakit ibunya. c. Perawat memiliki kompetensi yang kurang memadai. d. Penjelasan kontrak yang dilakukan perawat kurang lengkap. e. An.J mengalami gangguan psikososial.

40. Bapak S mengeluhkan mengalami susah buang air kecil. Bapak S dan keluarga mengatakan sudah lama Bapak S mengalami susah buang air kecil. Bapak S dan keluarga mengatakan orang tua bapak S, Bapak D dulu mengalami hal yang sama. Bapak S mengatakan dirinya tidak mau berobat ke rumah sakit karena takut dipasang selang oleh tenaga kesehatan. Bapak S mengatakan bahwa Bapak D meninggal karena dipasang selang urin.

Apakah yang harus dilakukan perawat untuk mengintervensi keluarga Bapak S? a. Menyarankan klien untuk menghindari minum disore dan malam hari. b. Memberikan penkes pada keluarga Bapak S tentang lanugo pada bayi baru lahir c. Membawa ahli perawat jiwa untuk mengatasi masalah kesehatan keluarga. d. Menghormati otonomi keluarga e. Melaporkannya pada puskesmas di wilayahnya.

41. Keluarga Bapak D (48 tahun) terdiri dari Bapak D, Ibu J (40 tahun), An. A ( 25 tahun), dan An Z (18 tahun).

An A. sudah menikah dengan An. N (24 tahun) dan memiliki 2 anak yaitu An. M (2 tahun), An N ( 1 bulan). Menurut Duvall, termasuk kedalam tahap perkembangan apakah keluarga Bapak D? a. Tahap melepas anak ke masyarakat (launching center family) b. Tahap orang tua usia menengah (parent alone in middle years) c.

Tahap menghadapi anak prasekolah (preschool family) d. Tahap menghadapi anak sekolah (school family) e. Tahap orang tua usia menengah (parent alone in middle years) 42. Seorang perawat jiwa masyarakat melakukan kunjungan rumah. Perawat tersebut melakukan pengkajian dan menetapkan diagnose keperawatan. Perawat lalu merencanakan untuk mengunjungi klien untuk memberikan sp1 halusinasi. Saat kunjungan klien mengeluhkan diare.

Apa yang harus dilakukan perawat pada saat itu? a. Memberikan Sp 1 halusinasi, lalu mengatasi diare b. Melakukan pengkajian here and now, lalu mengatasinya c. Menyarankan klien untuk meminum air banyak, dan meminum oralit d. Mengatasi diare klien, lalu memberikan sp 1 halusinasi e.

Membawa klien ke pelayanan kesehatan terdekat. 43. Keluarga Bapak U(50tahun) adalah keluarga yang berada di Rw 01/RT 02 Leuwi Gajah Cimahi. Seorang perawat telah melakukan pengkajian dan menegakkan diagnose. Salah satu diagnose yang diangkat adalah resiko gangguan perfusi serebral pada keluarga Bapak D khususnya Bapak D berhubungan dengan ketidakmampuan keluarga merawat anggota keluarga dengan hipertensi.

Hasil pengkajian prioritas masalah yang dilakukan dengan keluarga: sifat masalah: resiko,Kemungkinan masalah dapat diubah :Masalah mudah diubah, Potensi untuk dicegah : cukup, Menonjolnya masalah : Masalah tidak dirasakan Berapa jumlah nilai untuk prioritas diagnose keperawatan tersebut? a) ½ b) 1 c) 1 ½ d) 1 5/6 e) 2 ½ 44. Keluarga Bapak D (30 tahun) adalah keluarga yang tinggal di RW 01/RT 02 Leuwi Gajah cimahi. Bapak D memiliki 2 orang istri yaitu Ibu A (30 tahun) dan Ibu B (20 tahun).

Dari Ibu A Bapak A memiliki 2 orang anak yaitu An. C (10 tahun) dan An. D (5 tahun). Seluruh anggota keluarga tersebut hidup bersama didalam satu rumah. Apakah tipe keluarga Bapak D?

a) Keluarga besar (Extended Family) b) Keluarga berantai (Serial Family) c) Keluarga berkomposisi (Compocite) d) Keluarga kabitas (Cahabitation) e) Keluarga inti (Nuclear Family) 45. Bapak Y( 25 tahun) dengan istrinya Bapak X (24 tahun) tinggal bersama dalam satu rumah sebagai pasangan homoseksual.

Bapak Y dan Bapak X memenuhi criteria sebuah keluarga menurut definisi keluarga? a) Marylin M. Friedmen b) Duvall c) logan d) Selvicio G. Bailon e) Aracelis Maglaya 46. Keluarga Bpk U (28 thn) merupakan keluarga dengan tahap perkembangan anak usia toddler/batita. Bpk S dan Ibu R (23 thn) memiliki satu orang anak yaitu An. R (1 thn).

Ibu R mengatakan An. R sering mengalami batuk dan pilek walau saat ini tidak. Ibu R mengatakan batuk pilek merupakan keadaan batuk disertai hidung yang mengeluarkan ingus ataupun tersumbat. Ibu R mengatakan penyebab batuk pilek yang ia ketahui adalah akibat cuaca. Tanda dan gejala batuk pilek menurut Ibu R adalah badan panas, anak rewel serta keluar ingus lanugo pada bayi baru lahir hidung.

Akibat batuk pilek menurut Ibu R adalah anaknya menjadi lemas dan lanugo pada bayi baru lahir. Tindakan yang biasanya dilakukan Ibu R saat An R batuk pilek adalah langsung dibawa ke dokter. Apa Diagnosa keperawatan keluarga yang bisa ditegakkan pada keluarga Bpk U? a) b) c) d) Risiko bersihan jalan napas tak efektif pada keluarga Bpk U khususnya An R berhubungan dengan ketidakmampuan keluarga mengenal masalah anggota keluarga dengan ISPA yang berulang.

Risiko bersihan jalan napas tak efektif pada keluarga Bpk U khususnya An R berhubungan dengan ketidakmampuan keluarga mengambil keputusan untuk merawat anggota keluarga dengan ISPA yang berulang. Risiko bersihan jalan napas tak efektif pada keluarga Bpk U khususnya An R berhubungan dengan ketidakmampuan keluarga merawat anggota keluarga dengan ISPA yang berulang. Risiko bersihan jalan napas tak efektif pada keluarga Bpk U khususnya An R berhubungan dengan ketidakmampuan keluarga memodifikasi lingkungan untuk mengatasi anggota keluarga dengan ISPA yang berulang.

e) Risiko bersihan jalan napas tak efektif pada keluarga Bpk U khususnya An R berhubungan dengan ketidakmampuan keluarga memanfaatkan fasilitas kesehatan untuk mengatasi anggota keluarga dengan ISPA yang berulang. 47. Keluarga terdiri dari kepala keluarga 50 tahun, istri ibu rumah tangga berusia 38 tahun, anak 3 orang. Kondisi keluarga dapat memenuhi kebutuhan dasar (sandang, pangan, papan) secara minimal, interaksi dalam keluarga minimal karena kepala keluarga bekerja sebagai kuli bangunan, ibu bekerja sebagai buruh cuci dan setrika, anak pertama dan kedua menjadi pengamen jalanan, serta anak ketiganya masih balita sehari-hari dititipkan pada tetangga.

Apakah tipe kesejahteraan keluarga tersebut? a. Keluarga Prasejahtera b. Keluarga sejahtera I c. Keluarga sejahtera II d. Keluarga sejahtera III e. Keluarga sejahtera plus 48. Keluarga Tuan S memiliki 5 anggota keluarga, terdiri dari Ny. S sebagai ibu rumah tangga, kedua anaknya. Tuan S sendiri sebagai kepala keluarga. Apakah tipe keluarga tersebut? A. Extended Family B. Nuclear Family C. Reconstituted Nuclear Family D.

Dyad Nuclear Family E. Commuter Married Family 49. Saat dilakukan pengkajian pada keluarga Bpk. G didapatkan data bahwa Bpk. G menderita batuk berdahak sudah 3 minggu dan tidak kunjung sembuh, berkeringat di malam lanugo pada bayi baru lahir meskipun sudah berobat dan mendapatkan obat dari dokter. Selain itu Bpk. G juga mengeluh berat badan turun 3 kg selama batuk ini.

Saat diperiksakan BTA di Puskesmas ternyata Bpk.G positif menderita TBC paru. Bpk. G dan keluarga mengatakan pernah mendengar tentang Lanugo pada bayi baru lahir tapi tidak tahu dengan jelas dan tidak tahu harus bagaimana menghadapi penyakit tersebut. Apakah diagnosa keperawatan prioritas untuk masalah keluarga Bpk. G tersebut di atas ? A. Kurangnya informasi keluarga berhubungan dengan ketidakmampuan keluarga mengenal masalah penyakit TBC. B. Kurangnya informasi keluarga berhubungan dengan ketidakmampuan keluarga mengambil keputusan dalam mengatasi penyakit TBC C.

Kurangnya informasi keluarga berhubungan dengan ketidakmampuan keluarga merawat anggota keluarga yang sakit TBC. D. Kurangnya informasi keluarga berhubungan dengan ketidakmampuan memodifikasi lingkungan rumah dari penyakit TBC. E. Kurangnya informasi keluarga berhubungan dengan ketidakmampuan keluarga dalam menggunakan fasilitas kesehatan untuk mengatasi penyakit TBC.

50. Saat dilakukan pengkajian pada keluarga Bpk. G didapatkan data bahwa Bpk. G menderita batuk berdahak sudah 3 minggu dan tidak kunjung sembuh, berkeringat di malam hari meskipun sudah berobat dan mendapatkan obat dari dokter. Selain itu Bpk. G juga mengeluh berat badan turun 3 kg selama batuk ini. Saat diperiksakan BTA di Puskesmas ternyata Bpk.G positif menderita TBC paru.

Bpk. G dan keluarga mengatakan pernah mendengar tentang TBC tapi tidak tahu dengan jelas dan tidak tahu harus bagaimana menghadapi penyakit tersebut.

Apakah upaya preventif sekunder yang perlu dilakukan perawat pada saat kunjungan terhadap keluarga pasien tersebut supaya tidak terjadi komplikasi lebih lanjut? a. Menjelaskan bagaimana cara minum obat dan lamanya pengobatan b. Memberikan penyuluhan tentang aktivitas yang dapat dilakukan c. Menganjurkan untuk mengkomunikasikan dengan keluarga d. Menyarankan untuk menggunakan oksigen jika sesak e.

Mnganjurkan untuk banyak minum jika batuk 51. Keluarga Tn. A (69 tahun) adalah seorang suami yang tinggal hanya dengan istrinya yang sudah lanjut usia juga karena anak-anak telah menikah dan hidup terpisah. Tn A mengalami post stroke dengan kondisi saat dikaji lumpuh ekstremitas bawah, bicara pelo, pemenuhan kebutuhan sehari-hari hanya dibantu oleh istri.

Dua hari yang lalu jatuh dan tangan kanan memar. Apakah tindakan keperawatan prioritas kasus diatas? a. Perawatan luka memar b. Peningkatan kemampuan komunikasi keluarga c. Pendidikan kesehatan tentang perawatan paska stroke d. Pendidikan kesehatan tentang resiko jatuh dan pencegahannya e. Pendidikan kesehatan tentang tugas perkembangan keluarga dengan lansia 52. Keluarga Tn. A (69 tahun) adalah seorang suami yang tinggal hanya dengan istrinya yang sudah lanjut usia juga karena anak-anak telah menikah dan hidup terpisah.

Tn A mengalami post stroke dengan kondisi saat dikaji lumpuh ekstremitas bawah, bicara pelo, pemenuhan kebutuhan sehari-hari hanya dibantu oleh istri. Dua hari yang lalu jatuh dan tangan kanan memar. Apakah sifat masalah dalam keluarga Tn. A? A. Sejahtera B. Ancaman C. Aktual D. Krisis E. Potensial 53. Indonesia saat ini sebagai salah satu negara dengan kasus penderita TBC lima terbesar di dunia.

Berbagai upaya telah dilakukan oleh pemerintah, salah satunya melalui penanganan pasien dengan metode DOT Apakah tindakan preventif primer yang tepat dilakukan oleh perawat keluarga? a. Memberikan penyuluhan pentingnya imunisasi pada balita sehat di posyandu b.

Melakukan skrining pada pasien TBC diwilayah kerja puskesmas c. Melakukan rehabilitasi pasien-pasien yang menjalani TBC d. Merujuk pasien TBC dengan komplikasi e. Melakukan Pengobatan pasien TBC 54. Keluarga Tn. A berusia 50 tahun memiliki istri Ny B berusia 40 tahun, sudah lama menikah. Namun belum memiliki keturunan. Keluarga memutuskan mengambil dua orang anak asuh, masing-masing berusia 19 tahun dan 7 bulan. Namun Ny B tidak menyangka bahwa ia sekarang sedang hamil, ny.

B terlihat kurang siap dengan kehamilannya dan sedikit mengabaikan anggota keluarga lainnya. Apakah yang terganggu dari Ny B dalam melaksanakan fungsi keluarga? a. Fungsi Biologis b. Fungsi Edukasi c. Fungsi Ekonomis d. Fungsi Psikologis e. Fungsi Pengontrol 55. Seorang laki-laki Tn. J berusia 58 tahun, mengeluh satu bulan terakhir, setiap pagi batuk-batuk sampai dahak keluar semua. Sesak nafas bila menaiki tangga. Dan dua hari terakhir, pasien mengeluh demam, batuk, pilek, pusing, dan sesak nafas.

Kemudian oleh anaknya di bawa ke Puskesmas, saat diperiksa tanda-tanda vital: suhu 38.5ºC, TD 140/90 mmHg, nadi 100x/mnt, RR 25x/mnt. Disarankan oleh dokter puskesmas untuk dirujuk ke rumah sakit, namun Tn. J menolak dengan alasan nanti juga sembuh dan ini sudah biasa. Apakah masalah keperawatan prioritas yang dapat ditegakkan pada kasus di atas?

a. Perubahan pola nafas b. Tidak efektifnya jalan nafas c. Resiko gangguan perfusi jaringan d. Kurang pengetahuan tentang dampak PPOK e. Ketidakmampuan keluarga mengambil keputusan 56. Seorang laki-laki Tn. J berusia 58 tahun, mengeluh satu bulan terakhir, setiap pagi batuk-batuk sampai dahak keluar semua. Sesak nafas bila menaiki tangga. Dan dua hari terakhir, pasien mengeluh demam, batuk, pilek, pusing, dan sesak nafas.

Kemudian oleh anaknya di bawa ke Puskesmas, saat diperiksa tanda-tanda vital: suhu 38.5ºC, TD 140/90 mmHg, nadi 100x/mnt, RR 25x/mnt. Disarankan oleh dokter puskesmas untuk dirujuk ke rumah sakit, namun Tn.

J menolak dengan alasan nanti juga sembuh dan ini sudah biasa. Apakah tindakan keperawatan yang perlu dilakukan untuk mengatasi kasus tersebut di atas? a. Memberikan pendidikan kesehatan b. Meminum obat secara teratur c. Mengajarkan nafas dalam d. Mengajarkan batuk efektif e. Mengubah posisi tidur 57. Keluarga dengan kepala keluarga 50 tahun, istri berusia 38 tahun, anak 3 orang, kondisi keluarga dapat memenuhi kebutuhan dasar (sandang,pangan,papan) secara minimal, interaksi dalam keluarga minimal karena kepala keluarga bekerja sebagai kuli bangunan diluar kota dan ibu bekerja sebagai buruh cuci baju, anak pertama dan kedua menjadi pengamen, anak ketiga yang masih balita sehari-hari dititipkan pada tetangga.

Apakah type kesejahteraan keluarga tersebut berdasarkan estándar BKKBN a. Prasejahtera b. sejahtera I c. Sejahtera II d. sejahtera III e. sejahtera plus 58. Keluarga dengan kepala keluarga berusia 45 tahun, istri 40 tahun, dan anak usia 3 tahun, pada saat dikaji anak mengalami ISPA, kondisi rumah : jendela jarang dibuka dan ruangan lembab, kepala keluarga memiliki kebiasaan merokok di dalam rumah.

Setelah dilakukan tindakan perawatan selama 4 hari, ibu mampu merawat anaknya yang ISPA, membuka jendela dan bapak menghentikan kebiasaannya merokok di dalam rumah. Apakah tingkat kemandirian keluarga setelah dilakukan tindakan keperawatan ? a. KM I b. KM II c. KM III d. KM IV e. KM V 59. Keluarga dengan kepala keluarga berusia 45 tahun, istri 40 tahun, anak pertama berusia 4 tahun mengalami sesak nafas, batuk berdahak,dan demam dengan suhu tubuh 39 derajat celcius.

Anak kedua 2 tahun belum bisa berjalan, saat ini ibu tidak berKB dengan alasan tidak diijinkan suami. Masalah prioritas apakah yang dapat muncul pada keluarga tersebut a. Resiko penularan ISPA b. Gangguan perkembangan c. Bersihan jalan nafas tidak efektif d. Ketidaktahuan keluarga tentang KB e. Gangguan thermoregulasi : Hyperthermi 60. Suatu keluarga dengan kepala keluarga berusia 34 tahun dan istrinya 30 tahun, anak pertama berusia 5 tahun dengan kondisi sesak nafas, tarikan dinding dada +, secret banyak, makan sedikit.

Anak kedua berusia 2 tahun dengan kondisi gizi kurang. Pekerjaan kepala keluarga adala buruh Apakah tindakan keperawatan prioritas ? a. Bantu pemenuhan kebutuhan nutrisi dengan makanan cair b. Penyuluhan kesehatan pada ibu tentang ISPA c.

Penyuluhan kesehatan pada ibu tentang gizi anak d. Observasi tumbuh kembang anak e. Bantu kebutuan lanugo pada bayi baru lahir : dengan perubahan posisi, postural drainage, 61. Keluarga dengan anak pertama usia 17 tahun, anak kedua 8 tahun dan anak ketiga 2 tahun. anak pertama perempuan, mengalami anemia karena terobsesi diet yang ketat untuk menurunkan berat badan, konjungtiva pucat, anak mengeluh sering capek dan badan lemas. Ibu dan anak mengatakan tidak ada masalah dengan kondisinya, itu terjadi karena kelelahan dengan kegiatan sekolah yang padat.

Apakah tugas kesehatan keluarga prioritas yang harus dipenuhi keluarga? a. Mengenal masalah kesehatan keluarga. b. Memutuskan tindakan kesehatan yang tepat bagi keluarga. c. Merawat keluarga yang mengalami gangguan kesehatan. d. Memodifikasi lingkungan keluarga untuk menjamin kesehatan keluarga. e. Memanfaatkan fasilitas pelayanan kesehatan disekitarnya bagi keluarga 62. keluarga dengan kepala keluarga berusia 40 tahun, memiliki tiga orang anak usia 13 tahun, 6 tahun dan 2 tahun, kondisi anak pertama sakit dengan diagnosis TBC.

Perawat dan keluarga sepakat untuk dilakukan kunjungan rumah 2x dalam seminggu. Perawat berusaha menepati janji mengunjungi keluarga sesuai dengan kesepakatan lanugo pada bayi baru lahir telah dibuat.

Prinsip etik apakah yang dipegang oleh perawat dengan menepati janji lanugo pada bayi baru lahir a. Justice b. Fidelity c. Veracity d. autonomy e. Avoding killing 63. Perawat laki-laki mengkaji struktur kekuatan pada keluargadari pengkajian didapat data bawa ibu memberi contoh pada anaknya dalam melakukan perilaku mencuci tangan sebelum dan setelah makan. Bentuk Struktur kekuatan apakah yang dilakukan lanugo pada bayi baru lahir dalam menerapkan perilaku pada anak?

a. b. c. d. e. Referent power Reward power Coercive power Affective power Resource or expert power 64. Seorang laki – laki berusia 4 tahun mengeluh batuk, pilek, sesak R : 28x/mnt, tampak keluar cairan kental di hidung, saat respirasi tampak tersendat hasil kajian terhadap orang tuanya mengatakan penyakitnya adalah batuk pilek dan tidak paham bagaimana cara mengatasinya, dan pernah dibawa ke posyandu Apakah tindakan keperawatan yang tepat pada kasus di atas ?

a. Memberikan penyluhan tentang batuk pilek b. Memberikan penyuluhan upaya pencegahan c. Memberikan penyuluhan tentang cara perawatan d. Memberikan penyuluhan cara pemamfaatan pelayanan kesehatan e. Memberikan penyuluhan tentang rumah sehat 65. Seorang laki – laki berusia 72 tahun mengeluh sesak nafas setelah berolahraga, klien mengeluh tubuhnya terasa dingin, nadi tidak teratur.

Hasil wawancara klien memiliki riwayat hipertensi sejak 5 tahun yang lalu. Apakah tindakan keperawatan prioritas akan anda berikan pada kasus di atas ? a. Memberikan oksigen dosis 5 liter b. Menganjurkan bedrest c. Memberikan posisi semi fowler d.

Menganjurkan istirahat e. Menganjurkan nafas dalam 66. Seorang laki – laki berusia 25 tahun mengeluh sesak, batuk. Hasil pengkajian berat badan 45 kg, tinggi badan 160 cm. Pada waktu wawancara diperoleh data klien mengatakan sedang mengikuti pengobatan tetapi minum obat tidak teratur karena sering lupa, tidak tahu bagaimana upaya pencegahan dan perawatan TBC.

Apakah rencana tindakan yang paling tepat pada kasus diatas? a. Melatih klien untuk batuk yang efektif b. Menganjurkan keluarga menjadi pengawas minum obat c. Memberikan penyuluhan tentang pencegahan d. Memberikan penyuluhan tentang perawatan e. Menganjurkan keluarga membawa anggota keluarga yang sakit ke puskesmas 67. Kepala keluarga (55 Tahun) dengan 2 orang anak, Anak paling kecil berusia 2 tahun 9 bulan dan paling besar 26 tahun akan segera menikah.

Anak paling kecil BB 10 kg, ke Posyandu tidak rutin, masih menyusui. Pekerjaan kepala keluarga buruh bangunan dengan penghasilan 800.000/bulan Apakah tahap perkembangan keluarga yang sedang dialami oleh keluarga tersebut?

a. Child Bearing Family b. Family with teenagers c. Family with preschool d. Launching center Family e. Family with aged Person 68. Seorang buruh (55 Tahun) mempunyai istri (42 Tahun) dengan 5 orang anak, Anak paling kecil berusia 2 tahun 9 bulan .Saat ini istrinya sedang hamil 7 bulan karena mengalami kegagalan KB.

BB sebelum hamil 51 kg, BB sekarang 56 kg, Hb 9 gr% dan baru melakukan pemeriksaan 2 kali. Anak paling kecil BB 12,5 kg, ke Posyandu tidak rutin. Apakah masalah kesehatan pada kasus diatas? a. b. c. d. e. Anemia pada ibu hamil Malnutrisi pada anak Risiko penyulit persalinan Sosial ekonomi yang rendah Jumlah anggota keluarga melebihi sumber daya keluarga 69.

Kepala keluarga (45 Tahun) mempunyai istri (37 Tahun) dengan 5 orang anak. Fase perkembangan keluarga adalah Family with teenagers. Sumber penghasilan keluarga hanya berasal dari kepala keluarga dengan penghasilan Rp 1.285.000/Bulan.

Apakah data lain yang diperlukan untuk memastikan bahwa sumber dana memenuhi kebutuhan keluarga? a. Pola makan keluarga b. Faktor pendukung lain dimasyarakat c. Pola pengambilan keputusan keluarga d. Pengalokasian sumber dana yang diperoleh keluarga e.

Penggunaan fasilitas pelayanan kesehatan oleh keluarga 70. Kepala keluarga (24 tahun) dengan istri (16 tahun) baru menikah sekitar 6 bulan yang lalu dan sedang mengandung 2 bulan. Istri mengatakan masih terlalu muda dan bingung bagaimana menjadi ibu yang baik. Ketika dikaji lebih dalam, ternyata istrinya belum ingin menikah dan masih ingin sekolah, tetapi karena desakan ekonomi dan anjuran orang tua maka ia mernikah dengan suaminya Apakah tugas perkembangan yang harus dipenuhi pada kasus tersebut?

a. Membangun perkawinan yang saling memuaskan b. Pembagian waktu untuk individu, pasangan c. Mempertahankan keintiman pasangan d.

Mempertahankan komunikasi terbuka e. Meningkatkan keakraban pasangan 71. Kepala keluarga (28 tahun) dengan istri (24 tahun) baru menikah sekitar 3 bulan dan sudah 1 minggu telat haid. Istri mengatakan masih terlalu muda dan bingung bagaimana menjadi ibu yang baik.

Bagaimanakah tugas perkembangan keluarga pada kasus di atas? a. Birth of the first child b. Newly married c. Family as launching center d. Family with preschool children e. Family with teenagers 72. Dalam suatu survey kesehatan rumah tangga, ditemukan sebuah keluarga yang anggotanya terdiri dari suami, istri, dua orang anak dan satu orang keponakan.

Anak pertama laki-laki berusia 8 tahun, sedangkan anak kedua perempuan berusia 3 tahun. Apakah type keluarga pada kasus di atas? a. Nuclear Family b. Extended Family c. Cohabiting Couple d. Second Carrier Family e. Blended Family 73. Laki-laki 37 tahun, dengan istri 30 tahun, dan 2 orang anak perempuan 12 tahun dan laki-laki 8 tahun.

Anak ke 2 sejak 1 minggu yang lalu dirawat di Puskesmas DTP. Keluarga merasa bingung dan bersalah atas kejadian yang menimpa anaknya.

Dua hari sebelum kejadian, keluarga tidak merasa curiga terhadap demam dan bintik-bintik merah pada kulit anaknya tersebut. Mereka menganggap hanya sebatas kejadian biasa seperti terkena ulat bulu.

Apakah masalah keperawatan keluarga berdasarkan teori Baylon & Maglaya pada kasus di atas? a. b. c. d. Ketidakmampuan keluarga mengambil keputusan yang tepat mengatasi DHF Ketidakmampuan keluarga merawat anggota keluarga yang menderita DHF Ketidakmampuan keluarga mengenal masalah kesehatan DHF Ketidakmampuan keluarga memanfaatkan fasilitas kesehatan e.

Ketidakmampuan keluarga memodifikasi lingkungan rumah 74. Laki-laki 48 tahun, tinggal bersama seorang istri, 45 thn, dan 3 orang anak berusia remaja. Dua hari yang lalu anak yang paling kecil dibawa ke Puskesmas DTP karena demam dan bintik-bintik merah pada kulit. Keluarga mengatakan bahwa tetangganya baru saja terkena demam berdarah. Apakah diagnosa keperawatan keluarga pada kasus tersebut? a. Keluarga dengan risiko anak menderita DHF b.

Keluarga dengan anak mengalami gangguan rasa nyaman c. Keluarga yang mengalami gangguan peran sebagai orang tua. d. Keluarga yang mengalami kecemasan terhadap anaknya yang dirawat e. Keluarga dengan anak mengalami gangguan pemenuhan kebutuhan fisiologis 75. Sebuah keluarga dengan kepala keluarga Tn. B berusia 50 tahun dan istri usia 40 tahun telah lama menikah dan belum memiliki keturunan.

Keluarga mengambil 2 orang anak asuh, yaitu usia 7 tahun dan paling besar 19 tahun akan segera kuliah. Saat ini istri Tn.B sedang hamil 7 bulan. Istri Tn.B tidak menyangka bisa hamil saat usianya sudah 40 thn. Ia terlihat kurang siap dengan kehamilannya, sehingga menjadi kurang perhatian dengan anggota keluarga yang lain, terutama ke dua anak asuhnya.

Apakah yang terganggu dari Ny D untuk kasus di atas dalam melaksanakan fungsi Keluarga? a. b. c. d. e. Fungsi Biologis Fungsi Ekonomis Fungsi Edukasi Fungsi Psikologis Fungsi Pengontrol SOAL KEPERAWATAN JIWA 1. Seorang perempuan Usia 35 Tahun Dibawa ke dr Psikiatri oleh Ibunya karena sering berteriak dan memukul dirinya sendiri,memecahkan lanugo pada bayi baru lahir yg ada di dekatnya.sekitar 5 bulan yang lalu klien diceraikan oleh suaminya.selama berkeluarga dengan mantan suaminya klien sering mengalami siksaan dan pukulan oleh suaminya.saat dilakukan pengkajian klien tampak berantakan,mata melotot,pandangan tajam,bicara kasar dan tangan selalu mengepal.tampak tegang saat berbicara.

Apakah yang menjadi Masalah utama pada pasien diatas ? a) Resiko Bunuh Diri b) Resiko mencedrai diri sendiri c) Isolasi sosial d) Perilaku kekerasan e) Harga diri rendah 2. Nona A Usia 20 Tahun datang ke Ruanan Unit Gawat Darurat Dia terlihat sangat pucat,menangis histeris saat melihat jasad Orang Tuanya yang telah meninggal dunia karena terlindas mobil truk.dia berteriak-teriak histeris mengatakan ;Tidak,tidak,saya tidak percaya hal ini terjadi.!

Apakah tindakan keperawatan yang akan dilakukan pada Nona A diatas ? a) b) c) d) e) Memberi dukungan secara non verbal Memberi kesempatan kepada klien untuk menangis Mengidentifikasi Tingkat depresi Membantu klien dan keluarga untuk bisa mengerti penyebab kematian Memotivasi klien untuk membicarakan perasaan marahnya 3. Seorang Anak Usia 15 Tahun sedang di rawat di RSUP sejak satu minggu yang lalu,dari sudut Ruangan klien berteriak-teriak sambil menutup wajahnya mengatakan kepada semua orang ;Hai.awas jangan dekat-dekat ada bayangan yang akan masuk ketubuh Mu awas jangan duduk disana.!

Bagaimanakah Strategi yang akan kita lakukan untuk pasien diatas a) “Coba Ade ceritakan seperti apa bayangan itu ? b) “Ade kalau bayangan itu datang ucapkan dalam hati kalau itu tidak nyata “ c) ”Ade,Jangan lupa obatnya diminum yaa?

d) ”Baiklah terimaksih de sudah mau melihat bayangan itu” e) ”Nantikalau bayangan itu ada kasih tahu saya ya ? 4. Seorang gadis usia 20 tahun di bawa ke polo psikiatri dia tampak menutup kedua matanya,bibir nya komat kamit,dan tampak ketakutan serta sering mondar mandir.menurut ibu yg mengantarnya bahwa klien sebelumnya sering menyendiri dibawah pohon besar Apakah priotas rencana keperawatan pada klien diatas? a) Ajarkan klien untuk berlatih berkenalan b) Berikan obat kepada klien c) Buat jadwal sehari-hari klien d) Libatkan klien dalam terapi aktivitas kelompok e) Ajarkan klien cara menghardik halusinasi 5.

Seorang laki-laki umur 30 tahun mengalami kecelakan dan harus diamputasi,pada saat pengkajian klien tampak tegang dan tidak mau menatap perawat dan gelisah,berteriak;mengapa ini bisa terjadi pada saya?saya tidak mau di amputasi.bagaimana saya berjalan nanti?

Apakah diagnosa utama pada pasien diatas? a) Kehilangan :Anger b) Kehilangan: Denial c) Resiko perilaku kekerasan d) Gangguan Harga diri Rendah e) Gangguan citra diri 6. Seorang laki-laki usia 30 tahun di bawa ke unit psikiatri karena menangis terus menerus dan tidak mau keluar kamar,klien mengatakan dirinya jelek,miskin,tidak menarik dan tidak berguna.satu tahun yang lalu terkena longsor yg merenggut nyawa ibunya.setelah itu klien di PHK dari tempat bekerja kemudian mencari kerja lagi tetapi selalu di tolak.satu bulan yg lalu pacar yang dicintainya tiba-tiba menikah dengan juragan jengkol dikampungnya.

Faktor presipitasi manakah yang paling berpengaruh kepada klien diatas? a) Ibunya meninggal dunia b) Di PHK dari tempat kerjanya c) Rumahnya terkena longsor d) Selalu di tolak dalam mencari kerja e) Pacarnya menikah lagi dengan juragan 7.

Nyonya A mengalami kanker payudara setelah diberitahu hasil biopsi payudara ternyata ada keganasan,dia menyangkal bahwa dirinya tidak pernah dilakukan biopsi Mekanisme ego apakah yang digunakan oleh Ny.A a) b) c) d) Kompensasi Displasement Denial Lanugo pada bayi baru lahir e) Introyeksi 8. Pasien dengan disorientasi waktu tempat dan orang untuk mengatasi nya perawat melakukan intervensi sehingga dapat meminimalisisr masalahnya Apakah kriteria hasil dari tindakan keperawatan ?

a) Kembalinya fungsi kognitif b) Kemampuan melakukan perawatan diri c) Terpeliharanya hubungan dengan orang yang terdekat d) Mengembalikan harga diri klien e) Terkendalinya perilaku bermusuhan 9. Nona A umur 23 Tahun merasa melihat sosok ayahnya yang sudah meninggal 2 tahun yang lalu kadang dia bicara sendiri dan senyum sendiri.klien mengatakan lebih senang berdiam diri di kamar menunggu ayahnya datang Masalah apakah yang sedang dialami oleh pasien diatas ? a) Halusinasi pendengaran b) Halusinasi penglihatan c) Ilusi penglihatan d) Harga diri rendah e) Ilusi pendengaran 10.

Seorang laki-laki usia 60 Tahun dibawa ke RSJ karena suka mundar mandir di dalam rumah pada malam hari,kadang BAK dan BAB disembarang lanugo pada bayi baru lahir sering merasa tidak diperhatikan makan padahal barusan sudah makan,klien slalu menanyakan anak kesayangannya padahal ada di dekat nya. Apakah prioritas tindakan yang dilakukan oleh perawat ?

a) b) c) d) e) Mengontrol tanda-tanda vital Menyediakan vispot di kamar klien Mengenalkan nama saat bertemu klien Memberi makan sesuai kesukaan klien Mengatur lingkungan yang aman bagi klien 11. Tn. C mengatakan ingin mati saja, ia merasa dirinya tidak pantas untuk hidup karena buruk rupa, ia tidak tahu apa yang harus dilakukan untuk masa depannya, setiap melihat pisau keinginan untuk mengakhiri hidupnya selalu muncul.

Ia akan memukul siapa saja yang tidak mengikuti keinginannya disertai suara pria yang dengarnya tanpa ada wujud, ia juga mengatakan suara tersebut muncul pada saat menyendiri dan melamun. Diagnosis keperawatan yang mungkin ditegakkan berdasarkan data tersebut adalah ? A. Perilaku Kekerasan B. Resiko Bunuh Diri C. Isolasi Sosial D. Harga Diri Rendah E. Halusinasi 12. Seorang pria berusia 30 tahun dirawat RSJ karena dirumah bicara sendiri, lanugo pada bayi baru lahir dan keluyuran.

Pasien pertama kali dirawat di RSJ disertai keluhan fisik lemas dan pegal lalu Dokter memberi terapi obat.

Setelah minum obat, pasien mengalami mulut kering dan pandangan kabur. Efek obat apakah yang menyebabkan klien mengalami gejala tersebut ? A. Triheksifenidil (THP) B. Klorpromazine (CPZ) C. Parasitamol D. Haloperidol E. Vitamin B12 13. Tn. M berusia 27 Thn. Merupakan klien baru diruangan NAPZA di RSJ.

Klien tersebut mempunyai riwayat menggunakan jenis NAPZA sabu-sabu sejak ia diajak temannya di saat SMA. Saat awal mengkonsumsi ia tidak mengetahui efek samping dari NAPZA tersebut Pencegahan yang paling di prioritaskan dan diberikan seorang perawat pada klien tersebut adalah ?

A. Memberikan informasi dan pendidikan yang efektif tentang NAPZA B. Deteksi dini perubahan perilaku C. Menolak tegas untuk mencoba say no to drug D. Melakukan Terapi Aktivitas Kelompok E. Sosialisasikan pada teman pasien yang menggunakan NAPZA 14. Ny. W mengatakan “ Kakak saya mau meracuni saya karena ia iri dengan kesuksesan saya, karena saya keturunan seorang Nabi dan punya mukjizat dan perusahaan banyak, pokoknya saya tidak mau makan dan minum yang diberikan oleh kakak saya”. ia juga mengatakan bahwasanya ia tinggal saat ini disurga.

Berdasarkan pernyataan diatas, maka perawat dapat mendiagnosa klien sedang mengalami waham jenis apa ? A. Agama B. Somatik C. Curiga D. Kebesaran E. Nihilistik 15. Tn. H merupakan pasien RSJ, saat anamnesa ia mengatakan sering mendengar suara tanpa ada wujudnya, suara tersebut menyuruhnya untuk membunuh ibunya.

Saat suara tersebut muncul ia selalu berteriak keras dan bernada mengancam pada orang lanugo pada bayi baru lahir ingin menolongnya dan ia tidak mau ditemani siapa pun termasuk dokter & perawat ruangan Tujuan tindakan keperawatan untuk pasien halusinasi yang dapat diimplementasikan pada pasien tersebut adalah ? A.

Bisa mengenali dan mengontrol halusinasinya B. Mampu berorientasi pada realita C. Dapat menyalurkan energi marahnya D. Berinteraksi dengan perawat ruangan E.

Bercakap-cakap dengan pasien lainnya 16. Pasien jiwa mengalami perubahan perilaku yang ditandai dengan perilaku maladaptive, tidak umum/lazim, aneh, dan menimbulkan distress serta gangguan dalam pemenuhan kebutuhan hidup.

jika pasien mampu berespon terhadap suara yang didengar dan berespon terhadap gambar yang dilihat. Maka jenis TAK yang sesuai diberikan adalah ? A. Sosialisasi B. Stimulasi Persepsi C. Orientasi Realisasi D. Stimulasi Sensori E. Realitifitas 17. An. R 13 Thn. kehilangan orang tuanya yang meninggal pada bencana longsor. Ia tinggal dipanti dan ditemukan oleh pamannya, kemudian ikut pamannya tersebut. Setahun kemudian, ia ditemukan di kolong jembatan dan sudah ketiga kali kabur dari rumah, sebab diperlakukan kasar oleh pamannya dan disuruh bekerja hingga malam, sehingga kelelahan dan sering tertidur dikelas.

ia tidak tahu harus pergi kemana dan menyesal tidak mati saja bersama orang tuanya. Sebagai seorang perawat, apa hasil yang diharapkan pada masalah anak depresi dengan resiko bunuh diri tersebut ?

A. Anjurkan mengikuti kegiatan kemasyarakatan yang ada dilingkungannya B. Menceritakan penderitaannya secara terbuka dan menggunakan pemecahan masalah yang konstruktif C. Mendiskusikan aktivitas yang biasa dilakukannya D. Mampu berpartisipasi dalam menentukkan perawatan diri secara maksimal E. Mempertemukan kembali dengan pamannya 18. Saat pengkajian didapatkan data obyektif muka pasien tampak merah dan tegang, pandangan tajam, klien lanugo pada bayi baru lahir kotor, sering mondar mandir di ruangan, jika ada perawat yang mengajak berbicara klien mengancam secara verbal.

Jika ada yang menghina dan melihat bayangan tinggi besar maka ia akan menghindar Berdasarkan data tersebut, perawat dapat menyimpulkan klien tersebut mempunyai masalah keperawatan jiwa ?

A. Resiko Perilaku Kekerasan B. Harga Diri Rendah C. Defisit Perawatan Diri D. Isolasi Sosial E. Halusinasi 19. Pelayanan keperawatan jiwa yang berfokus pada peningkatan fungsi dan sosialisasi serta pencegahan kekambuhan pada klien gangguan jiwa yang diterapkan di klinik dan komunitas Termasuk pada tingkat pencegahan pelayanan keperawatan apa ?

A. Primer B. Sekunder C. Tersier D. Kuartet E. Kolaboratif 20. Tn. M merupakan pasien gangguan jiwa di ruang perawatan psikiatrik, perawat akan melatih pasien untuk tutup telinga dan memejamkan mata serta mengatakan, “ Saya tidak mau dengar ! kamu suara palsu ! pergi ! pergi lanugo pada bayi baru lahir “ Berdasarkan data diatas salah satu cara mengontrol halusinasi dengan cara yaitu A. Menghardik halusinasi B.

Berbincang dengan orang lain C. Melakukan aktivitas yang terarah D. Bercakap-cakap dengan perawat E. Mengikuti Terapi Aktivitas Kelompok 21. Seorang klien dengan diagnosis depresi berat yang mencoba bunuh diri mengatakan kepada perawat, "Aku seharusnya mati. Aku selalu gagal. Tidak ada yang pernah pergi tepat bagi saya." Respon yang paling terapi untuk klien?

A. "Saya tidak melihat Anda sebagai sebuah kegagalan." B. "Merasa seperti ini semua bagian dari menjadi sakit." C. "Kau sudah merasa seperti kegagalan untuk sementara waktu?" Lanugo pada bayi baru lahir. "Anda memiliki segala sesuatu untuk hidup." 22. Seorang klien dirawat di unit kesehatan mental mengalami proses berpikir terganggu. Klien percaya bahwa makanan yang poisioned.

Teknik yang melakukan komunikasi rencana perawat digunakan untuk mendorong klien untuk makan? Teknik yang melakukan komunikasi rencana perawat digunakan untuk mendorong klien untuk makan?

A. B. Menggunakan pertanyaan dan keheningan terbuka Menawarkan pendapat tentang perlunya C. mengidentifikasi alasan bahwa klien mungkin tidak ingin makan D. Fokus pada pengungkapan diri mengenai preferensi makanan 23. Seorang klien dirawat di unit kesehatan mental untuk perawatan perilaku psikotik. Klien adalah di pintu keluar terkunci dan berteriak "Biarkan aku keluar. Tidak ada yang salah dengan saya. Saya tidak pantas berada di sini." Perawat menganalisis perilaku sebagai?

A. Proyeksi B. Denial C. Regresi D. Rasionalisasi 24. Seorang perawat kesehatan rumah sedang berbicara dengan istri klien mengambil antidepresan. Istri mengatakan, "Sekarang suami lanugo pada bayi baru lahir merespon antidepresan, risiko bunuh diri selesai dan Anda dapat berhenti melakukan kunjungan rumah ini." Setelah menganalisa pernyataan ini, dan Refleksi berikut adalah respon keperawatan yang paling tepat?

Refleksi berikut adalah respon keperawatan yang paling tepat? A. "Saya setuju dengan Anda. Klien yang ingin membunuh diri mereka sendiri hanya ingin bunuh diri untuk waktu yang terbatas. Tidak ada yang dapat merasakan merusak diri sendiri selamanya." B. "Saya perlu untuk melanjutkan dengan kunjungan saya. Komentar anda mencerminkan kurangnya pengetahuan bahwa penyakit ini berjalan dalam keluarga." C.

"Saya setuju dengan Anda. Ancaman ingin bunuh diri benar-benar mencari perhatian. Melanjutkan untuk mengunjungi akan memperkuat penggunaan suami Anda manipulasi." D.

"Saya perlu untuk melanjutkan dengan kunjungan saya. Kebanyakan bunuh diri terjadi dalam 3 bulan setelah perbaikan dimulai karena klien sekarang memiliki energi untuk melaksanakan niat ingin bunuh diri." 25. Seorang wanita berusia 18 tahun dirawat di unit rawat inap dengan diagnosis anoreksia nervosa. Pendekatan perilaku kognitif digunakan sebagai bagian dari rencana perawatannya. Perawat memahami bahwa tujuan dari pendekatan ini adalah untuk Perawat memahami bahwa tujuan dari pendekatan ini adalah untuk A.

Bantuan klien mengidentifikasi dan memeriksa pikiran dan keyakinan disfungsional. B. Tekankan interaksi sosial dengan klien yang menarik diri. C. Menyediakan lingkungan aupportive. D. Memeriksa konflik intrapsikis dan isu-isu masa lalu 26.

Seorang klien laki-laki dengan delirium menjadi disorientasi dan bingung di kamarnya di malam hari. Awal intervensi keperawatan yang terbaik adalah Awal intervensi keperawatan yang terbaik adalah? A. B. C. D. Gunakan lampu malam dan mematikan televisi Keep televisi dan cahaya lembut pada malam lanugo pada bayi baru lahir Pindahkan klien sebelah stasiun perawat Putar musik lembut pada malam hari, dan menjaga ruangan yang cukup terang 27.

Perawat meninjau jadwal kegiatan untuk hari dan rencana yang aktivitas untuk klien manik? Perawat meninjau jadwal kegiatan untuk hari dan rencana yang aktivitas untuk klien manik? A. B. C. D. Tas coklat makan siang dan review buku Terherball Gambar nomor aktivitas Bernapas dalam dan relaksasi progresif kelompok 28.

Perawat adalah pemakaian klien dengan riwayat halusinasi perintah untuk menyakiti diri sendiri atau orang lain. Perawat memberikan instruksi kepada klien tentang intervensi untuk halusinasi dan kecemasan dan menentukan bahwa klien memahami instruktur berikut pernyatan bahwa Intervensi apa yang klien telah pahami? A. B. "obat saya tidak akan membuat saya cemas." "Saya bisa memanggil terapis saya ketika saya sedang berhalusinasi sehingga saya dapat berbicara tentang perasaan dan rencana saya dan tidak menyakiti siapa pun." C.

"Aku akan pergi untuk mendukung kelompok dan berbicara sehingga saya tidak menyakiti siapa pun." D. "Saya tidak akan mendapatkan cemas atau mendengar hal-hal jika saya mendapatkan cukup tidur dan makan dengan baik." 29. Seorang klien dirawat di unit kesehatan mental dengan diagnosis depresi. Perawat mengembangkan rencana perawatan untuk klien dan termasuk yang aktivitas paling tepat dalam program tersebut Rencana apa yang paling tepat untuk pasien diatas? A. Membaca dan menulis sebagian besar hari B.

Nothing sampai klien meminta untuk berpartisipasi dalam lingkungan C. Beberapa kegiatan yang klien dapat memilih dari. D. Sebuah program terstruktur kegiatan bagi klien untuk ikut serta dalam 30.

Seorang klien maniak mengumumkan kepada semua orang di ruang pada hari itu penari telanjang akan datang untuk tampil malam ini. Saat seorang perawat dengan tegas menyatakan bahwa ini tidak akan terjadi, klien maniak menjadi berbicara kasar dan mengancam kekerasan fisik terhadap perawat.

Berdasarkan analisis situasi ini, perawat menentukan bahwa tindakan yang paling tepat adalah dengan A. Dengan bantuan, menemani klien maniak menuju kamarnya dan mengadministrasikan haloperidol (Haldol) seperti yang ditentukan jika diperlukan B. Katakan kepada klien bahwa merokok hak akan ditarik selama 24 jam C.

Orient klien ke waktu, orang, dan tempat D. Beritahu klien bahwa perilaku tersebut tidaklah tepat 31. Seorang wanita berusia 45 tahun melangkah mondar mandir dan agitasi sejak dia masuk rumah sakit pagi ini, ia berpakaian rapi, bersih dan sesuai dengan rambut tertata rapi.

Ia berkata bahwa ia bertanggung jawab terhadap perceraiannya 12 tahun yang lalu, berpikir bahwa dirinya bodoh dan tahu bahwa tidak ada seorang pun yang dapat menyukainya Apa perilaku yang penting yang harus dicatat untuk mengetahui tingkat depresi klien ini a.

b. c. d. Afek dan proses pikir Mood dan kontrol impuls Orientasi dan penampilan Keputusasaan dan ketidakberdayaan 32. Seorangklien berkata pada anda ” anda adalah perawat terbaikk yang pernah saya temui.

Saya ingin anda mengingat saya.” Apakah respon perawat yang tepat a. ”Apakah anda berpikir untuk bunuh diri?” b. Terimakasih. Saya juga merasa anda spesial” c. ”Anda mungkin mengatakan hal itu kepada semua perawat.” d. ”Saya curiga anda menginginkan sesuatu dari saya. Apakah itu?” 33.

Seorang klien perempuan memakai baju yang sangat minim, riasan wajah yang tebal dan mencolok. Ketika ia melambaikan roknya di depan klien pria, jelas terlihat ia tidak memakai celana dalam. Perawat mengalihkan 34. 35. 36. 37. 38. perhatiannya dan membawanya ke kamar untuk memakai celana dalam. Apakah yang harus dilakukan perawat untuk mengatasi nya ?

a. Membuatnya berhenti menari b. Menghindari lanugo pada bayi baru lahir malu klien pria c. Mengajarkannya tentang pakaian yang pantas d. Meminimalkan rasa malu klien terhadap perilakunya saat itu Perempuan, 33 tahun masuk 33. rumah sakit untuk ketiga kalinya, dengan diagnosa skizofrenia paranoid. Sudah lama meminum obatnya secara teratur, tetapi dua minggu yang lalu berhenti meminumnya dan mengatakan pada orang tuanya obat adalah racun yang membuat saya sakit.

Kemarin dibawa kerumah sakit setelah teriak – teriak di rumahnya Apakah data pengkajian tambahan yang diperlukan perawat untuk merencanakan perawatannya? a. Efek samping obat yang dirasakan b. Tidak ada yang mengawasi minum obat c. Ungkapan klien tentang kesulitan mengikuti program pengobatan d. Menemukan isi setiap halusinasi yang melarang untuk minum obat Jhon dirawat dengan diagnosa skizofrenia paranoid.

Jhon sangat waspada dan curiga serta sangat sedikit berbicara pada orang sekitarnya. Rambutnya kusut dan badannya bau, dan ia memakai beberapa lapis pakaian tebal walaupun suhu ruangan hangat.

Sampai saat ini jhon menolah makanan atau minuman yang ditawarkan. Ketika perawat mendekati jhon dengan satu dosis obat ia mengatakan” anda ingin saya mati?”Apakah diagnosa keperawatan yang tepat a. Defisit perawatan diri b. Gangguan harga diri rendah c. Koping individu tidak efektif d. Gangguan persepsi sensori halusinasi Seorang perempuan berusia 24 tahun menyukai lingkungan sekitarnya rapi. Pada kenyataannya, ia biasanya sibuk mengatur barang – barang dalam posisi simetris.

Menurut teori Freud, ia memperlihatkan fiksasi pada tahap mana? a. Oral b. Anal c. Genitas d. falik Seorang laki-laki semakin marah. Ia melangkah dengan cepat, hiperventilasi, menegangkan rahangnya, mengemgam tangannya, dan tubuhnya bergetar, berbicara melantur dengan nada suara tinggi, dan tampak preokupasi dengan pikirannya.

Ia memukulkan kepalan tanggannya ke tangan yang lain sambil mondar mandirI. Tentukan tingkat ansietas laki- laki tersebut ? a. Ringan b. Sedang c. Berat d. Panik Imam mengantri dikantin sekolah ketika ia merasa seolah – olah tercekik, frekuensi jantungnya meningkat, mengalami nyeri dada, berkeringat, mual, dan pusing.

Ia berlari meninggalkan kantin dan buku serta tas punggungnya. Ketika anda menemukannya di luar kantin beberapa menit kemudian sudah tampak lebih tenang, tetapi takut terjadi sesuatu dengan jantungnya. Gangguan apa yang mengindikasikan gejala – gejala ini a.

Panik b. Agorafobia c. Ansietas umum 39. 40. 41. A. B. C. D. E. 42. A. B. C. D. E. 43. 44. d. stres pasca trauma Seorang laki- laki berusia 25 tahun baru saja pulang dari tempat kerjanya, lalu segera mandi, ia menyabuni berulang-ulang waslapnya dan menggosok setiap inci tubuhnya dengan kuat. ” saya tidak boleh melewatkan bagian sekecil apapun, saya harus membuang semua kuman ini. Apa pengkajian yang harus dilakukan oleh perawat ?

a. Deskripsi perilaku b. Penilaian terhadai perilakunya c. Upaya yang dilakukan untuk mengatasinya d. Pikiran klien terhadap perilaku yang dilakukan Perawat yang menangani klien selama mengalami kilas balik mengatakan ” saya tahu anda ketakutan, tapi anda berada ditempat yang aman.

Apakah anda melihat telivisi yang ada di ruangan anda?. Apakah anda merasakan makanan yang anda makan? Tehnik apakah yang digunakan perawat a. Distraksi b. Relaksasi c. Grounding d. Orientasi realitas Seorang wanita usia 35 tahun merasa pusing karena sudah dua hari tidak bias tidur karena harus menyelesaikan pekerjaan kantornya. Dari hasil pemeriksaan fisik didapatkan tekanan darah 150 / 90 mmHg. Manakah stadium stress pada pasien tersebut? I II III IV V Seorang anak usia 7 tahun kesal karena dimarahin oleh ibunya, karena kesal ia memukul mukul bonekanya.

Apakah mekanisme ego pada anak tersebut? Displacement Disosiasi Kompensasi Regresi Introyeksi Seorang wanita usia 27 tahun senang pada teman kerja dikantornya, tapi ia memberlakukan temannya dengan kasar. Apakah mekanisme ego pada wanita tersebut? A. Displacement B. Supresi C. Kompensasi D. Introyeksi E. Reaksi Formasi Seorang wanita usia 40 tahun merasa syok dan tidak percaya kalau anaknya sudah meninggal karena kecelakaan. Apakah fase kehilangan pada wanita tersebut?

A. Denial B. Anger C. Bargaining D. Depresion E. Acceptance 45. Seorang wanita berusia 56 tahun klien merasa khawatir dan bingung dengan kondisi fisiknya yang sering sakit sakitan. Manakah masalah utama pada pasien tersebut? A. Ansietas B. Ketidakberdayaan C. Keputusasaan D. Gangguan gambaran diri E. Harga diri rendah situasional 46.

Pasien merasa kesal kepada mahasiswa yang lagi praktek di rumah sakit karena ia lama menunggu mahasiswa tersebut, pasien mengatakan sebelumnya mahasiswa itu membuat kontrak dengan saya katanya mau ketemu jam 10 tapi sekarang sudah jam 12 mahasiswa itu belum datang juga.Manakah pelanggaran prinsif etik yang dilakukan oleh perawat?

A. Justice B. Benificience C. Otonomi D. Fidelity E. Veracity 47. Seorang pria berusia 35 tahun dirawat diruang tenang rumah sakit jiwa, klien mengatakan dirinya merasa malu dan tidak berguna lagi.Manakah konsep diri yang terganggu pada pasien tersebut? A. Gambaran diri B.

Harga diri C. Ideal diri D. Peran diri E. Identitas diri 48. Seorang pria berusia 25 tahun dirawat diruang tenang rumah sakit jiwa, klien tampak menyendiri, tidak respon terhadap lingkungan, apatis, kebersihan diri kurang. Manakah, afek yang dimiliki oleh pasien tersebut? A. Datar B. Tumpul C. Labil D. Ambivalen E.

Tidak sesuai 49. Seorang pria berusia 25 tahun dirawat diruang tenang rumah sakit jiwa, jika pasien marah, pasien dapat mengungkapkan marahnya tanpa menyakiti orang lain. Manakah rentang respon pada pasien tersebut? A. Asertif B. Frustasi C. Pasif D. Agresif E. Amuk 50. Seorang pria berusia 25 tahun dirawat diruang tenang rumah sakit jiwa, klien merasa dirinya seorang dokter dan ketika ada mahasiswa yang mau melakukan pemeriksaan fisik pasien tidak mau, dan pasien tersebut mengatakan saya sehat karena saya ini seorang dokter.

Keluarga mengatakan pasien menjadi seperti itu setelah ia 3 kali mengikuti ujian masuk kedokteran ia tidak diterima. Manakah masalah utama pada pasien tersebut?

A. Waham curiga B. Waham agama C. Waham kebesaran D. Waham nihilistik 51. 52. 53. 54. 55. 56. E. Waham somatic Seorang laki-laki berusia 45 tahun datang ke puskesmas dengan keluhan tidak bisa tidur, sakit lanugo pada bayi baru lahir dan nafsu makan menurun, sejak di PHK dari pekerjaannya.

Pasien mengatakan: “Selama ini saya yang menjadi kepala keluarga dan pencari nafkah, sekarang saya tidak bisa menafkahi keluarga saya”. Apakah pertanyaan yang harus disampaikan oleh perawat untuk mendapatkan data adanya masalah psikososial pada kasus di atas?

a. Apa yang akan Saudara lakukan? b. Sejak kapan Saudara kehilangan pekerjaan? c. Mengapa perusahaan memberhentikan Saudara? d. Sudah berapa lama Saudara bekerja di perusahaan tersebut? e. Bagaimana pandangan Saudara terhadap diri Saudara saat ini ? Seorang perempuan berusia 40 tahun, dirawat di Ruang Obstetri Ginekolog karena mengalami kanker rahim. Pasien merasa sedih dan malu. Pasien mengatakan: “Saya sekarang tidak bisa lagi melayani suami”.

Apakah perubahan konsep diri yang terjadi pada kasus di atas? a. Citra tubuh b. Identitas diri c. Peran d. Ideal diri e.

Harga diri Seorang perawat perempuan berusia 20 tahun sedang melakukan asuhan kepada pasien di Ruang Bedah. Sambil wawancara dengan pasien, tampak perawat menyilangkan kaki dan asyik menggunakan telepon genggamnya.

Apakah aspek yang harus dikembangkan oleh perawat pada kasus di atas? a. Menghadirkan diri secara terapeutik b. Komunikasi verbal dan non verbal c. Dimnensi Tindakan d. Mendengar aktif e. Dimensi respon Seorang perawat perempuan berusia 25 tahun, sedang melakukan asuhan kepada pasien kanker rahim. Pada saat itu, tampak pasien menangis dan mengatakan “Kenapa ini terjadi pada lanugo pada bayi baru lahir Apakah respon yang tepat dilakukan oleh perawat pada kasus di atas?

a. Restating b. Reflecting c. Validation d. Eksploring e. Active listening Seorang laki-laki berusia 35 tahun dirawat di rumah sakit jiwa dengan keluhan marah-marah tanpa sebab yang jelas. Pada saat berinteraksi dengan perawat mengatakan: “Saya tahu, semua orang akan meracuni saya,” Apakah diagnosa keperawatan yang tepat pada kasus di atas?

a. Gangguan proses pikir: waham agama b. Gangguan proses pikir: waham curiga c. Gangguan proses pikir: waham somatik d. Gangguan proses pikir: waham nihilistik e. Gangguan proses pikir: waham kebesaran Seorang perempuan berumur 15 tahun dirawat di ruang rawat luka bakar.

Pasien masuk rumah sakit 3 hari yang lalu karena ledakan kompor. Pasien mengalami luka serius pada bagian wajah dan lengan, dan badan. Saat dikaji tampak murung, kontak mata kurang, pasien mengatakan malu dengan kondisinya, dan saat ini tidak mau dikunjungi teman-temannya. Apakah diagnosa keperawatan pada kasus di atas? 57. 58. 59. 60.

61. a. Krisis b. Kecemasan ringan c. Kecemasan sedang d. Harga diri rendah kronis e. Harga diri rendah situasional Seorang perempuan berumur 28 tahun mengalami depresi berat, Pada saat dilakukan pengkajian didapatkan data pernah menulis pesan yang berisi keinginannya untuk mati. Apakah tindakan keperawatan yang tepat untuk kasus diatas? a. Mendiskusikan cara mengatasi keinginan bunuh diri b. Meningkatkan kemampuan menyelesaikan masalah c. Memberi kesempatan mengungkapkan perasaan d.

Menjauhkan benda yang berbahaya e. Meningkatkan harga diri pasien Suatu keluarga memiliki seorang anak laki-laki berumur 15 tahun. Anak ini sering keluar malam dan bolos sekolah. Orangtua sering menegur dan berselisih paham dengan anak tersebut. Apakah indikasi terapi keluarga untuk kasus di atas? a. Konflik orangtua anak b. Proses transisi dalam keluarga c. Tidak ada kemajuan terapi individu d. Terapi individu yang perlu melibatkan keluarga e.

Konflik perkawinan, sibling konflik, beda generasi Seorang laki-laki berumur 35 tahun tampak berusaha menutup telinganya dan terkadang berbicara sendiri, Tn. A mengatakan “Saya masih mendengar bisikan yang mengatakan kalau saya ini bodoh” Apakah diagnosa keperawatan pada kasus di atas?

a. Gangguan sensori persepsi : halusinasi b. Gangguan proses pikir: waham c. Harga diri rendah kronik d. Resiko bunuh diri e. Isolasi sosial Seorang perempuan berusia 35 tahun sudah lima hari dirawat di Ruang Akut Rumah Sakit Jiwa. Pasien dirawat karena tidak mau makan dan tidak mau bergaul. Saat ini pasien menujukkan perilaku tidak kooperatif dan tatapan mata menyelidik pada saat berinteraksi dengan perawat. Menurut Piaget, kondisi ini disebabkan adanya hambatan/trauma pada salah satu tahap perkembangan.

Apakah teori perkembangan yang dimaksud pada kasus di atas? a. Social b. Cognitive c. Psychosocial d. Interpersonal e. Psychoseksual Seorang laki_laki berusia 43 tahun, dirawat di ruang gaduh gelisah dengan keluhan sering marah-marah dan merusak barang.

Hasil pengkajian pasien berada pada rentang respon maladaftip (agresif), emosi labil, tatapan mata tajam dan sering mondar-mandir, di tangan pasien terdapat luka bekas sayatan. Apakah diagnosis keperawatan yang paling tepat pada pasien di atas? a. Resiko mencederai diri sendiri b. Resiko merusak lingkungan dan orang lain c. Perilaku Kekerasan 62. 63. 64. 65. 66. d. Resiko perilaku kekerasan e. Resiko Bunuh Diri Seorang pria berusia 30 tahun di rawat di ruang akut Rumah Sakit Jiwa, sejak 1 (satu) bulan yang lalu pasien sering mengurung diri, tidak mau beraktifitas dan cenderung menarik diri.

Pada saat pengkajian pasien tampak murung, kontak mata kurang dan kadang terlihat cemas dan panik. Kecemasan pasien ini mengakibatkan pasein tidak dapat mengenali dirinya sendiri. Pasien sedang berada pada rentang respon? a. Aktualisasi Diri b. Konsep Diri Positif c. Harga Diri Rendah d. Kekacauan Identitas e. Depersonlisasi Pasien laki-laki berusia 20 tahun di rawat di rumah sakit jiwa karena lanugo pada bayi baru lahir mengamuk di rumah, setelah bertengkar dengan ayahnya.

Hasil pengkajian didapatkan data muka tampak merah, pandangan mata tajam dan tampak masih bersikap bermusuhan. Perawat telah melakukan strategi tindakan perawatan (SP 1, 2 & 3 ).

Apa tindakan selanjutnya yang harus dilakukan oleh perawat ? a. Melatih pasien mengontrol marah dengan memukul bantal lanugo pada bayi baru lahir. Melatih pasien mengontrol marah dengan meminum obat c. Melatih pasien mengontrol marah dengan spiritual d. Melatih pasien mengontrol marah dengan melakukan aktifitas e. Melatih pasien mengontrol marah dengan latihan nafas dalam Pasien laki-laki berusia 42 tahun di rawat di rumah sakit jiwa karena pasien mengamuk di rumah, setelah bertengkar dengan mantan istrinya.

Hasil pengkajian didapatkan data muka tampak merah, tangan mengepal, pasien mengatakan bahwa dia kesal dan ingin memukul mantan istrinya. Perawat telah melakukan strategi tindakan perawatan 1 (SP1) yaitu mengidentifikasikan penyebab marah, tanda dan gejala marah serta kerugian marah yang dilakukan oleh pasien. Apa tindakan selanjutnya yang harus dilakukan oleh perawat ? A. Melatih pasien mengontrol marah dengan memukul bantal B. Melatih pasien mengontrol marah dengan meminum obat C.

Melatih pasien mengontrol marah dengan spiritual D. Melatih pasien mengontrol marah dengan melakukan aktifitas E. Melatih pasien mengontrol marah dengan latihan nafas dalam Seorang perempuan berusia 20 tahun di bawa ke IGD Rumah Sakit Jiwa. Keluarga pasien mengatakan sudah 2 hari pasien sering diam sendiri di kamar, marah-marah, merusak barang-barang yang ada didekatnya dan sempat mencoba untuk bunuh diri. Manakah tindakan pertama yang harus dilakukan oleh perawat? a. Melatih pasien mengontrol marah dengan cara memukul bantal b.

Melatih pasien mengontrol marah dengan cara menarik napas dalam c. Mengidentifikasi penyebab marah d. Melatih pasien mengontrol marah dengan cara spiritual e.

Melatih pasien mengontrol marah dengan cara minum obat Seorang pria berusia 35 tahun dirawat di lanugo pada bayi baru lahir Akut, pasien datang dengan keluhan sering marah-marah, memukul-mukul tembok dan merusak barang lanugo pada bayi baru lahir ada di sekitarnya. pada saat dilakukan pengkajian tatapan mata pasien tajam, tampak bermusuhan, emosi labil dan selalu memukul tembok jika sedang kesal atau marah. Mekanisme koping yang digunakan oleh pasien adalah? a. Proyeksi b.

Sublimasi c. Represi d. Reaksi Formasi 67. 68. 69. 70. 71. e. Displacement Seorang pria berusia 17 tahun di rawat di ruang akut Lanugo pada bayi baru lahir Sakit Jiwa, sejak 1 (satu) bulan yang lalu pasien sering mengamuk, memecahkan barang yang ada di sekitarnya dan bersikap bermusuhan.

hal ini terjadi karena pasien mengalami kegagalan dalam mencapai keinginannya. Pasien sedang berada pada rentang respon? a. Asertif b. Frustasi c. Pasif d. Agresif e. Amuk Seorang wanita berusia 17 tahun dirawat di ruang akut RSJ, sudah 3 hari keluarga mengatakan pasien sering senyum-senyum sendiri, marah-marah tanpa sebab dan merusak barang-barang yang ada di sekelilingnya. Pada saat pengkajian pasien tampak sedang marah-marah, tatapan mata tajam dan tampak tidak bersahabat.

Pasien tambah mengamuk jika orang lain tidak memperhatikannya. Perilaku pasien termasuk kedalam perilaku? a. Assertiveness b. Perilaku Kekerasan c. Acting Out d.

Lanugo pada bayi baru lahir of Fight e. Perilaku Aktif Seorang perempuan berusia 20 tahun di bawa ke IGD Rumah Sakit Jiwa. Keluarga pasien mengatakan sudah 4 hari pasien sering diam sendiri di kamar, tidak mau makan, diam dengan tatapan mata yang kosong dan mengatakan malu karena tidak bisa menjadi wanita yang sempurna.

Manakah tindakan pertama yang harus dilakukan oleh perawat? a. Identifikasi kemampuan positif yang dimiliki b. Pilih kemampuan kedua yang dapat dilakukan c. Memilih kemampuan ketiga yang dapat dilakuka d. Memasukan kemampuan yang dimiliki ke dalam kegiatan e. Melatih pasien meminum obat Seorang perempuan berusia 20 tahun di bawa ke IGD Rumah Sakit Jiwa. Keluarga pasien mengatakan sudah 4 hari pasien sering diam sendiri di kamar, tidak mau makan dan tidak mau mandi.

Pada saat pengkajian badan pasien lengket, kotor, mulut mau dan rambut acak-acakan. Manakah tindakan pertama yang harus dilakukan oleh perawat? a. Jelaskan pada pasien tentang penting nya berdandan b. Jelaskan pentingnya kebersihan diri c. Identifikasi kebersihan diri, berdandan, makan dan BAB/BAK d.

Latih cara berdandan e. Jelaskan cara dan alat makan yang benar Seorang perempuan berusia 20 tahun di bawa ke IGD Rumah Sakit Jiwa. Keluarga pasien mengatakan sudah 4 hari pasien sering diam sendiri di kamar, tidak mau makan dan tidak mau mandi.

Pada saat pengkajian badan pasien lengket, kotor, mulut mau lanugo pada bayi baru lahir rambut acak-acakan. Perawat telah melakukan strategi tindakan perawatan 1 (SP1) yaitu mengidentifikasi kebersihan diri, berdandan, makan dan BAB/BAK. Apa tindakan selanjutnya yang harus dilakukan oleh perawat ?

a. Jelaskan pada pasien tentang penting nya berdandan b. Jelaskan pentingnya kebersihan diri c. Identifikasi kebersihan diri, berdandan, makan dan BAB/BAK d. Latih cara berdandan e. Jelaskan cara dan alat makan yang benar 72. Seorang laki laki berusia 37 tahun, dirawat diruang Rajawali RSJ Bandung, pernyataan klien pernah mengalami kegagalan diusia 20 tahun saat masuk akademi kepolisian, sejak saat itu klien kurang bersemangat, hasil observasi klien berpakaian rapih, selalu menggunakan separu seragam polisi, sering mondar mandir dan member hormat pada sekitarnya, saat dikaji klien mendominasi pembicaraan dan ia mengatakan bahwa dirinya seorang jendral yang dikatakan berulang – ulang dan klien mudah tersinggung, afek labil.

Apakah tujuan utama tindakan keperawatan pada klien tersebut? a. Pasien dapat berorientasi pada realitas secara bertahap b. Pasien dapat memenuhi kebutuhan dasar c. Pasien mampu berinteraksi dengan orang lain d. Pasien mampu berinteraksi dengan lingkungan e. Pasien menggunakan obat dengan prinsip 5 benar 73. Seorang laki laki berusia 37 tahun, dirawat diruang Rajawali RSJ Bandung, pernyataan klien pernah mengalami kegagalan diusia 20 tahun saat masuk akademi kepolisian, sejak saat itu klien kurang bersemangat, hasil observasi klien berpakaian rapih, selalu menggunakan separu seragam polisi, sering mondar mandir dan member hormat pada sekitarnya, saat dikaji klien mendominasi pembicaraan dan ia mengatakan bahwa dirinya seorang jendral yang dikatakan berulang – ulang dan klien mudah tersinggung, afek labil.

Tindakan keperawatan manakah yang paling tepat pada klien tersebut? a. Tidak mendukung atau membantah wahamnya b. Meyakinkan klien berada dalam keadaan aman c.

Membantu melakukan kemampuan yang dimiliki d. Mendiskusikan tentang obat yang diminum e. Melatih minum obat dengan benar 74. Seorang laki laki berusia 27 tahun, dirawat di ruang Gelatik, hasil pengamatan klien selalu mengatakan bahwa ada orang yang mau membunuhnya, “saya tahu.

seluruh saudara saya ingin menghancurkan hidup saya, karena mereka iri dengan kesukaaan saya”. Saat dikaji klien sering mendominasi pembicaraan dengan isi wahamnya, klien sering menolak untuk makan, saat diklarifkasi… klien mengatakan takut ada racunnya, afek labil, saat diminum obat harus di dampingi perawat karena sering di sembunyikan di bawah lidah. Apakh jenis waham yang paling tepat pada klien tersebut? a. Waham kebesaran b. Waham agama c. Waham curiga d. Waham somatik e.

Waham nihilistik 75. Seorang perempuan berusia 33 tahun, dirawat di ruang Rajawali RSJ Bandung, hasil pengamatan klien sudah mulai tenang dan sudah mampu memenuhi kebutuhan sehari hari secara mandiri, pada saat dikaji klien tampak kooperatif dan menjawab dengan jelas, isi pembicaraan sesuai dengan kenyataan afek sesuai stimulus.

Apa yang harus di satukan perawat dalam membantu orientasi realitas pada kasus disebut? a. Memberikan pujian jika penampilan dan orientasi klien sesuai dengan realitas b. Mengobservasi pengaruh waham pada aktivitas sehari hari c. Meyakinkan klien berada dalam keadaan aman d. Tidak mendukung atau membantah wahamnya e. Melatih klien untuk minum obat 76. Seorang perempuan berusia 33 tahun, dirawat di ruang Rajawali RSJ Bandung, hasil pengamatan klien sudah mulai tenang dan sudah mampu memenuhi kebutuhan sehari hari secara mandiri, pada saat dikaji klien tampak kooperatif dan menjawab dengan jelas, isi pembicaraan sesuai dengan kenyataan afek sesuai stimulus.

Apakah tindakan keperawatan selanjutnya pada kasus tersebut? 77. 78. 79. 80. 81. a. Meningkatkan aktivitas yang dapat memenuhi fisik klien dan emosional b. Membantu melakukan kemampuan yang dimiliki c. Mendiskusi tentang obat yang diminum d. Melatih minum obat yang benar e. Mendiskusikan tentang hobi klien Seorang wanita usia 17 tahun, dirawat diruang Nuri RSJ Bandung, hasil pengamatan klien sudah tampak tenang dan mampu melakukan kebutuhan sehari hari secara mandiri, saat dikaji untuk kebutuhan persiapan pulang klien tersenyum dan mengatakan ingin pulang, karena rindu dengan keluarga dan teman temannya.

Tindakan keperawatan apakah yang paling tepat pada klien tersebut? a. Melatih klien menghardik halusinasi b. Melatih klien bercakap cakap saat halusinasi muncul c. Membantu klien melaksanakan aktivitas terjadwal d. Mengikutsertakan terapi aktivitas kelompok e. Mendiskusikan tentang obat obatan yang harus diminum An. X dibawa ke poliklinik RSJ prov jabar karena ibu klien mengeluh anaknya ketika sekolah tidak mau diam, sering meninggalkan tempat duduk pada waktu mengikuti kegiatan, berlari atau memnjat secara berlebihan dan sering banyak bicara.

Pertanyaan : apakah gangguan yang dialami oleh anak tersebut ? A. Eneuresis fungsional B. Impulsive C. Hiperaktivitas D. In attention E. Obsesif kompulsive Seorang pria dewasa di rawat di ruang intermediate dengan gejala gangguan daya ingat, daya pikir, orientasi, daya tangkap, kemampuan belajar.

Dari hasil observasi klien mengalami regresi di mana perilakunya seperti anak kecil. Pertanyaan : apakah gangguan yang dialami klien? Pilihan jawaban : A. Delirium B. Sindrom ketergantungan C. Dimentia D. Schizoprenia E. Waham Tn. X dirawat di R, elang RSJ prov jabar. Ketika dialkukan komuniasi terapeutik, pasien tidak mampu menilai keadaan yang sesuai dengan kenyataan dan pasien menyadari bhwa dia sakit.

Pertanyaan : apakah penggolongan jiwa yang dialami tn. X berdasarkan tanda adn gejala diatas? A. Gangguan mental organik B. Gangguan mental psikotik C. Gangguan kepribadian D. Gangguan nerotik E. Gangguan suasana Tn Y dirawat di ruang nuri RSJ prov jabar, dari hasil observasi tampak pasien afwk datar tidak wajar (individu tampak dingin dan acuh tak acuh0.

Perilaku yang aneh, eksentrik, atau ganjil, menarik diri pikiran bersifat magic, ide-ide pranoid. Pertantaan ; apakah gangguan yang dialami tn Lanugo pada bayi baru lahir berdasarkan gejala yang muncul ? A. Delirium B. Sindrom ketergantungan C. Schizoprenia D. Dementia E. Shizotifal 82. Ny x dibawa ke RSJ karena mengeluh jika yidur sering mengalami peristuwa episodic abnormal sleep walking dan terror tidur.

Kejadian ini muncul 3 kali dalam seminggu sehingga membuat klien takut tidur. Pertanyaan ; apakah gangguan yang dialami ny x berdasarkan keluhannya ? A. Dyssomnia B. Parasomnia C. Bulimia D. Anoreksia E. Insomnia 83. Ny X dirawat di RSJ. Dari hasil pengamayan klien tanpak hipermotorik, mondar mandir tanpa henti sambil terus berbicara.

Perawat yang menangani klien mengatakan jik aklien sangat mudah emosi dan marah di luar batas kewajaran. Pertanyaan : apakah jenis gangguan yang dialami ny X ? A. Depresi B. Manic C. Perilaku kekerassan D. Waham E. Halusianasi 84. ANn. X berkonsuktasi dengan psikiater di poliklinik RSJ. Klien mengatakan dia tidak perdaya terhadap datangnya episode majan berlebihan dimana makanan dalam jumlah yang besar dimakan dalam waktu singkat, tapi pasien berusaha melawan efek kegemukan.

Klien mengatakan biasanya setelah makan klien meransang untuk muntah dengan memasukkan jari tangannya ke dalam mulut sampai makanan tsb keluar kembali. Apakah gangguan yang dialami nn. X? A. Dissomnia B. Parasomnia C. Bulimia D. Insomnia E. Anoreksia 85. tn XY dibawa ke RSJ karena menurut keluarga klien sellau menghindari aktivitas sosial.

Enggan terlibat dengan rang lain, merasa dirinya tidak mampu. Pertnyaan : apakah gagngguan kepribadain yang dialami tn XY berdasarkan gejala diatas ? A. Paranoid B. Dissosial C. Menghindar D. Dependen E. Independen 86.

Ny X dirawat di RSJ terlihat melakukan cuci tangan sebelum makan. Perawat memperhatikan perilaku klien dan klien sdh melakukan cuci tanagn selama 10 kali tanpa kunjung memakan makanan yang sdh disiapakn oleh perawat. Pertanyaan ; apakah jenis gangguan yang dialami oleh ny X? A. Anxietas fobik B.

Obsesi C. Kompulsif D. Somatoform E. Neurotic 87. An x usia 7 tahun mengalami retardasi mental. Dis ekolah klien dapat belajar berbicara dan dapat dilatih dlam ketrampilan hygiene dasar. Hasil pemeriksan IQ didapat nilai 30. Apakah jenis Retardasi mental yang dialami oleh an. X ? A. Ringan 88. 89. 90. 91. B. Sedang C. Berat D. Sangat berat E. Komplikasi Tn. B berusia 40 tahun dirawat di unit rawat inap psikiatri. Tn. B mengatakan sering mendengar suara-suara yang ingin membunuh dirinya, dan suara itu sangat menakutkan sehingga pasien kesal ingin melempar barang agar suara itu hilang.

Tn. B tampak sering bicara sendiri.Apakah masalah utama pada pasien tersebut? A. Waham B. Isolasi sosial C. Harga diri rendah D. Perilaku kekerasan E. Halusinasi pendengaran An. P laki-laki berusia 15 tahun telah diamputasi kaki kiri 2 hari yang lalu akibat kecelakaan lalu lintas. Hasil observasi didapatkan tampak murung, menangis dan cenderung menyendiri.

An. P mengatakan rasanya ingin mati saja dan tidak berharga lagi. Apakah tindakan keperawatan utama pada pasien di atas? A. Melindungi pasien B. Menggali perasaan pasien C. Mengatasi rasa cemas pasien D. Lanugo pada bayi baru lahir harga diri pasien E.

Menguatkan mekanisme koping pasien Tuan G, berusia 40 tahun, laki-laki, dirawat di rumah sakit jiwa karena di rumah marah-marah dan mengamuk. Saat ini pasien sudah perawatan hari ke delapan dan keluarga sudah tahu cara merawat pasien. Keluarga pasien mengatakan bahwa keluarga sudah mampu memotivasi pasien untuk mengontrol perilaku kekerasannya. Apakah indikator keberhasilan asuhan keperawatan yang dilakukan keluarga pada kasus diatas?

A. Keluarga mampu menangani masalah marah B. Keluarga mampu menangani masalah cemas C. Keluarga mampu menangani masalah riwayat amuk D. Keluarga mampu menangani masalah perilaku kekerasan E. Keluarga mampu menangani masalah koping tidak efektif Ny A perempuan berusia 26 tahun dirawat di rumah sakit jiwa hari ketiga. Ny. A mengatakan “Ibu saya mau meracuni saya karena dia tidak suka dengan calon suami saya.

Pokoknya saya tidak mau makan makanan yang diberikan oleh ibu saya.” Apakah masalah utama pada pasien tersebut? A. Waham curiga B. Waham somatik C. Waham nihilistik D. Waham kebesaran E. Waham penciuman 92. Tn. L laki-laki berusia 27 tahun, pakar ekonomi dirawat di rumah sakit umum dengan stroke. Tn.

L mengalami hemiperase kaki sebelah kanan. Tn. L mengatakan, “Saya sudah tidak mampu, tubuh saya tidak utuh, saya tidak mungkin akan bias bekerja lagi, saya sudah cacat.” Tn.

L selalu lanugo pada bayi baru lahir badan dan tidak mau melihat kaki kanannya. Apakah masalah keperawatan yang utama pada pasien tersebut? A. Gangguan peran B. Harga diri rendah C. Gangguan koping 93. 94. 95. 96. 97. D. Gangguan ideal diri E. Gangguan citra tubuh Tn. W berusia 20 tahun sudah 3 tahun merokok dan mulai mengenal putau 1 tahun karena diajak temantemannya.

Tn. W mengkonsumsi putau meningkat menjadi 4 kali sehari saat ini. Tn. W mengatakan “Suster, saya minta lagi susah nih tidurnya. Mana tulang rasanya pada sakit.” Tn. W tampak gelisah, sering ke kamar mandi, menggigil. Apakah masalah keperawatan utama pada kasus di atas? A. Resiko cedera B. Koping tidak efektif C. Resiko gangguan nutrisi D. Ketidakefektifan lanugo pada bayi baru lahir diri E. Resiko perilaku kekerasan Tn. B laki-laki berusia 49 tahun, dibawa ke rumah sakit jiwa oleh keluarganya 3 hari yang lalu dengan keluhan mengamuk di rumah dan selalu mau memukul orang.

Saat pengkajian, Tn. B mengatakan bahwa dirinya adalah seorang pejabat yang selalu mendampingi presiden dan seorang pejuang yang berpangkat sersan mayor. Tn. B tidak mau berhenti bicara dan komunikasi membanjir. Apakah masalah utama pada pasien tersebut? A. Waham curiga B. Waham somatik C. Lanugo pada bayi baru lahir nihilistik D. Waham kebesaran E. Waham penciuman Ners B menghampiri Tn. K usia 42 tahun yang duduk sendiri di sudut kamar Ruang Melati. Ners B bertanya kepada Tn. K ”Selamat pagi, pak.

Saya melihat bapak duduk sendiri di kamar ini. Apakah yang sedang anda pikirkan saat ini ?” Apakah teknik komunikasi yang dilakukan oleh Ners B pada kasus diatas ? a. Silent b. Empati c. Broad opening d. Open ended question e. Close ended question Ners V sedang berada bersama Tn. L usia 29 tahun di kamar 4 Ruang Jelatik. Tn. L mengatakan ”Mengapa Tuhan hanya membawa Wiwi? Mengapa saya tidak boleh ikut bersama Tuhan? Kamu tahu dimana dia? ” Tn. L tertawa keras kemudian menangis.

Apakah jawaban tepat yang disampaikan oleh Ners V pada kasus diatas ? a. “Anda tertawa tetapi saya merasa bahwa anda sangat sedih.” b. “Saya melihat anda tertawa.

Apakah yang membuat anda tertawa ?” c. ”Anda mengatakan bahwa Wiwi telah meninggal dunia. Siapakah Wiwi ? ” d. ”Saya tidak jelas apa yang anda maksudkan. Dapatkah anda menjelaskan kembali ?” e. “Sebaiknya Anda jangan bersedih. Tuhan menyayangi Wiwi dan Wiwi telah bahagia disana.” Ners V sedang berada bersama Tn. L usia 29 tahun di kamar 4 Ruang Jelatik. Tn. L mengatakan ”Mengapa Tuhan hanya membawa Wiwi?

Mengapa saya tidak boleh ikut bersama Tuhan? Kamu tahu dimana dia? ” Tn. L tertawa keras kemudian menangis. Ners V kemudian berkata “Anda tertawa kemudian menangis.

Apakah anda sangat sedih saat ini ?” Apakah teknik komunikasi yang dilakukan oleh Ners Lanugo pada bayi baru lahir pada kasus diatas ? a. Saran b.

Empati c. Verifikasi d. Klarifikasi e. Close ended 98. Seorang pasien dibawa ke RSJ karena 1 bulan yang lalu bicara tidak nyambung, sering bicara dan tertawa sendiri, serta tidak mau merawat diri.

Gejala tersebut muncul sejak kematian ibunya 6 bulan yang lanugo pada bayi baru lahir. Dari wawancara diketahui bahwa pasien memang pendiam dan jarang menceritakan masalahnya pada orang lain.

Pasien merasa bahwa dirinya tidak memiliki orang lain yang memperhatikannya. Apakah faktor presipitasi yang menyebabkan Ny.D mengalami gangguan jiwa? A. Karakteristik pendiam B. Kurang motivasi dalam merawat diri C. Ny.D sangat dekat dengan ibunya D. Kematian ibu Ny.D E. Tidak memiliki teman dekat 99. Seorang pasien schizophrenia dibawa ke RSJ karena 1 bulan yang lalu bicara tidak nyambung, sering bicara dan tertawa sendiri, serta tidak mau merawat diri.

Gejala tersebut muncul sejak kematian ibunya 6 bulan yang lalu. Dari wawancara diketahui bahwa pasien memang pendiam dan jarang menceritakan masalahnya pada orang lain. Pasien merasa bahwa dirinya tidak memiliki orang lain yang memperhatikannya.

Apakah faktor presipitasi yang menyebabkan Ny.D mengalami gangguan jiwa? A. Karakteristik pendiam B. Kurang motivasi dalam merawat diri C. Pasien merasa sangat dekat dengan ibunya D. Kematian ibu pasien E. Tidak memiliki teman dekat 100. Seorang pasien schizophreniadibawa ke RSJ karena 1 bulan yang lalu bicara tidak nyambung, sering bicara dan tertawa sendiri, serta tidak mau merawat diri.

Saat dikaji klien lebih sering diam, kontak mata terbatas dan sedikit bicara. Berdasarkan kasus di atas diagnosa keperawatan prioritas yang dapat dikelola adalah A. Halusinasi B. Kurang perawatan diri C. Isolasi sosial D. Harga Diri Rendah E. Risiko perilaku kekerasan 101. Seorang perawat lanugo pada bayi baru lahir komunikasi terapeutik kepada pasien schizophrenia.

Pada saat memasuki fase kerja klien kemudiantertawa sendiri, tidak menjawab pertanyaan perawat dan pandangan mata berfokus pada jendela yang ada di sebelah kanan pasien. Setelah kejadian tersebut, apakah yang perlu dilakukan oleh perawat tersebut ? A. Memutuskan kontrak komunikasi terapeutik sepihak B. Melakukan validasi terhadap respon pasien C. Mengganti topik pembicaraan pada klien D. Melakukan teknik komunikasi terapeutik : silence E.

Meminta klien untuk lebih fokus mendengarkan perawat 102. Seorang perawat melakukan komunikasi terapeutik kepada pasien schizophrenia. Perawat tersebut mengajarkan cara mengatasi halusinasi kepada klien.

Saat ditanya, pasien dapat menyebutkan ke-4 cara mengatasi halusinasi tetapi tidak dapat mendemonstrasikan caranya. Pasien juga menyatakan belum pernah mengikuti kegiatan TAK (Terapi Aktivitas Kelompok) tentang halusinasi. Apakah kemungkinan penyebab pasien tidak dapat mendemonstrasikan cara mengatasi halusinasi yang diajarkan oleh perawat ?

A. Perawat tidak pernah mendemonstrasikan cara mengatasi halusinasi yang diajarkan B. Perawat tidak menggunakan teknik komunikasi yang tepat C. Perawat belum pernah mengikutsertakan pasien dalam kegiatan TAK D. Pasien belum percaya kepada perawat E. Pasien memutuskan komunikasi sepihak 103. Seorang pasien dengan diagnosa keperawatan isolasi sosial mendapatkan intervensi SP lanugo pada bayi baru lahir (Strategi Pelaksanaan) oleh seorang perawat. Pada fase terminasi pasien dapat mengulangi keuntungan dan kerugian bersosialisasi, dan dapat mempraktikkan cara berkenalan dengan perawat tersebut.

Kontak mata klien masih kurang, bicara pelan, pasien dapat mengikuti kegiatan bersama pasien lain. Tindak lanjut yang dapat diberikan pada pasien ini adalah… A. Pasien latihan berkenalan dengan perawat B. Pasien mencoba berkenalan dengan pasien lain C. Pasien menghafalkan keuntungan dan kerugian bersosialisasi D. Pasien menceritakan cara berkenalan pada pasien lain E. Pasien mengikuti TAK sosialisasi 104.

Seorang laki-laki 30 tahun diantar orangtuanya datang ke Instalasi Gawat Darurat dengan keluhan selama di rumah klien ngamuk, memukul tetangganya dan bicara sendiri. Kejadian ini sudah terjadi selama 1 minggu yang lalu. Pada saat dikaji pasien mengatakan,”saya masih sangat kesal dengan tetangga saya, karena dia selalu mengejek saya sebagai pengangguran dan hanya beban keluarga saja”.

Pada saat komunikasi tatapan mata terlihat tajam, intonasi bicara tinggi dan ekspresi wajah terlihat tegang. Pasien tampak kotor, dan berusaha menghindari kontak dengan perawat. Apakah diagnosis keperawatan utama pada pasien tersebut ? a. Isolasi Sosial b. Harga diri rendah c. Perilaku Kekerasan d. Kurang Perawatan Diri e. Hallusinasi 105. Seorang pasien, laki-laki berumur 25 tahun dirawat di bangsal rumah sakit jiwa, pasien adalah pindahan dari Instalasi Gawat Darurat satu hari yang lalu.

Pada saat interaksi pertama antara pasien dan perawat, pasien mengatakan saat ini masih marah dengan kakaknya, tatapan mata terlihat tajam, intonasi bicara tinggi dan bicara ekspresi muka terlihat tegang. Pakaian pasien tidak rapi.

Apakah kalimat yang tepat untuk ditanyakan kepada pasien tersebut ? a. Apakah sudah dicoba teknik tarik nafas dalam ? b. Apa yang dirasakan pasien pada saat marah? c. Apakah yang dirasakan pasien pada saat memukul bantal? d. Apakah yang dirasakan pasien pada saat pukul kasur? e. Apakah bapak bisa menolak dengan baik ? 106. Seorang pasien, laki-laki berumur 25 tahun dirawat di bangsal rumah sakit jiwa, pasien adalah pindahan dari Instalasi Gawat Darurat dua hari yang lalu.

Pada saat interaksipasien mengatakan sampai saat ini saya masih marah dengan kakak saya, padahal saya sudah mencoba untuk tarik nafas dalam. Tatapan mata pasien masih terlihat tajam ,dan ekspresi muka terlihat tegang.

Apakah kalimat yang tepat untuk ditanyakan kepada pasien tersebut ? a. Apakah bapak sudah mencoba teknik tarik nafas dalam ? b. Apa yang dirasakan pasien pada saat marah? c. Apakah bapak sudah mencoba dengan teknik memukul bantal dan lanugo pada bayi baru lahir d. Apakah bapak sudah mencoba dengan teknik bedo,a pada Tuhan YME ? e. Apakah bapak bisa menolak dengan baik ?

107. Seorang pasien, perempuan berumur 25 tahun dirawat di bangsal rumah sakit jiwa, pasien adalah pindahan dari Instalasi Gawat Darurat 1 minggu yang lalu. Pada saat interaksipasien mengatakan saat ini rasa marah saya sudah berkurang dengan kakak saya, walaupun rasa kesa masih ada, dan pasien mengatakan bahwa beliau sudah mencoba untuk dapat mengungkapkan dengan baik. Tatapan mata pasien masih terlihat tajam ,dan ekspresi muka terlihat lanugo pada bayi baru lahir.

Apakah kalimat yang tepat untuk ditanyakan kepada pasien tersebut ? a. Apakah bapak sudah mencoba teknik tarik nafas dalam ? b. Apa yang dirasakan pasien pada saat marah? c. Apakah bapak sudah mencoba dengan teknik memukul bantal dan kasur? d. Apakah bapak sudah mencoba dengan teknik bedo,a pada Tuhan YME ?

e. Apakah bapak bisa menolak dengan baik ? 108. Seorang wanita berusia 29 tahun dirawat dirumah sakit jiwa, saat di kaji klien mengatakan sering mendengar suara-suara yang gaduh, klien juga terlihat sering marah-marah tanpa sebab dan menyedengkan telinga ke arah tertentu, apakah kemungkinan masalah yang dialami klien?

Apakah kemungkinan masalah yang dialami klien? A. Gangguan waham B. Gangguan harga diri rendah C. Gangguan waham D. Gangguan defisit perawatan diri E. Gangguan halusinasi 109. Seorang wanita berusia 29 tahun dirawat dirumah sakit jiwa, saat di kaji klien mengatakan sering mendengar suara-suara yang gaduh, klien juga terlihat sering marah-marah tanpa sebab dan menyedengkan telinga ke arah tertentu, apakah kemungkinan masalah yang dialami klien?

Apa tindakan keperawatan perawat untuk masalah klien tersebut? A. Berbicara dalam konteks realitas B. Latih klien mengontrol halusinasi C. Tidak mendukung dan membantah pasien D.

Diskusikan kemampuan realistis yang dimiliki E. Anjurkan melakukan aktivitas sesuai kemampuan yang dimilikinya 110. Seorang pria 30 tahun dirawat dirumah sakit jiwa. Pasien tersebut mengalami halusinasi penglihatan, perawat yang melakukan pengkajian kepadanya menanyakan: Kapan bayang-bayang itu muncul? Jika mungkin jam berapa? Apakah tujuan implementasi yang bisa dirumuskan dari hasil pertanyaan perawat tersebut? A. Menentukan intervensi khusus pada waktu terjadinya halusinasi. B. Menghindari situasi yang menyebabkan munculnya halusinasi.

C. Merencanakan tindakan untuk mencegah terjadinya halusinasi. D. Mengobservasi perilaku pasien saat halusinasi muncul. E. Mengetahui perasaan pasien ketika mengalami halusinasi 111. Saat anda melakukan pengkajian pada pasien dengan gangguan halusinasi, anda menanyakan : “Apa yang Bpk/Ibu rasakan jika suara-suara itu muncul ?

Jika suara-suara itu datang, apa yang Bpk/Ibu lakukan?” Apakah tujuan implementasi yang bisa dirumuskan dari hasil pertanyaan perawat tersebut? A. Menentukan intervensi khusus pada waktu terjadinya halusinasi. B. Menghindari situasi yang menyebabkan munculnya halusinasi. C. Merencanakan tindakan untuk mencegah terjadinya halusinasi.

D. Mengkaji Respons Pasien terhadap Halusinasi E. Mengetahui perasaan pasien ketika mengalami halusinasi. 112. Seorang laki-laki berusia 36 tahun, berjalan mondar-mandir di lorong salah satu ruang perawatan rumah sakit jiwa sambil mengepalkan tangan dan wajahnya tampak memerah, Ia berteriak dan sumpah serapah.Apakah fase siklus agresi yang ditunjukan pasien tersebut?

A. Kemarahan. B. Pemicu. C. Eskalasi. D. Krisis. E. Agresif.

lanugo pada bayi baru lahir

113. Lanugo pada bayi baru lahir pria 29 tahun di rawat di Rumah Sakit Jiwa karena memiliki kecenderungan bertindak agresif, merusak diri sendiri dan dapat mengakhiri kehidupan. Dimana hal tersebut termasuk kedaruratan Psikiatri karena klien berada dalam keadaan stress yang tinggi dan menggunakan koping yang maladaptif.

Apakah masalah yang dialami klien? A. Waham B. Halusinasi C. Resiko Perilaku Kekerasan D. Defisit Perawatan Diri E. Resiko Bunuh Diri 114. Seorang remaja berusia 18 tahun sering merasa tidak dimengerti orang lain, klien sering terlihat menyendiri dikamarnya, klien menolak saat ada teman yang ingin menemaninya dan klien juga sulit mempertahankan hubungan interpersonal. Dari kasus diatas dapat disimpulkan sebagai?

A. Penyebab kenakalan pada remaja B. Penyebab bunuh diri pada remaja C. Penyebab Harga diri rendah D. Penyebab kurang pergaulan E. Penyebab isolasi sosial 115. Rentang respon pada gangguan Waham Reaksi emosi berlebihan atau kurang, ilusi, adanya perilaku aneh atau tidak biasa. Pertanyaan diatas menunjukan rentang respon? A. Pikiran Logis B. Waham C. Gangguan Persepsi D. Distorsi pikiran E.

Menarik diri 116. Seorang wanita 27 tahun dirawat di rumah sakit jiwa, ketika di lakukan pengkajian oleh perawat klien sering mengatakan “Saya menderita penyakit kanker dan sulit untuk disembuhkan”. setelah pemeriksaan laboratorium tidak ditemukan tanda-tanda kanker namun pasien terus mengatakan bahwa ia terserang kankeR.

Dari kasus diatas apa masalah yang dialami klien? A. Waham curiga B. Waham agama C. Waham kebesaran D. Waham nihilistic E. Waham somatik 117. Seorang wanita berusia 45 tahun terlihat sering murung dan bersedih, wanita tersebut juga beberapa kali mengatakan “Tolong jaga anak-anak karena saya akan pergi jauh!” atau “Segala sesuatu akan lebih baik tanpa saya.” Kepada suami nya.

Dari hasil pengkajian diatas merupakan? A. Ancaman bunuh diri B. Percobaan bunuh diri C. Isyarat bunuh diri D. Perilaku bunuh diri E. Rencana bunuh diri 118. Seorang perempuan berusia 55 tahun datang ke RSU dengan keluhan sakit pada daerah payudara, setelah diperiksa didiagnosa kanker payudara stadium tiga. Seminggu kemudian saat dikaji didapatkan data pasien terlihat murung, sudah mau bicara dengan orang lain dan pasien mengatakan pasrah dengan keadaan ini, mungkin ini yang terbaik dari Tuhan.

Apakah tahapan kehilangan ? a. Denial b. Depresi c. Berduka d. Aceptance e. Bargaining 119. Tn. D berusia 50 tahun dirawat di RSJ tiga hari yang lalu, hasil pengkajian didapatkan data sebulan yang lalu burung kesayanganya dicuri.

Sejak kejadian itu setiap melihat burung, pasien mengambilnya dan memukul yang punya burung karena menyangka pencuri burung.

lanugo pada bayi baru lahir

Oleh karena itu keluarga mengurung Tn. D dikamar dan seminggu yang lalu Tn D mengamuk lagi serta teriak-teriak mengatakan melihat banyak burung yang akan menyerangnya. Apakah fase halusinasi yang dialami Tn. D? a. Fase kedua b. Fase ketiga c. Fase kelima d. Fase pertama e. Fase keempat 120.

Seorang perempuan berusia 27 tahun dirawat diRSJ 2 hari yang lalu, saat dikaji pasien mengatakan mendengar suara ibunya memanggil-manggil namanya dan mengajak pergi. Pasien terlihat menyendiri dan tidak lanugo pada bayi baru lahir berhubungan dengan orang lain. Menurut keluarganya pasien mengalami gejala tersebut sudah 1 tahun yang lalu semenjak ibunya meninggal dunia. Apakah masalah keperawatan utama ?

a. Isolasi sosial b. Prilaku kekerasan c. Harga diri rendah d. Halusinasi dengar e. Kurang perawatan diri 121. Seorang laki-laki berusia 25 tahun dirawat di RSJ 5 hari yang lalu, hasil pengkajian didapatkan : pasien tampak mondar-mandir diruangan, expresi wajah tegang, mudah tersinggung, tangan sering mengepal, tatap mata tajam, pasien tidak kooperatif, bicara keras dan cepat, saat ditanya ada suara hati yang menghina membuatnya marah.

Penampilan pasien kotor dan tidak mau bergaul dengan orang lain. Apakah pasien tampak mondar-mandir diruangan, expresi wajah tegang dalam pengkajian? a. Afek b. Penampilan c. Pembicaraan d. Aktivitas motorik e. Interaksi selama wawancara 122. Seorang laki-laki berusia 25 tahun dirawat di RSJ 5 hari yang lalu, hasil pengkajian didapatkan : pasien tampak mondar-mandir diruangan, expresi wajah tegang, mudah tersinggung, tangan sering mengepal, tatap mata tajam, pasien tidak kooperatif, bicara keras dan cepat, saat ditanya ada suara hati yang menghina membuatnya marah.

Penampilan pasien kotor dan tidak mau bergaul dengan orang lain. Apakah pasien mudah tersinggung didokumentasikan dalam pengkajian?

a. Afek b. Penampilan c. Pembicaraan d. Aktivitas motorik e. Interaksi selama wawancara 123. Seorang Laki-laki berusia 45 tahun dirawat di RSJ seminggu yang lalu, hasil pengkajian didapatkan data 3 bulan yang lalu usahanya bangkrut dan istri minta cerai, pasien mengatakan sudah tidak berguna, sudah putus asa karena tidak dapat menafkahi keluarga, pasien terlihat murung, sedih, tidak mau bicara, sering menyendiri dan kontak mata kurang serta penampilannya kotor.

Apakah SP2? a. Melatih kemampuan kedua pasien b. Melatih kemampuan ketiga pasien c. Melatih kemampuan keempat pasien d. Melatih kemampuan pertama pasien e. Mengidentifikasi kemampuan pasien yang positif 124. Seorang laki-laki berusia 25 tahun dirawat diRSJ 5 hari yang lalu, hasil pengkajian didapatkan lanugo pada bayi baru lahir pasien tampak mondar-mandir diruangan, expresi wajah tegang, mudah tersinggung, tangan sering mengepal, tatap mata tajam, pasien tidak kooperatif, bicara keras dan cepat, saat ditanya ada suara hati yang menghina membuatnya marah.

Penampilan pasien kotor dan tidak mau bergaul dengan orang lain. Apakah fase untuk melakukan kontrak pertemuan selanjutnya dengan pasien? a. Fase kerja b. Fase orientasi c. Fase terminasi d. Fase pra interaksi e. Fase post interaksi 125. Seorang laki-laki berusia 25 tahun dirawat diRSJ 5 hari yang lalu, hasil pengkajian didapatkan : pasien tampak mondar-mandir diruangan, expresi wajah tegang, mudah tersinggung, tangan sering mengepal, tatap mata tajam, pasien tidak kooperatif, bicara keras dan cepat, saat ditanya ada suara lanugo pada bayi baru lahir yang menghina membuatnya marah.

Penampilan pasien kotor dan tidak mau bergaul dengan orang lain. Apakah fase membina trust dan kontrak dengan pasien? a. Fase kerja b. Fase orientasi c. Fase terminasi d. Fase pra interaksi e. Fase post interaksi 126. Seorang laki-laki berusia 25 tahun dirawat diRSJ 5 hari yang lalu, hasil pengkajian didapatkan : pasien tampak mondar-mandir diruangan, expresi wajah tegang, mudah tersinggung, tangan sering mengepal, tatap mata tajam, pasien tidak kooperatif, bicara keras dan cepat, saat ditanya ada suara hati yang menghina membuatnya marah.

Penampilan pasien kotor dan tidak mau bergaul dengan orang lain. Apakah TAK ? a. b. c. d. e. TAK persepsi TAK keluarga TAK relaksasi TAK sosialisasi TAK perawatan diri 127. Seorang laki-laki berusia 25 tahun dirawat di RSJ 5 hari yang lalu, hasil pengkajian didapatkan : pasien tampak mondar-mandir diruangan, expresi wajah tegang, mudah tersinggung, tangan sering mengepal, tatap mata tajam, pasien tidak kooperatif, bicara keras dan cepat, saat ditanya ada suara hati yang menghina membuatnya marah.

Penampilan pasien kotor dan tidak mau bergaul dengan orang lain. Apakah fase untuk mengevaluasi pasien? a. Fase kerja b. c. d. e. Fase orientasi Fase terminasi Fase pra interaksi Fase post interaksi 128.

Asuhan keperawatan jiwa pada saat implementasi menggunakan komunikasi terapeutik Apakah fasenya? a. Fase kerja b. Fase orientasi c. Fase terminasi d. Fase pra interaksi e. Fase post interaksi 129. Diagnosa keperawatan jiwa adalah diagnosa tunggal. Apakah artinya? a. Diagnosa utama b. Diagnosa prioritas c.

Diagnosa untuk satu pasien d. Diagnosa yang terdiri dari problem saja e. Diagnosa lanugo pada bayi baru lahir terdiri dari problem etiologi symtom 130. Data yang harus ada dalam merumuskan diagnosa keperawatan.

Apakah termasuk data ? a. Data minor b. Data mayor c. Data primer d. Data tersier e. Data sekunder 131. Masalah keperawatan yang sudah terjadi dan ada data pendukungnya. Apakah termasuk diagnosa ?

a. Diagnosa Resiko b. Diagnosa Aktual c. Diagnosa Banding d. Diagnosa Potensial e. Diagnosa Keperawatan 132. Perawat A sedang lanugo pada bayi baru lahir seorang klien wanita (27 tahun) di diagnosa medis skizofrenia akut. Perawat A bertanya mengenai apa makna suatu kejadian bagi klien tersebut, bagaimana pengaruh kejadian terhadap masa depan serta apakah klien memandang kejadian tersebut secara realistik. Data apakah yang tengah di identifikasi oleh perawat A tersebut?

a. Sistem dukungan dan koping b. Persepsi terhadap kejadian c. Mekanisme koping d. Factor pencetus e. Perilaku Seorang laki-laki 133. Tn. S (41 th) mempunyai tiga orang anak, telah 6 tahun bercerai dengan istrinya. Ketiga orang anaknya sejak bercerai di asuh oleh orang tua Tn.

S. Tiga bulan yang lalu Tn. S. di PHK oleh perusahaan di mana ia bekerja, sejak itu klien sering melamun dan mengurung diri. Klien dibawa ke RS Jiwa dengan alasan marah dan melempar kaca rumah dengan gelas. Riwayat keluarga bahwa ayah klien menderita gangguan jiwa juga dan sekarang sudah meninggal.

Saat dikaji klien tampak tegang dan mata melotot. Apakah faktor predisposisi gangguan jiwa pada Tn S? a. Di PHK b. Mengurung diri c. d. e. Riwayat keluarga gangguan jiwa Melempar kaca rumah dengan gelas Ketiga anaknya di asuh orang tuanyaSeorang laki-laki 134.

Tn. S (41 th) mempunyai tiga orang anak, telah 6 tahun bercerai dengan istrinya. Ketiga orang anaknya sejak bercerai di asuh oleh orang tua Tn. S. Tiga bulan yang lalu Tn. S. di PHK oleh perusahaan di mana ia bekerja, sejak itu klien sering melamun dan mengurung diri. Klien dibawa ke RS Jiwa dengan alasan marah dan melempar kaca rumah dengan gelas.

Riwayat keluarga bahwa ayah klien menderita gangguan jiwa juga dan sekarang sudah meninggal. Saat dikaji klien tampak tegang dan mata melotot. Manakah dari data klien Tn. S sebagai faktor presipitasi? PHK a. Tidak mau bergaul b. Kesal pada keluarganya c.

Perceraian dengan istrinya d. Riwayat keluarga dengan gangguan jiwa 135. Seorang laki-laki Tn. S (41 th) mempunyai tiga orang anak, telah 6 tahun bercerai dengan istrinya. Ketiga orang anaknya sejak bercerai di asuh oleh orang tua Tn. S. Tiga bulan yang lalu Tn. S. di PHK oleh perusahaan di mana ia bekerja, sejak itu klien sering melamun dan mengurung diri. Klien dibawa ke RS Jiwa dengan alasan marah dan melempar kaca rumah dengan gelas. Riwayat keluarga bahwa ayah klien menderita gangguan jiwa juga dan sekarang sudah meninggal.

Saat dikaji klien tampak tegang dan mata melotot. Apakah masalah keperawatan prioritas yang dapat dirumuskan pada Tn S? a. Resiko bunuh diri b.

Harga diri rendah c. Resiko perilaku kekerasan d. Marah yang tidak konstruktif e. Resiko perubahan sensorik persepsi 136. Seorang laki-laki Tn. S (41 th) mempunyai tiga orang anak, telah 6 tahun bercerai dengan istrinya. Ketiga orang anaknya sejak bercerai di asuh oleh orang tua Tn. S. Tiga bulan yang lalu Tn. S. di PHK oleh perusahaan di mana ia bekerja, sejak itu klien sering melamun dan mengurung diri.

Klien dibawa ke RS Jiwa dengan alasan marah dan melempar lanugo pada bayi baru lahir rumah dengan gelas. Riwayat keluarga bahwa ayah klien menderita gangguan jiwa juga dan sekarang sudah meninggal. Saat dikaji klien tampak tegang dan mata melotot. Apakah tindakan keperawatan pripritas yang dianjurkan pada Tn S? a. Berteriak jika marah b. Mengajarkan teknik katarsis c. Mengajarkan teknik relaksasi progresif d.

Menganjurkan bercerita pada orang yang dipercayai e. Secara fisik ajarkan cara memukul bantal atau kasur yang aman 137. Seorang perempuan berusia 30 tahun, hamil 7 bulan anak pertama. Dua hari yang lalu dinyatakan janinnya meninggal dan dokter memutuskan supaya janinnya dikeluarkan.

Klien mengatakan tidak mungkin ini terjadi padanya dan menyalahkan dokter dan perawat yang tidak ahli dalam merawatnya.

Apakah tahapan berduka pada kasus di atas a. Denial b. Anger c. Depresi d. Bargaining e. Acceptance 138. Seorang perempuan berusia 25 tahun, masuk ke rumah sakit jiwa karena tidak mau makan dan minum serta tidak mau mandi. Setelah satu minggu dirawat didapatkan data pasien selalu menyendiri di sudut ruangan, jika makan tidak bergabung dengan pasien lainnya, tampak sering melamun, ketika diajak bicara lebih banyak menunduk.

Saat ditanya alasan tidak bergabung dengan pasien lain, pasien mengatakan tidak suka bicara dengan orang lain karena malas. Apakah prioritas diagnosa keperawatan yang tepat berdasarkan kasus diatas? A. Perubahan sensori persepsi: halusinasi B. Perubahan proses pikir: waham C. Harga diri rendah kronik D.

Defisit perawatan diri E. Isolasi social 139. Seorang perempuan berusia 35 tahun, tampak tertawa sendiri dan melamun. Saat ini mendapatkan terapi dengan obat Clorpromazin 3x100 mg. Setelah mengkonsumsi obat tersebut klien mengatakan kuduknya terasa kaku, dan saat klien di observasi, berjalan seperti robot. Apakah obat yang dapat mengurangi efek samping pada kasus diatas? A. Litium B. Haloperidol C. Serenance D. Triheksilfenidil E. Chlorpromazine 140.

Seorang laki-laki berusia 25 tahun, dirawat di RSJ sejak 1 minggu yang lalu. Ketika perawat melakukan ronde, mendapati klien bicara dan tertawa sendiri tanpa stimulus. Apakah yang harus dilakukan perawat terlebih dahulu pada kasus tersebut? a. Melapor kepada kepala ruangan tentang kondisi pasien b.

Diskusi dengan teman sejawat tentang kondisi klien. c. Mengidentifikasi perilaku pasien yang terjadi d. Melakukan bina hubungan saling percaya e. Mengajak klien melakukan kegiatan 141. Seorang wanita berusia 32 tahun dirawat di RSJ dengan kondisi murung, menyendiri dan kurang kontak mata.

Riwayat minum racun serangga namun tetangga sempat menolong dan klien selamat. Saat diwawancara oleh perawat, klien merasa sedih karena suaminya menikah lagi dan membawa anaknya. Klien selalu mengatakan ingin mati karena malu dan merasa tidak berguna. Apakah tindakan keperawatan yang tepat pada kasus tersebut? a. Mengajak pasien berinteraksi dengan orang lain b. Mendiskusikan tentang penyebab pasien bunuh diri c.

Mengidentifikasi kemampuan dan aspek positif yang dimiliki d. Lanugo pada bayi baru lahir tentang pikiran (ide) bunuh diri dengan pasien e. Menemani pasien terus-menerus sampai dipindahkan ke tempat aman SOAL KEPERAWATAN ANAK 1. Seorang anak lanugo pada bayi baru lahir umur 4 tahundi antar orang tuanya ke UGD karena panas sudah 3 hari dan muntah-muntah.

Hasil pengkajian didapatkan data : pasien tampak lemas, mukosa bibir kering, turgor kulit kurang elastis. Akral dingin, nadi 100 kali permenit, suhu tubuh 38,6°C, pernafasan 28 kali permenit, petikie pada ektremitas .Trombosit 87.000 /mm3Hematokrit 40 %. Manakah rencana tindakan yang utama untuk memperbaiki status cairan pada anak tersebut ? A. Kaji tanda-tanda dehidrasi B. Ukur intake dan out put C.

Beri banyak minum D. Beri antiemetik sesuai terapi E. Lanugo pada bayi baru lahir cairan parenteral sesuai program 2. Seorang anak laki-laki umur 2 tahun di rawat. Menurut ibu klien anaknya sesak dan batuk –batukpanas, rewel.

Hasil pengkajian didapatkan bayi didapatkan sesak, batukretraksi dada, pernafasan 30 kali permenit nadi 100 kali permenit, suhu tubuh 38°C, terdapat ronkhi, terpasang O2 1liter/menit dengan nasal kanul Berapakah konsentrasi oksigen yang di dapatkan? A. B. C. D. E. 24 % 44 % 30% 60% 40% 3. Seorang anak laki-laki umur 4 tahun dirawat dirumah sakit.

Ibu klien mengatakan badan anaknya bengkak sejak 2 bulan. Hasil pemeriksaan fisik : edema pada wajah, abdomen, dan ekstremitas, tekanan darah 140/90 mmHg, nadi 88 x/menit, pernafasan 28 x/menit,suhu 36.8 o C.

Manakah berikut ini yang merupakan penyebab utama timbulnya gejala tersebut di atas ? A. Retensi air dan Natrium B. Lanugo pada bayi baru lahir ADH dan Aldosteron C.

Hipoalbuminemia akibat proteiuria D. Penurunan Tekanan osmotik koloid E. Peningkatan Permeabilitas membran glomerolus 4. Seorang bayi laki-laki berusia 1 bulan dibawa oleh ibunya dengan Labiopalatozkisis dengan keluhan kesulitan menyusu dan berat badan menurun.

Berdasarkan kasus tersebut, diharapkan bayi akan mengkonsumsi nutrisi secara adekuat. Apa tindakan keperawatan prioritas utama yang diberikan untuk mencapai tujuan yang diharapkan? A. Beri diet sesuai usia B. Sendawakan dengan sering C.

Dorong ibu untuk menyusui sesegera mungkin D. Gunakan alat makan khusus E. Pantau berat badan bayi 5. Seorang anak perempuan usia 4 tahun, di rawat dengan diagnosa medis Bronchopneumonia ibu mengatakan anaknya batuk tapi tidak disertai sesak pada saat dilakukan pemeriksaan fisik didapatkan frekwensi pernapasan 30x/menit denyut nadi 100 x/menit temperatur 36 ºC setelah selesai pemeriksaan TTV anak tersebut di rencanakan untuk dilakukan fisioterapi dada yang di awali dariPostural drainage,claping dan vibrating.

Sebelum melaksanakna postural drainage hal pertama yang harus dilakukan oleh perawat adalah?Pilihan Jawaban A. Memberikan air minum hangat B. Mengatur posisi klien C. Mengauskultasi paru D. Memberikan obat ekspektoran E. Melakukan perkusi/klaping 6. Seorang anak laki-laki berumur 1 bulan dengan diare dirawat di rumah sakit.

Ibu klien mengatakan klien buang air sudah 8x, muntah dan tidak mau minum ASI, mata cekung, mukosa bibir kering,berat badan turun,apatis Apakah rencana keperawatan utama pada kasus diatas?

A. Berikan cairan pedialit B. Teruskan pemberian ASI saja C. Berikan cairan RL dan oralit D. Berikan cairan Dekstros dan NaCl E. Berikan diet secara bervariasi 7. Seorang anak laki-laki usia 1 tahun ,Orang tua mengatakan anaknya batuk sejak 14 hari yang lalu, dan kondisi batuknya semakin berat dan sesak nafas,hasil pengkajian pernafasan 60 x/menit, nafas cuping hidung, retraksi dada, ronkhi terdengar di kedua lapangan paru dari terafi yang di berikan oleh doter adalah pemberian nebulizer dengan dosis obat 3x 1 amp ambiven.

Tujuan utama pemberian Nebulizer adalah? a. Mengurangi batuk b. Merangsang pengeluaran sekret c. Mengencerkan sekret d. Mengurangi dahak e. Memberikan rasa nyaman. 8. Seorang anak laki – laki berusia 1 tahun, dirawat dengan keluhan: sesak nafas, panas tinggi dan sering muntah.

Dari hasil wawancara dengan ibu An.S ; sebelumnya anak menderita batuk pilek dan tidak sembuh, tidak mau makan. Hasil pengkajian diperoleh data ; sesak nafas, retraksi dinding dada, ronchi positif pada kedua lapang dada. RR: 54 x/ mt, Suhu Tubuh: 39 o C, HR: 110 x/mt. Hasil Ro: Bronchopneumonia kronik. Apakah masalah keperawatan utama yang dialami An.S ? A. B. C. D. E. Gangguan pola nafas Gangguan nutrisi kurang dari yang dibutuhkan Gangguan pertukaran gas Gangguan keseimbangan cairan Tidak efektifnya bersihan jalan nafas 9.

Seorang Perawat anak mendemontrasikan cara pembuatan larutan oralit pada seorang ibu yang anaknya mengalami diare. Selanjutnya perawat meminta kepada orang tua anak tersebut untuk memberikan cairan oralit kepada anaknya sampai habis Apakah peran perawat anak pada kasus diatas ?

a. Care giver b. Educator c. Advocacy d. Kolaborasi e. Konseling 10. Pada seorang anak usia toddler yang di rawat diruang anak dengan keluhan diare, dilakukanl pengkajian berat badan, hasilnya menunjukkan anak memiliki berat badan 12 kg.

Pada hari rawat ketiga saat dikaji berat badan anak menurun menjadi 11 kg. Apakah derajat dehidrasi yang dialami anak pada kasus diatas ? A. B. C. D. E. Dehidrasi sangan ringan Dehidrasi ringan Dehidrasi sedang Dehidrasi berat Dehidrasi sangat berat 11. Seorang anak laki-laki berusia 4 bulan dibawa orang tuanya ke rumah sakit dan dirawat di Ruang Anak karena mengalami BAB mencret dan muntah terus menerus selama 3 hari. Berdasarkan hasil pemeriksaan diperoleh data lanugo pada bayi baru lahir tampak lemas dan rewel, terdapat kemerahan di sekitar anus, hasil auskultasi bunyi peristaltik usus 15x/menit, perkusi abdomen hipertimpani (kembung), BAB lebih dari 4x dengan konsistensi cair berampas, berat badan anak sebelum BAB mencret 5,3 Kg dan berat badan anak saat BAB mencret 4,9 Kg.

Apa masalah keperawatan utama yang dihadapi oleh anak tersebut? A. Kekurangan kebutuhan nutrisi B. Kelebihan kebutuhan nutrisi C. Kerusakan integritas kulit D. Kekurangan volume cairan dan elektrolit E. Kelebihan volume cairan dan elektrolit 12. Seorang anak perempuan berusia 6 bulan dibawa orang tuanya ke Poli Tumbuh Kembang Rumah Sakit dengan keluhan keterlambatan perkembangan.

Pada pemeriksaan perkembangan dengan menggunakan format DDST (Denver Development Screening Test) II didapatkan keterlambatan pada sektor bahasa dan personal sosial, berat badan 18 kg, tinggi badan 90 cm, serta nafsu makan anak semakin menurun dari hari ke hari.

Apa intervensi keperawatan prioritas yang dilakukan terhadap anak tersebut? A. Beri terapi nutrisi B. Lakukan deteksi dini perkembangan C.

Beri terapi cairan D. Pantau penurunan berat badan E. Beri penkes orang tua tentang perkembangan anak 13. Seorang anak laki-laki berusia 6 tahun dibawa orang tuanya ke rumah sakit dan dirawat di Ruang Anak dengan keluhan sesak napas.

Berdasarkan hasil pemeriksaan diperoleh data tampak pilek, nafsu makan menurun, batuk berdahak dengan sputum berwarna hijau, frekuensi napas 35 x/menit cepat dan dangkal, frekuensi nadi 80 x/menit, tekanan darah 100/70 mmHg, suhu 39oC. Apa masalah keperawatan prioritaspada anak tersebut? A. Ketidakefektifan bersihan jalan napas B. Ketidakefektifan pola pernapasan C. Risiko aspirasi D. Gangguan pertukaran gas E. Ketidakefektifan termoregulasi 14. Seorang anak laki-laki berusia 1 tahun dibawa orang tuanya ke rumah sakit dan dirawat di Ruang Anak dengan keluhan sesak napas.

Lanugo pada bayi baru lahir hasil pemeriksaan diperoleh data tampak batuk dan pilek, wajah tampak kebiruan jika menangis, akral dingin, frekuensi napas 50 x/menit cepat dan dangkal, frekuensi nadi 135 x/menit, suhu 38,5oC, hipertrofi ventrikel kanan dan defek pada septum ventrikel. Apa intervensi keperawatan yang utama dilakukan pada anak tersebut? A.

Batasi aktivitas B. Berikan oksigen C. Cegah anak sering menangis D. Lakukan kompres dingin E. Beri penkes orang tuanya 15. Seorang anak usia 2 tahun datang ke Unit Gawat Darurat RS. A, dengan keluhan buang air besar >10 kali perhari. Saat dilakukan pengkajian terhadap anak tersebut kesadaran compos mentis, terlihat membran mukosa kering, demam, menangis tanpa keluar air mata, serta selalu merasa kehausan.

Intervensi apakah yang dilakukan perawat terhadap anak tersebut kecuali? A. Berikan cairan RL atau NaCl B. Kaji status dehidrasi C. Berikan minum 2-3 liter/hari D.

Kolaborasi dengan dokter untuk pemberian obat antisekresi E. Kolaborasi dengan dokter untuk pemberian obat antipiretik 16. Seorang anak laki-laki berusia 4 tahun dibawa oleh ibunyake Rumah Sakit dan dirawat di ruang anak dengan keluhan sesak napas. Keluhan tersebut di sertai demam tinggi, dan batuk berdahak. Klien tampak gelisah dan menangis. Hasil dari pemeriksaan fisik di temukan bahwa Suhu 38,9 0C, frekuensi napas 44 x/menit, frekuensi nadi 72 x/menit, sianosis pada kulit, terdapat penurunan bunyi napas.

Tindakan apa yang harus dilakukan perawat untuk mengatasi hal tersebut? a. Berikan kompres pada anak dengan air hangat b. Monitor TTV c. Berikan antipiretik d. Pemantauan saturasi oksigen e. Berikan terapi oksigen dan lakukan terapi nebulizer 17. Anak A berusia 5 tahun dengan Berat Badan 15 kg dirawat di ruang Kemuning dengan diagnosa kejang demam.

Pada jam 14.30 wib, ibu anak tersebut berteriak kepada perawat bahwa anaknya kejang kembali. Saat didatangi ke tempat tidurnya, mata anak tersebut membuka lebar mengarah ke atas, dan giginya terkunci rapat.

Apakah tindakan pertama yang harus dilakukan perawat? A. Melonggarkan pakaian dan memiringkan kepala anak B. Memasang oropharingeal airway tube C. Memberikan oksigenasi nasal kanul D. Memberikan suntikan diazepam IV E. Memberikan diazepam per rektal 18. Seorang anak perempuan berusia 6 bulan dibawa orang tuanya ke IGD rumah sakit dengan keluhan lemas. Berdasarkan hasil pemeriksaan diperoleh data mukosa bibir dan mulut kering dan ubun-ubun cekung, tampak rewel dan menangis serta berontak bila disentuh perawat, frekuensi napas 26 x/menit, frekuensi nadi 120 x/menit, suhu 37,5oC, mendapatkan terapi infus Dextrose 5%.

Perawat pelaksana yang menangani anak tersebut melakukan pemasangan infus, tetapi setelah dicoba beberapa kali ternyata gagal. Akhirnya perawat menunda pemasangan infus. Apakah prinsip etik yang diabaikan oleh lanugo pada bayi baru lahir A. Eficence B. Beneficence C. Maleficence D. Justice E. Fear 19. Seorang bayi berusia 6 bulan dibawa ibunya datang ke posyandu. Dari hasil pengkajian, ditemukan data bahwa BB lahir 2800 gr, PB lahir 42 cm, BB saat ini 7300 gr, PB saat ini 63 cm, LK saat ini 37 cm, fontanel anterior belum menutup, dan lingkar dada 35 cm Manakah data yang harus diwaspadai perawat?

A. Fontanel anterior belum menutup B. Lingkar dada 35 cm C. BB 7300 gr D. PB 63 cm E. LK 37 cm 20. Seorang anak perempuan berusia 1 tahun dibawa orang tuanya ke rumah sakit dan dirawat di Ruang Anak dengan keluhan BAB mencret selama 3 hari. Berdasarkan hasil pemeriksaan diperoleh data mukosa bibir dan mulut kering dan ubun-ubun cekung, kulit sekitar perineal memerah, frekuensi napas 26 x/menit, frekuensi nadi 120 x/menit, suhu 39oC. Apa bentuk penyuluhan kesehatan yang sesuai untuk orang tua anak tersebut?

A. Diet TKTP B. Perawatan hygiene anak C. Penanganan hidrasi D. Cara pembuatan oralit Lanugo pada bayi baru lahir. Pencegahan penyakit diare 21. An. M ( 5 thn ) dibawa ke RS dengan keluhan darah keluar dari hidung. Saat dilakukan pemeriksaan fisik didapatkan memar dan kebiruan di lengan atas dan disekitar bawah mulut.

Ibu klien mengatakan 2 minggu yang lalu anaknya sakit panas dan pilek. Hasil pemeriksaan darah menunjukkan : trombosit 80.500/mm³ ; leukosit 8.300/mm³ ; Hb 8,7 gr/dl. Apa masalah keperawatan utama yang terjadi pada An. M ? A. Intoleransi aktivitas B. Gangguan perfusi jaringan C. Resiko perdarahan D. Gangguan nutrisi kurang dari kebutuhan tubuh E.

Resiko tinggi gangguan integritas kulit 22. Klien B, 5 tahun, laki-laki, datangdenganorangtuanyake RS dengankeluhansesaknafas. Orangtuaklienmengatakanklienmulaiterlihatsesaksejakperutdan kaki klienbengkak. Orangtuamengatakan 3 minggu yang lalukliensakitgigidanseringmengorekgiginya.

Saatdiperiksa BB klien 18 kg dari BB sebelumnya 15 kg, TD 160/100 mmHg, RR 40x/menit, HR 110x/menit, CRT < 2 detik, klientampakbengkakdibawahmata, perut, kaki danskrotum.

Saatiniklienmalasmakandanminumsertakadang-kadangmuntah. Padaklientersebut, apa intervensi yang paling tepatdilakukanuntukmengatasimasalahkelebihan volume cairan di interstitial ? A. Anjurkan klien untuk lebih banyak bergerak dan beraktivitas B. Kurangi intake cairan sesuai dengan status edema klien C.

Anjurkan klien untuk mengkonsumsi cairan yang hipotonis D. Berikan diuretic untuk menarik cairan di interstitial E. Berikan albumin sebagai pengganti seluruh kebutuhan cairan pada klien 23. Bayi D lahir premature pada usia 36 minggu. Berat badan bayi D 2 kg. bayi D sudah mulai belajar menuyusui. Bayi D merupakan anak pertama dari ibu A. Penyuluhan kesehatan apa yang harus disampaikan kepada ibu A ? A. Anjurkan ibu untuk menyerahkan perawatan bayinya kepada perawat berpengalaman B. Rekomendasikan ibu untuk menggunakan empeng dor yang lunak, lentur agar bayi dapat menyedot lebih cepat C.

Dorong ibu untuk meneruskan menyusui kepada bayinya, diselingi dengan periode istirahat yang sering D. Jelaskan kepada ibu bahwa bayi memerlukan NGT untuk membantu pemberian makan E. Jelaskan kepada ibu bahwa bayi belum mampu minum susu per oral 24.

Bayi preterm usia 20 hari, berat 1600 gram, dalam incubator secara konsisten kehilangan 30-50 gram selama 2 hari setelah 2 minggu mengalami pertambahan berat badan yang memadai melalui NGT.

Suhu lingkungan dalam incubator meningkat 5o C, sementara suhu aksila bayi berkisar 36,4o-36,5o Lanugo pada bayi baru lahir Bagaimana cara mempertahankan suhu ideal untuk bayi tersebut? A. Gunakan control suhu udara B.

Gunakan kain penutup incubator C. Bungkus bayi dengan selimut katun dalam inkubatur D. Pantau bayi akan adanya kerusakan system saraf E. Pantau bayi akan adanya gangguan termoregulasi 25. An. H berusia 18 bulan, dibawa oleh ibunya ke poli tmbuh kembang RSHS. Sebagai bagian dari pemeriksaan rutin pada umur 18 bulan, perawat melakukan Denver Developmental Screening Test (DDST) kepada An. A. Perawat mendapatkan hasil bahwa fungsi anak tersebut tampaknya pada tingkat perkembangan 15-18 bulan, tetapi ia tidak patuh dan sulit diuji.

Apa yang harus perawat sampaikan kepada ibu berdasarkan hasil pemeriksaan perkembangan An. H? A. Perkembangan sudah lanjut dan mengalami ketegangan pada waktu pengujian B. Perkembangan terlambat dan psikologis terganggu C.

Perkembangan terlambat dan mengalami ketegangan pada waktu pengujian D. Perkembangan normal dan ketidakpatuhan umumnya didapati pada umur ini E. Perkembangan normal tetapi secara psikologis terganggu 26. An. B (8 tahun) dirawat di RS sejak 4 hari yang lalu. An. B tampak lemah, mengeluh nyeri pada bagian abdomen dan sakit kepala, An. B demam tinggi terus menerus, lidah tampak kotor dan kehilangan napsu makan. An. B mengatakan sudah mengalami demam naik turun sejak seminggu sebelum masuk rumah sakit.

Berdasarkan pemeriksaan Widal diperoleh titer O 1/320 ; leukosit : 4200/mm³ ; Eritrosit: 4,2 x 10 ⁶/mm³ ; Trombosit 240.000/mm³. Apa masalah keperawatan yang tidak muncul pada An. B ? A. Gangguan nutrisi kurang dari kebutuhan tubuh B. Gangguan rasa nyaman : peningkatan suhu tubuh (hipertermi) C.

Resiko tinggi defisit volume cairan D. Intoleransi aktivitas E. Resiko tinggi infeksi 27. Bayi A laki-laki berusia 2 hari dibawa ke RS karena mengalami atresia ani. Berdasarkan hasil pemeriksaan diagnostic didapatkan posisi rectum berada dibawah m. puborektalis, lekukan anus dan sfingter eksternal berada di posisi yang normal. Bayi mengalami distensi abdomen dan muntah hijau. Apa tindakan pembedahan segera yang dapat dilakukan pada bayi A untuk memperbaiki kondisi bayi secara umum ?

Lanugo pada bayi baru lahir. Kolostomi B. Post sagital anoplasty C. Ileostomi D. PSARP E. Apendiktomi 28. Anak laki-laki usia 5 tahun, dirawat di RS dengan diagnosis ALL-L3.

Menurut ayah klien, klien sering mengeluh capek, terlihat pucat sejak 3 bulan yang lalu. Saat dikaji klien terlihat apatis. Hasil pemeriksaan fisik klien terdapat hepatomegali, status gizi kurang. Hasil pemeriksaan penunjang menunjukkan Hb 9 gr/dl, Trombosit 100.000/dl dan leukosit 400.000/dl.

Pada klien diatas dengan dapat berisiko terjadi kondisi kegawatan akibat ? A. Leukopenia B. Hiperleukositosis C. Anemia D. Perdarahan otak E. Trombositopenia 29. Seorang ibu prihatin dengan anak laki-lakinya yang berumur 30 bulan, yang kadang-kadang mengulangi kata-kata yang diucapkan kepadanya. Pemeriksaan jasmani dan neurologic lanugo pada bayi baru lahir normal, dan tanda-tanda perkembangan anak dalam batas-batas normal.

Apa kemungkinan perkembangan anak laki-laki tersebut ? A. Perkembangan tingkah laku verbal premature B. Kelainan neurologic yang tidak disadari C. Perkembangan bahasa yang kurang D. Autism infantile E. Perkembangn normal 30. Seorang anak berumur 2 tahun dirawat di rumah sakit. Dalam tiga hari pertama, ibunya berkunjung sewaktu siang hari, dan anak tampak ketakutan dan menangis ketika ibu meninggalkannya.

Dalam 3 hari berikutnya ibunya tidak mengunjunginya, anak menangis dan memanggilnya. Pada hari ketujuk, meskipun ibunya tidak mengunjunginya, anak tampak sangat tenang. Apa yang sebaiknya perawat lakukan terhadap kondisi anak tersebut ? a. Memberitahukan ibu bahwa kunjungannya tampaknya mengganggu anak dan anak akan lebih mneyesuaikan diri jika ibu tidak melihatnya selama beberapa hari b.

Menjelaskan kepada ibu bahwa jika ia tidak dapat tinggal bersama dengan anaknya, maka paling baik baginya untuk tidak mengunjungi anaknya c. Mendorong ibu untuk datang mengunjungi lebih sering dan dalam waktu lebih lama d. Meresepkan obat penenang atau sedative untuk anak e. Meminta ibu untuk mengganti orang yang menemani anak jika tidak bisa datang 31.

Bayi B usia 2 tahun sudah 2 hari dirawat di ruang anak, menurut ibu bayi dibawa ke RS dengan keluhan sulit BAB, ada riwayat sering menggunakan pencahar supaya mudah BAB, BAB keluar sedikit berbentuk pita, sudah 1 minggu belum BAB serta anak sulit makan, pemeriksaan fisik menunjukkan perut kembung dan lubang anus terasa menjepit, berat badan saat ini 4 kg, frekuensi nafas 25x menit, frekuensi nadi 128x/menit.

Apakah implementasi untuk mengatasi masalah prioritas kasus di atas? a. b. c. d. e. Pemasangan nasogastric tube Pemasangan rectal tube Pemberian infus cairan N4 Pemberian nutrisi yang lunak Lakukan pemberian oksigen 32.

Anak S, laki-laki, 10 tahun, datang ke Poliklinik anak dengan riwayat dua hari sebelum masuk RS klien mengeluh sakit kepala disertai panas badan yang tinggi, terdapat perdarahan gusi. Klien dibawa ke balai pengobatan kemudian di anjurkan untuk dirawat di Rumah Sakit.

Hasil pemeriksaan fisik menunjukkan suhu tubuh 38,5⁰C, teraba dingin pada ekstremitas, frekuensi nadi 100x/menit, terapat ptekie pada ektremitas, uji tourniquet positif. Hasil Laboratorium didapatkan hasil sebagai berikut: Hb : 11 gr/dl, Ht : 34 %, L : 9500 /mm3, Tr: 36.000 /mm3. Berapakah derajat DHF yang di alami oleh Anak S tersebut ? a. b. c. d. e. Derajat I Derajat II Lanugo pada bayi baru lahir III Derajat IV Derajat V 33.

Anak A, perempuan, usia 1 tahun dengan BB 8200 gram (BBL 3200 gram). Menurut ibunya BB klien semakin menurun karena kurangnya nafsu makan dan klien sudah lebih dari 3 minggu tampak sesak nafas yang disertai batuk, pilek dan panas. Pada pemeriksaan fisik kulit tampak pucat, nadi 120 kali/menit, respirasi rate 32x/menit, suhu 38,7⁰ C, suara nafas terdengar wheezing dan rochi basah, tampak retraksi interkostal dan epigasrium, terdengar dullness pada area paru, pengembangan paru kurang maksimal, pemeriksaan laboratorium, Hb 11,2 gr%, leukosit 6900/mm3, glukosa sewaktu 128 mg/dl.

Apakah diagnosa keperawatan yang prioritas pada kasus di atas ? a. b. c. d. e. Tidak efektifnya jalan nafas berhubungan dengan akumulasi sekret Gangguan pola nafas berhubungan dengan hipersensitifitas Gangguan pemenuhan nutrisi kurang dari kebutuhan berhubungan dengan anoreksia Gangguan perfusi jaringan berhubungan dengan kurangnya suplai oksigen Gangguan keseimbangan cairan dan elektrolit berhubungan dengan peningkatan suhu tubuh 34.

Bayi M, perempuan, usia 6 bulan, dirawat di rumah sakit dengan keluhan sesak nafas. Dari hasil pemeriksaan fisik diperoleh data: panjang badan 62 cm, berat badan 5,6 kg, frekuensi nadi 140 x/menit, suhu lanugo pada bayi baru lahir 38,40C, frekuensi nafas 60 x/menit, terdengar suara nafas ronchi, saat perkusi terdengar dullness dan klien tampak sianosis. Hasil laboratorium menunjukkan kadar leukosit 21.000/mm3. Apakah masalah keperawatan yang tepat pada kasus di atas ?

A. B. C. D. E. Gangguan oksigenasi berhubungan dengan cyanosis Gangguan transportasi oksigen berhubungan dengan suplai oksigen yang kurang Gangguan pola nafas berhubungan dengan sesak Gangguan bersihan jalan nafas berhubungan dengan akumulasi sekret Gangguan oksigenasi berhubungan dengan akumulasi sekret 35.

Anak S, 8 bulan, perempuan, tertawa melihat gambar mickey mouse yang terpampang di dinding ruang perawatan. Setelah puas memandangi gambar dia kemudian melihat jari-jemari tanggannya sambil mengoceh dan terkadang memasukan salah satu jarinya ke dalam mulut, kemudian perawat mendekatinya dan memberikan mainan gantungan yang berbunyi dan dapat berputar, Anak S tampak menyukainya dan tertawa sambil menggerakan tangan dan kakinya.

Apakah jenis permainan yang diberikan perawat berdasarkan karakteristik sosial pada anak tersebut ? a. Social affective play b. Sense of pleasure play c. Pararel play d. Solitary play e. Assosiative play 36. Anak Y, laki-laki, usia 10 bulan datang ke poli anak dibawa ibunya dengan keluhan anak tampak pucat dan terlihat kurang aktif. Saat dilakukan pengkajian anak tampak lemah, wajah pucat, conjuctiva tampak anemis, kulit berwarna hitam bersisik, muka bulat mongoloid, pada perabaan tampak pembesaran hati dan limfa, pada pemeriksaan CRT lebih dari 3 detik, BB anak 8 kg, Hb 5gr% Ht 22 %Fe 1500 gr/dl.

Apakah diagnosa keperawatan yang prioritas pada kasus di atas ? A. Gangguan rasa nyaman berhubungan dengan pembesaran hati B. Gangguan perfusi jaringan berhubungan dengan penurunan pembentukan eritrosit C. Gangguan body image berhubungan dengan kulit berwarna hitam D.

Gangguan pemenuhan nutrisi berhubungan dengan anoreksia E. Resiko injury berhubungan dengan hemosiderosis 37. Anak A, laki-laki, usia 7 tahun dibawa ibunya datang ke poli anak, menurut ibunya setiap 2 minggu anaknya rutin datang untuk mendapatkan tranfusi, saat dilakukan pengkajian tampak lemah, pucat, anak tidak menghabiskan porsi makan, conjuctiva anemis, kulit berwarna hitam bersisik, muka bulat mongoloid, pada perabaan tampak pembesaran hati dan limfa, pada pemeriksaan CRT lebih dari 3 detik, BB anak 13 kg, Hb 8 gr% Ht 24 %.

Apakah perencanaan pendidikan nutrisi yang tepat pada klien di atas? a. b. c. d. e. Anjurkan ibu untuk membatasi anaknya makan sayuran hijau Anjurkan ibu untuk memberikan multivitamin yang mengandung Fe Anjurkan ibu untuk memberikan anaknya makan tinggi serat Anjurkan ibu untuk memberikan makanan tinggi karbohidrat Anjurkan ibu untuk membatasi pemberian garam 38.

Bayi A, perempuan, usia 7 bulan, digendong ibunya ke poli tumbuh kembang, ibu mengatakan klien sudah mendapatkan imunisasi lengkap dan sekarang dijadwalkan untuk mendapatkan imunisasi selanjutnya. Berat badan anak 10 kg, panjang badan 110 cm, anak tampak aktif dan pada saat pemeriksaan fisik dalam keadaan sehat dan bugar. Apakah jenis imunisasi yang seharusnya sudah didapatkan pada anak tersebut a.

DPT, Polio, MMR b. Hepatitis B, BCG dan Campak c. Hepatitis B, Polio dan MMR d. BCG, DPT, dan Polio e. BCG, Hepatitis B dan Campak 39. Anak S, laki-laki, 12 tahun, datang ke poli anak dengan keluhan sering pusing, dan mudah lemah, saat pengkajian lanugo pada bayi baru lahir conjunctiva anemis, bibir pucat, BB 25 kg, TB 138 cm, Hb 9 gr%. Ibunya bertanya kepada perawat jenis makanan yang sebaiknya diberikan kepada anaknya.

Apakah perencanaan pendidikan nutrisi selain protein yang dibutuhkan oleh anak tersebut ? a. Nutrisi yang mengandung besi, vitamin C dan Calcium b. Nutrisi yang mengandung besi, vitamin B12 dan thiamin c. Nutrisi yang mengandung besi, vitamin A dan Asam Folat d. Nutrisi yang mengandung besi, vitamin B12 dan asam folat e. Nutrisi yang mengandung besi, vitamin E dan Riboflavin 40. Anak F, laki-laki, umur 2,5 tahun, BB 10,5 kg (BB asal sebelum diare 13 kg), mengalami buang air besar (BAB) hampir setiap jam dengan jumlah sekitar setengah sampai 1 gelas ukuran 200ml, konsistensi encer sejak 2 hari yang lalu.

Anak agak susah minum, menurut ibu dari pagi baru masuk teh manis 1 gelas dan air sup 1 mangkuk. Saat dibawa ke ruang gawat darurat RS, anak dalam keadaan somnolen, nadi sulit diraba, mata cekung, turgor jelek, CRT > 3. Apakah analisis masalah pada kasus di atas ? a. Diare tanpa dehidrasi b. Diare dengan lanugo pada bayi baru lahir ringan c. Diare dengan dehidrasi sedang d. Diare dengan dehidrasi berat e. Diare dengan dehidrasi berat disertai Shock 41. Seorang anak laki-laki 6 lanugo pada bayi baru lahir dirawat dengan keluhan langit-langit mulut yang terbuka.

Semenjak lahir klien menderita bibir sumbing dan telah dilakukan operasi di RS 2 hari yang lalu. Namun langit-langit mulut klien belum dilakukan operasi untuk penutupan. Menurut ibunya klien sering sulit menelan. Pada pemeriksaan TTV didapatkan : Nadi 104 x/menit, RR 24 x/menit, Suhu 37,8oc Hb : 9 gr/dL Ht : 28 % Leukosit 10.700/mm3 Apakah masalah prioritas pada kasus di atas : a.

Gangguan pemenuhan nutrisi b. Gangguan rasa nyaman nyeri c. Gangguan perfusi jaringan d. Resiko terjadi infeksi e. Gangguan thermoregulasi 42. Seorang anak perempuan usia 2 tahun dibawa ke poli rumah sakit dengan keluhan lanugo pada bayi baru lahir 2 hari BAB encer. Pada saat dikaji anak tampak lemah, kesadaran lethargik, turgor kulit sangat jelek, saat menangis air mata tidak keluar. Berat badan anak saat sebelum diare 10 kg dan saat dikaji 8,2 kg, frekuensi nafas 25x/menit, freuensi nadi 125x/menit Apakah tingkat dehidrasi pada anak dengan kasus di atas ?

a. Dehidrasi Ringan b. Dehidrasi sedang c. Dehidrasi Berat d. Dehidrasi Isotonis e. Dehidrasi Hipertonis 43. Seorang anak laki-laki usia 8 tahun, berat badan 18 kg, tinggi badan 117 cm.

Sejak lahir orangtua klien mengatakan bahwa klien BAK melalui lubang yang berada di bawah penis, bila klien BAK kencing yang keluar memancar lurus. Riwayat antenatal didapatkan bahwa ibu klien mengatakan saat usia awal kehamilan tidak dapat mengkonsumsi makanan dengan baik. Menurut orangtua klien belum pernah melakukan terapi hormon Apakah data fokus objektif yang diperlukan saat pengkajian pada kasus di atas ?

a. Kebiasaan cara BAK b. Bentuk penis c. Frekuensi BAK d. Warna Air Kencing e. Keberadaan testis 44. Klien perempuan usia 8 tahun keluhan diawali sejak lahir. BAB pertama klien terjadi 2 hari setelah lahir. Klien telah dilakukan colostomy loop, Saat dikaji klien telah 8 hari post colostomy, BAB sedikit-sedikit, banyak gas yang ikut keluar, BAB keras, berwarna kuning, nyeri perut (-), muntah (-), perut teraba distensi dan cembung.

Perawat merencanakan untuk dilakukan wash out untuk mengatasi kesulitan BAB pada klien tersebut. Apakah cairan yang digunakan dalam rencana tindakan tersebut ? a. NaCl 0,9% dingin b. NaCl 0,9% hangat c. Ringer Laktat dingin d. Ringer Laktat hangat e. Air Kran Biasa hangat 45. Anak perempuan usia 3 tahun sudah 2 hari dirawat di ruang anak dengan keluhan sulit BAB, ada riwayat menggunakan pencahar semingggu sekali, perutnya kembung, muntah sudah dua kali sehari, muntah berwarna hijau, pada pemeriksaan lubang anus teraba menjepit, bibir kering, turgor kulit lambat, BB 12 kg, frekuensi nafas 25x menit, frekuensi nadi 128x/menit Apakah rencana tindakan yang tepat untuk mengatasi masalah prioritas kasus di atas?

a. b. c. d. e. Pemasangan nasogastric tube Pemasangan rectal tube Pemberian infus cairan N4 Pemberian nutrisi yang lunak lakukan pemberian oksigen 46.

Anak perempuan usia 14 tahun datang ke poli anak dengan keluhan sering pusing, dan mudah lemah, saat pengkajian ditemukan conjunctiva anemis, bibir pucat dan kering, BB 25 kg, TB 138 cm, HB 9 gr%, Ibunya bertanya kepada perawat jenis makanan yang sebaiknya diberikan kepada anaknya. Apakah perencanaan pendidikan nutrisi selain protein yang dibutuhkan oleh anak tersebut ? a. Nutrisi yang mengandung besi, vitamin C dan Calcium b.

Nutrisi yang mengandung besi, vitamin B12 dan thiamin c. Nutrisi yang mengandung besi, vitamin A dan Asam Folat d. Lanugo pada bayi baru lahir yang mengandung besi, vitamin B12 dan asam folat e. Nutrisi yang mengandung besi, vitamin E dan Riboflavin 47. Anak perempuan usia 1 tahun dengan dibawa ibunya dengan keluhan sesak nafas. Sesak nafas yang disertai batuk, pilek dan panas. Pada pemeriksaan fisik kulit tampak pucat, suara nafas terdengar wheezing (+), rochi (+) tampak retraksi interkostal pada epigasrium, perkusi lanugo pada bayi baru lahir paru terdengar dullness, pergerakan paru kurang maksimal nadi 120 kali/menit, Respirasi rate 32x/menit, suhu 38,7 C,BB 8,2 kg (BBL 3200 gr).

pemeriksaan laboratorium, HB 11,2 gr%, leukosit 6900/mm3, glukosa sewaktu 128 mg/dl Apakah diagnosa keperawatan yang prioritas pada kasus di atas ? a. Tidak efektifnya jalan nafas berhubungan dengan akumulasi sekret b.

Gangguan pola nafas berhubungan dengan hipersensitifitas c. Gangguan pemenuhan nutrisi kurang dari kebutuhan berhubungan dengan anoreksia d. Gangguan perfusi jaringan berhubungan dengan kurangnya suplai oksigen e. Gangguan keseimbangan cairan dan elektrolit berhubungan dengan peningkatan suhu tubuh 48.

Seorang anak laki-laki usia 10 bulan datang ke poli Anak dengan keluhan lemah. Pada saat dikaji klien tampak lemah, pucat, conjuctiva tampak ikterus, kulit berwarna hitam bersisik, muka bulat mongoloid, pada perabaan tampak pembesaran hati dan limfa, pada pemeriksaan CRT lebih dari 3 detik, BB anak 8 kg, HB 5gr% Ht 22 %Fe 1500 gr/dl Apakah diagnosa keperawatan yang prioritas pada kasus di atas ?

A. Gangguan rasa nyaman berhubungan dengan B. Gangguan perfusi jaringan berhubungan dengan anemia C. Gangguan body image berhubungan dengan kulit berwarna hitam D. Gangguan pemenuhan nutrisi berhubungan dengan anoreksia E. Resiko injury berhubungan dengan hemosiderosis 49.

Anak laki-laki usia 7 tahun dibawa ibunya datang ke poli anak,menurut ibunya setiap 2 minggu anaknya rutin datang untuk mendapatkan tranfusi, saat dilakukan pengkajian tampak lemah, pucat anak sulit makan, conjuctiva tampak ikterus, kulit berwarna hitam bersisik, muka bulat mongoloid, pada perabaan tampak pembesaran hati dan limfa, pada pemeriksaan CRT lebih dari 3 detik, BB anak 13 kg, HB 8 gr% Ht 24 % Apakah perencanaan pendidikan nutrisi yang tepat pada klien di atas?

a. Anjurkan ibu untuk membatasi anaknya makan sayuran hijau b Anjurkan ibu untuk memberikan multivitamin yang mengandung Fe c Anjurkan ibu untuk memberikan anaknya makan tinggi serat d Anjurkan ibu untuk memberikan makanan tinggi karbohidrat e.

Anjurkan ibu untuk membatasi pemberian garam 50. Anak perempuan usia 2 bulan dibawa oleh ibunya untuk dilakulan imunisasi, ibu mengatakan anaknya akan dilakukan imunisasi selanjutnya, Hasil pengkajian anak telah diimunisasi Hepatitis B1 dan Polio 1 Apakah jenis imunisasi dasar yang selanjutnya diberikan ?

a. DPT 1, Polio 2, b. Hepatitis B 2, Polio 2 c. Campak, Polio-2 d. Hepatitis B-2, DPT 1 e. DPT 2, Hepatitis B2 51. Seorang bayi laki-laki lahir dengan BB 2 Kg, proporsi kepala Nampak lebih besar daripada badan, kulit tipis transparan, lanugo banyak terutama pada dahi, pelipis, telinga dan lengan, lemak kulit kurang, ekstremitas Nampak kebiruan, genitalia teraba testis belum turun.

Pada pemeriksaan tanda vital diperoleh frekuensi nafas 60 x/menit, frekuensi nadi 100 x/menit, suhu 35,80C Apakah diagnose keperawatan prioritas dari kasus diatas ? a. b. c. d. e. Gangguan keseimbangan suhu tubuh; hypotermi s.d proses adaptasi dengan lingkungan luar rahim Resti kekurangan volume cairan dan elektrolit s.d efek dari inkubator Gangguan pola nafas s.d imaturitas organ pernafasan Inefektifitas jalan nafas s.d penumpukan sekret Infeksi s.d imaturitas imonoglobulin 52.

Seorang anak usia 3 tahun sedang di rawat di RS. Anak nampak ketakutan, terus menangis dan tidak mau ditinggal ibunya. Apakah Intervensi keperawatan yang dapat diberikan untuk mengurangi dampak hospitalisasi pada anak tersebut?

a. b. c. d. e. Memaksimalkan manfaat hospitalisasi Meminimalkan sressor atau penyebab stres. Memberikan permainan sesuai dengan usianya Memberikan dukungan pada anggota keluarga lain Mempersiapkan anak untuk mendapat perawatan di RS 53.

Seorang anak lanugo pada bayi baru lahir berusia 6 tahun datang bersama ibunya ke RS dengan keluhan sejak 2 minggu yang lalu badannya panas menggigil, keluhan disertai pusing, mual, nafsu makan menurun. Pada pemeriksaan fisik diperoleh BB turun hingga 20%, klien tampak pucat, mukosa bibir kering, nyeri ulu hati skala 4, kadang disertai diare, muntah 4x/hr.Pada pemeriksaan tanda vital diperolehSuhu= 380C.

TD= 90/60, frekuensi nadi = 104x/mnt.Hasil Pemeriksaan Diagnostik: Pemeriksaan darah tepi (DDR) plasmodium fositif. Apakah Masalah keperawatan utama yang mungkin muncul? a. b. c. d. e. Gangguan perfusi jaringan otak Deficit cairan dan elektrolit Inefektif jalan nafas Hipotermi Mual 54. Seorang bayi berusia 3 hari datang dengan keluhan dari ibunya kuning. Pada pemeriksaan fisik diperoleh BB 2 Kg, bayi tidak mau menetek, perut tampak buncit.

Pada pemeriksaan tanda-tanda vital diperoleh frekuensi nadi 120 x/menit, frekuensi nafas 50 x/menit, suhu 370. Pada pemeriksaan laboratorium diperoleh kadar bilirubin serum 13 mg%. Apakah tindakan perawat yang harus dilakukan pada pasien diatas? a. b.

c. d. e. Melakukan fototherapy Memberikan therapy cairan Mengobservasi tanda-tanda vital Memasukkan klien ke dalam inkubator Menjaga keseimbangan suhu tubuh klien 55.

Seorang bayi usia 10 hari dibawa oleh ibunya ke RS dengan keluhan kejang-kejang dan tidak dapat menetek. Pada hasil pemeriksaan ditemukan ada trismus pada otot mulut, leher kaku, terjadi opistotonus, kadang terjadi kejang pada otot pernafasan, bayi nampak sianosis. Pemeriksaan tandatanda vital diperoleh suhu 390C, frekuensi pernafasan 65x/menit, frekuensi nadi 100 x/menit. Apakah tindakan pertama yang harus dilakukan perawat untuk mengatasi gangguan fungsi pernafasan pada bayi tersebut?

a. b. c. d. e. Atur posisi bayi dengan kepala ekstensi Berikan oksigen 1-2 liter/menit Observasi tanda-tanda vital setiap setengah jam Bersihkan jalan nafas Pasangkan sudip lidah 56. Bayi A usia 6 hari di rawat di ruang cempaka rumah sakit harapan anak. Saat ini bayi a tidak mau meneteki ke ibunya.

Reflek menghisap kurang. Bayi sering terlihat tidur. Berat badan 1900 gram bilirubin 15 mg/dl Apakah Intervensi keperawatan yang tepat untuk mengatasi masalah nutrisi bayi tersebutt? A. B. C. D. E. Memberikan ASI lewat sendok 10 ml tiap 2 jam Memasang Nasogastric tube. Mengganti ASI dengan susu formula Memberikan dukungan pada ibu untuk terus meneteki Mempersiapkan anak untuk mendapat perawatan di NICU 57.

Anak A 6 tahun datang bersama ibunya ke puskesmas dengan keluhan sejak 3 hari yang lalu anak nya diare BAB 5x/hari, disertai adanya muntah. Pada pemeriksaan fisik diperoleh BB turun hingga 20%, klien tampak pucat dan lemah, mukosa bibir kering,Cubitan kulit perut kembali sangat lambat (≥ 2 detik). Pada pemeriksaan tanda vital diperolehSuhu= 380C.

TD= 90/60 mmHg, frekuensi nadi = 104x/mnt. BB : 20 kg Apakah intervensi keperawatan utama yang harus dilakukan? a. b. c. d. e. Berikan infuse cairan ringer laktat sebanyak 600 ml dalam 1 jam pertama Siapkan rujukan ke rumah sakit terdekat Berikan oksigen 3 l/mnt lewat nasal canule Berikan tablet zinc 20 mg/hari selama 10 hari Berikan lanugo pada bayi baru lahir oralit menggunakan pipa nasogastrik 58.

Seorang bayi berusia 3 hari dirawat di rumah sakit. Ketika perawat mau memandikan keluarga pasien menolak dengan alas an memegang kepercayaan bahwa selama sakit pasien jangan dimandikan sampai benar benar sembuh. Apakah tindakan perawat yang harus dilakukan pada pasien diatas?

a. b. c. d. e. Tidak jadi memandikan pasien dengan alasan menghargai kepercayaan keluarga Memandikan klien dengan alasan menjaga kebersihan di lingkungan rumah sakit Memberikan pendidikan kesehatan tentang personal higiene kepada keluarga pasien Hanya mencuci muka pasien Mengganti baju pasien 59. Seorang anak usia 14 tahun hari dirawat di ruang mawar rs. Harapan anak. Pasca operasi apendictomi hari ke-2. Pasien mengeluh lapar dan haus. Pada hasil pemeriksaan ditemukan Bising usus 6 x/ mnt suhu 37.80C, frekuensi pernafasan 28x/menit, frekuensi nadi 100 x/menit pasien mengaku belum buang angin (flatus) Apakah tindakan pertama yang harus dilakukan perawat terkait keluhan anak tersebut?

a. b. c. d. e. Tetap dipuasakan sampai pasien flatus Berikan bubur saring Berikan minum air putih secara bertahap. Berikan makanan hangat sedikit tapi sering Berikan jus buah lewat sedotan 60. Seorang anak usia 14 tahun telah dirawat di rumah sakit selama 8 hari diagnose typoid.

Pasien saat ini ada rencana pulang Pasien tampak lemas dan dianjurkan bedrest selama di rumah. Ibu Pasien bertanya kepada perawat tentang perawatan di rumah. nutrisi apa yang sebaiknya diberikan terhadap pasien selain bubur saring.

Diagnosa keperawatan yang muncul pada keluarga pasien diatas? a. b. c. d. e. Kesiapan keluarga pasien meningkatkat pengetahuan tentang nutrsi pasien Cemas sehubungan dengan kurang pengetahuan Gangguan komunikasi verbal Gagguan nutrsi kurang dar kebutuhan tubuh Gangguan pola pemenuhan nutrisi.

61. Ibu dari seorang bayi preterm 35 minggu yang sudah lanugo pada bayi baru lahir selama 6 hari. Menyatakan kekahwatiran tentang pemberian asi.

Ia mengatakan bayi mengalami episode apneu sekali sampai dua kali selama menyusui. Bb bayi meningkat 1500-2000 mg tiap hari respirasi : 30 x/menit intervensi keperawatan apa yang akan dilakukan pada ibu diatas? a. b. c. d. Menganjurkan ibu jangan dulu meneteki Menganjurkan ibu untuk memberikan asi lewat dot Menjelaskan kepada ibu bahwa bayi perlu dipasang ngt Dorong ibu untuk terus memberikan makan kepada bayinya dengan periode istirahat dan jeda yang sering e. Memberitahukan kepada ibu bahwa apneu sesuatu yang biasa terjadi untuk bayi preterm 62.

Bayi laki-laki usia 8 bulan dibawa oleh ibunya ke Puskesmas untuk melakukan imunisasi. Pada pemeriksaan didapatkan hasil yaitu berat badan 9 kg, suhu tubuh 36,8ºC, pernafasan 20x/menit, sebelumnya telah mendapatkan imunisasi BCG, DPT I dan Polio 2. Imunisasi apa yang sekarang harus diberikan?

A. B. C. D. E. DPT II Polio II DPT II Polio III DPT II Polio IV DPT III Polio III DPT III Polio IV 63.

Anak perempuan umur 1 tahun, dibawa oleh orangtuanya ke RS karena mengalami pembesaran kepala sejak 1 bulan yang lalu, kemudian perawat melakukan pemeriksaan fisik, didapatkan hasil: lingkar kepala 59 cm, berat badan 8 kg, tinggi badan 72 cm, terdapat sunset sign, belum bisa berjalan, aktifitas fisik hanya di tempat tidur atau digendong oleh orangtuanya.

Apa masalah keperawatan utama pada kasus diatas? A. Gangguan pertumbuhan dan perkembangan B. Gangguan nutrisi kurang dari kebutuhan C. Resiko tinggi gangguan integritas kulit D. Resiko gangguan cairan dan elektrolit E. Kurangnya pengetahuan orangtua 64.

Seorang anak laki-laki yang berusia 11 bulan dibawa oleh ibunya ke Poli Thalasemia dengan keluhan mudah sakit, wajah yang pucat, sklera anemis. Hasil pemeriksaan laboratorium 3 gr/dl, diagnosa medis Thalasemia Apakah implementasi utama yang dilakukan?

A. Memberikan cairan infus B. Memberikan transfusi darah C. Memberikan nutrisi yang adekuat D. Memberikan informasi yang benar E. Memberikan Penyuluhan kesehatan tentang penyakit Thalasemia. 65. Bayi baru lahir akan mengeluarkan tinja pertamanya (mekonium) dalam 24 jam pertama, namun pada bayi yang menderita penyakit Hisprung (akibat dari kelumpuhan usus besar dalam menjalankan fungsinya), maka tinja tidak dapat keluar, lanugo pada bayi baru lahir akan keluar terlambat atau bahkan tidak dapat keluar sama sekali.

Selain itu perut bayi juga akan terlihat menggembung, disertai muntah. Jika dibiarkan lebih lama, berat badan bayi tidak akan bertambah dan akan terjadi gangguan pertumbuhan. Apakah tindakan bedah sementara pada Bayi tesebut ? A. Kolostomi B. Colok dubur C. Atresia ani D. Operasi besar E.

Laparatomi 66. An. C laki-laki, berumur 2 tahun mengalami diare sejak 2 hari yang lalu, dibawa ke rumah sakit dalam kondisi dehidrasi dengan penurunan kesadaran. Apa penyebab utama penurunan kesadaran An.C? A. Hipoperfusi jaringan serebral karena penurunan volume vaskuler B. Penurunan fungsi hemodinamik dan kelelahan jantung C. Penekanan pada pusat vital dan kesadaran di otak D. Mekanisme lanugo pada bayi baru lahir pada kerusakan jaringan ginjal E. Kondisi dehidrasi 67.

Seorang bayi perempuan berusia 8 bulan dibawa ibunya berobat ke poliklinik anak dengan keluhan sejak 2 minggu terakhir bayi BAB 4 – 5 x/hari dengan keluaran sisa makanan yang belum tercerna dengan baik. Ibu bekerja sebagai guru, memberikan asi 1 x sebelum bekerja dan 3 – 4 kali sepulang bekerja.

Sehari-hari bayi diurus oleh neneknya dengan pengaturan makan pemberian bubur susu 3x/hari dan sari jeruk peras 2 x/hari, susu buatan 3x/hari. Apakah anjuran yang paling tepat saudara berikan pada ibu bayi? A. B. C. D. E. Pemberian bubur susu dihentikan Pemberian sari jeruk peras dihentikan Pemberian susu buatan dihentikan Pemberian asi dilanjutkan dengan frekuensi ditambah Pemberian asi dihentikan karena tidak efektif 68.

Seorang ibu sedang cemas melihat bayinya (8 bln) sesak lanugo pada bayi baru lahir nafas bunyi “grok-grok”. Setelah dilakukan pemeriksaan fisik didapatkan : Nadi lanugo pada bayi baru lahir kali/mnt, Suhu 38.5 C, Pernapasan 52 kali/mnt, tampak tarikan dinding lanugo pada bayi baru lahir kedalam dan pernapasan cuping hidung.

Apakah tindakan keperawatan yang utama pada bayi tersebut A. Lakukan physiotherapi dada B. Beri oksigen 2 ltr/mnt C. Posisikan bayi trendelenburg D. Posisikan bayi semi fowler E. Gunakan baju yang tipis dan longgar 69. Seorang bayi laki-laki baru saja lahir di RSU. Kondisi bayi 5 menit setelah lahir lanugo pada bayi baru lahir dilakukan penghisapan lendir adalah badan merah kaki biru, detak jantung 88 x/mnt, menangis lemah, ekstrimitas sedikit fleksi, tonus otot kurang baik dan usaha bernafas lambat/lemah Berapa nilai APGAR Score pada bayi tersebut ?

A. 4 B. 5 C. 6 D. 7 E. 8 70. Seorang anak laki-laki umur 3 th dibawa ke UGD RS dengan keluhan demam. Hasil pengkajian ditemukan anak panas sudah 4 hari yang lalu, badan panas suhu 39,50 c, bibir kering, ada perdarahan hidung, mual muntah, anak tidak mau makan dan minum.

Pengkajian kulit apa yang perlu di kaji pada kasus diatas ? A. Ruam B. Lesi C. Petekhie D. Bula E. Vesikula 71. An.A, usia 2 tahun dibawa orangtuanya ke poliklinik anak, dengan keluhan utama sering BAB 3-4 x sehari, dengan konsistensi cair, dan ada darah berwarna merah marun.

Anak rewel, lesu, suhu tubuhnya 380 C, turgor kulit kembali lambat. Apakah diagnosa medis yang paling tepat pada kasus diatas? A. B. C. D. E. Diare. Disentri. Demam berdarah. Influenza. Dehidrasi. 72. An.F berumur 8 tahun datang ke UGD di bawa oleh orang tuanya,orang tua An F mengatakan bahwa setelah pulang sekolah, an.

F mengatakan sesak nafas dan batuk batuk pada saat d kaji didapatkan riwayat keluarga astma, dan respirasi pada saat itu 32 x/ menit dan terdapat suara wheezing, terdapat penggunaan otot nafas tambahan dan terdapat retraksi intercostal Apakah masalah keperawatan yang tepat pada kasus diatas ?

a. b. c. d. e. Bersihan jalan nafas tidak efektif Kerusakan pertukaran gas resiko aspiksia Intoleransi aktifitas resiko asidosis respiratorik 73. Seorang ibu yang memiliki anak berumur 4 bulan datang ke poliklinik anak, ibu terlihat bingung dan cemas, ibu mengatakan bahwa bayinya sejak kemarin panas, tapi dia tetap datang ke poliklinik karena hari ini adalah jadwal imunisasi DPT dan polio, pada saat di kaji suhu badan An C adalah 40°C Bagaimana respon Saudara menanggapi kasus di atas ?

A. Anjurkan ibu untuk mengimunisasi anaknya setelah demamnya turun dan kolaborasi untuk pemberian Antipiretik B. perawat kolaborasi dengan dokter untuk pemberian antibiotic C. menganjurkan kepada ibu karena anak ibu sedang sakit sekarang, jadi dia tidak boleh mendapatkan imunisasi D. Menganjurkan datang pada jadwal berikutnya dan memberikan doble dosis pada an.F E. Pemberian imunisasi tetap dianjurkan walaupun pasien panas tinggi 74.

Seoarang bayi berusia 8 bulan diantar oleh orang tuanya ke UGD, dengan keluhan orang tuanya mengatakan bahwa sudah dari sehari yang lalu anaknya BAB per hari lebih dari 5 kali dengan konsistensi encer, di sertai muntah dan demam.

Hasil pengkajian menunjukkan terlihat anak sangat lemas dan pucat, membran mukosa kering, turgor kulit jelek, ubun – ubun cekung Apakah masalah keperawatan yang tepat pada kasus diatas ? a. b. c. d. e. gangguan rasa nyaman nyeri kekurangan cairan dan elektrolit gangguan integritas kulit hipertemi perubahan nutrisi kurang dari kebutuhan tubuh 75. Seorang anak laki laki usia 9 tahun datang ke IGD RS diantar ibunya, dengan keluhan mual, muntah dan BAB cair sudah 5 kali dalam sehari, hasil pemeriksaan tanda vital : TD 90/70 mmhg,Suhu 38,5,Nadi 90 x/meit Pernapasan 30x/mnt turgor kulit jelek.

mucosa bibir tampak kering an wajah pucat, mata cekung. Apakah intervensi keperawatan yang tepat pada kasus tersebut ? a. b. c. d. e. Berikan terapi cairan perparentral Kaji tanda-tanda dehedrasi Berikan makan sedikit tapi sering Kaji tanda-tanda vital kolaborasi pemberian obat 76.

Seorang anak usia 4 tahun dirawat ruang Anak, dengan keluhan buang buang air sudah sejak 3 hari yg lalu, Hasil pemeriksaan didapatkan anak mengalami dehidrasi sedang. terpasang infuse RL makro. Advis dokter infuse diberikan selama 24 jam Berapakah jumlah tetesan infus dalam satu menit selama 24 jam ? a. b. c. d. e. 16 tts/mnt 19 tts/mnt 22 tts/mnt 32 tts/mnt 33 tts/mnt 77. Seorang bayi laki-laki berusia 8 bulan dibawa ibunya ke UGD RS dengan keluhan utama BAB cair 4 kali dan muntah 2 kali.

Pemeriksaan fisik : BB 6,5 kg. Suhu : 38,5°C, Nadi : 90x/menit, Respirasi : 30x/menit. Turgor kulit kembali lebih dari 3 detik, bibir agak kering, area perianal kemerah-merahan, perut kembung. Apakah diagnosa keperawatan prioritas pada kasus diatas? A. B. C. D. E. Kerusakan integritas kulit area perianal berhubungan dengan seringnya terpapar feces yang cair.

Hyperthermia berhubungan dengan proses inflamasi; dehidrasi Kekurangan volume cairan berhubungan dengan kehilangan cairan yang aktif; diare Perubahan nutrisi kurang dari kebutuhan tubuh berhubungan dengan anoreksia. Gangguan rasa nyaman berhubungan dengan peningkatan motilitas usus. 78. Seorang anak perempuan usia 10 tahun mengeluh lemas dan cepat lelah. Dari hasil pengkajian terlihat konjungtiva anemis, mukosa bibir pucat, dan hasil pemeriksaan BB 15 kg, HB : 9 gr/dl. Pasien tersebut telah diberikan terapi sulfa ferous 3 mg/hari.

Apakah masalah keperawatan pada pasien di atas? a. b. c. d. e. Resiko terjadi cedera Kebutuhan nutrisi Gangguan psikososial Kurangnya pengetahuan Gangguan rasa aman dan nyaman 79. Seorang anak perempuan berusia 12 tahun dengan BB 26 Lanugo pada bayi baru lahir terkulai lemas di poli thalasemiaperut klien terlihat buncit,kulit pucat kekuning-kuningan, klien tampak murung,tidak kooperatif dan membatasi kontak dengan orang lain.

Apakah prioritas masalah keperawatan yang muncul pada kasus diatas? a. b. c. d. e. Nutrisi kurang dari kebutuhan Gangguan perfusi jaringan Gangguan psikososial Gangguan nyaman nyeri Kurang cairan tubuh 80. Seorang ibu dari anak laki-laki berusia 6 tahun yang menderita penyakit defek jantung kongenital menanyakan pada perawat, mengapa anaknya harus mengambil posisi jongkok saat tampak lelah setelah melakukan aktivitas.

Apa yang dapat perawat jelaskan mengenai hal tersebut? A. B. C. D. Memudahkan aliran lanugo pada bayi baru lahir Mengurangi sakit pada otot kaki Meningkatkan efisiensi kerja jantung Menurunkan aliran volume darah pada ekstremitas E.

Mencegah terjadinya gagal jantung 81. Seorang bayi perempuan berusia 9 bulan dirawat di ruang perawatan intensif dengan distress pernafasan karena bronkhopneumonia. Pengkajian saat ini menunjukkan kesadaran anak apatis, banyak sekret di hidung dan mulut, terdapat retraksi interkosta, terdengar stridor, reflek batuk lemah, akral teraba dingin, suhu 36,8°C, nadi 144x/menit, frekuensi pernapasan 68x/menit, dan tekanan darah 100/70 mmHg.

Apakah masalah keperawatan utama yang dialami anak tersebut ? A. Perfusi jaringan perifer tidak efektif B. Bersihan jalan nafas tidak efektif C. Gangguan pertukaran gas D. Pola nafas tidak efektif E.

Hipotermi 82. Seorang anak laki-laki berusia 24 bulan, datang lanugo pada bayi baru lahir klinik tumbuh kembang, perawat yang mengkaji melihat perkembangan motorik kasar menunjukkan dia sudah dapat mengikuti perintah untuk berdiri dan jongkok, mulai dapat mengungkapkan keinginannya pada orang lain, dan mulai tertarik untuk bermain bersama teman sebayanya.

Hal apa terkait bimbingan antisipasi yang harus dijelaskan pada orangtua? A. Mengenalkan mainan baru lanugo pada bayi baru lahir mengembangkan kemampuan motorik dan sosial B. Mendiskusikan untuk kebutuhan anak untuk dilibakan pada setiap kegiatan C. Menyiapkan orangtua untuk mengantisipasi adanya perubahan perilaku D. Mendiskusikan kesiapan fisik dan psikologis untuk toilet training E. Mempersiapkan kehadiran adik baru 83.

Seorang anak perempuan, berusia 4 tahun, dibawa ke unit gawat darurat, didiagnosis mengalami dengue syok sindrom, pengkajian menunjukkan adanya penurunan kesadaran, tekanan darah 63/39 mmHg, frekuensi pernapasan 61 x/menit, pusing, muntah 5 kali, perut kembung, kelopak mata bengkak, edema palpebra, mukosa bibir kering, sesak, terlihat pernafasan cuping hidung, ada ronkhi, berat badan 16 Kg, saat ini masih dipuasakan. Data prioritas apakah yang harus dikaji untuk melengkapi data diatas?

A. Suhu tubuh menurun B. Nadi teraba kecil dan cepat C. Terjadi retraksi dinding dada D. Cairan lambung berwarna kecoklatan E. Suara napas menurun di salah satu sisi paru 84. Seorang anak laki-laki berusia 8 tahun, di rawat di ruang perawatan anak dengan diagnosa medis nefrotik sindrom, dari pengkajian fisik didapatkan oedema di sekitar wajah terutama palpebra, pembengkakan di abdomen. Perawat lanugo pada bayi baru lahir bertanggung jawab merawat anak tersebut melakukan penghitungan berapa cairan yang diperbolehkan untuk diminum setiap harinya, pengukuran asupan dan haluaran dengan akurat, mengkaji perubahan lingkar perut setiap hari, dan mengobservasi derajat oedema.

Apakah sasaran yang ingin dicapai dari tindakan perawat tersebut? a. Akumulasi cairan pada tubuh pasien tidak terjadi b. Pasien tidak mengalami kehilangan cairan intravaskuler c. Pasien mendapatkan rasa nyaman dan aman d. Kebutuhan nutrisi pasien terpenuhi e.

Pasien terhindar dari rasa nyeri 85. Seorang anak laki-laki berusia 2 tahun dengan diagnosa lanugo pada bayi baru lahir hydrocephlus, 5 hari lanugo pada bayi baru lahir lalu telah menjalani operasi VP shunt, saat ini kondisi tand-tanda vital stabil, VP shunt berfungsi dengan baik, lingkar kepala berkurang 1,5 cm, dan asupan-haluaran seimbang. Anak ini esok hari sudah diperbolehkan pulang dan melanjutkan perawatan di rumah. Pendidikan kesehatan yang paling tepat diberikan pada orangtuanya hari ini adalah A.

B. C. D. E. Cara mengganti balutan VP shunt Bagaimana perkembangan anak saat ini Bagaimana tanda dan gejala jika shunt tidak berfungsi Menerangkan prosedur VP shunt Menerangkan hasil operasi VP shunt 86.

Seorang anak perempuan berusia 3 tahun lahir pada usia kandungan 30 minggu dengan berat lahir 2000 gr, setelah satu minggu di rumah tiba-tiba bayi menolak minum dan selalu dimuntahkan lagi, saat pengkajian fisik ditemukan distensi abdomen dan mekonium yang tercampur dengan darah.

Mengapa bayi prematur berpotensi mengalami masalah seperti bayi dalam kasus diatas ? a. Lapisan lemaknya tipis sehingga memicu kondisi iskemi b. Kemampuan menghisap yang belum baik c. Imaturitas saluran cerna dan imun respon yang rendah d. Volume lambung minimal e. Dampak pemberian susu formula terlalu dini 87. Bayi berusia 5 hari dengan NEC dirawat di ruang NICU, pada pengkajian fisik ditemukan data diameter rongga thoraks meningkat, suara paru redup, hasil laboratorium menunjukkan asidosis respiratori Apa yang menyebabkan adanya perubahan anatomi thoraks pada bayi tersebut?

a. b. c. d. e. Akibat pemberian oksigen tekanan positif Efek samping penggunaan ambubag Karena aspirasi ringan Karena frekuensi nafas meningkat Akibat retraksi interkostal untuk kompensasi 88. Seorang anak laki-laki berusia 6 tahun dibawa oleh ibunya ke rumah sakit dengan keluhan sudah 5 hari mengalami demam, lemah, tidak nafsu makan. Hasil pemeriksaan terdapat papula dan vesikel di sekitar punggung dan dadanya Menurut ciri-ciri yang ada, apa yang dialami oleh anak tersebut ? a. Morbili stdium prodormal b.

Morbili stadium erupsi c. Morbili stadium konvalensi d. Varicella stadium prodormal e. Varicella stadium erupsi 89. Seorang laki-laki berusia 10 hari dengan datang ke bagian IGD suatu rumah sakit dengan keluhan sering muntah saat diberi ASI, kondisi bayi tersebut lemah dan terlihat distensi abdomen. Petugas medis yang memeriksa mencurigai bayi tersebut mengalami nekrosis enterokolitis. Intervensi pertama yang tepat dilakukan untuk kondisi tersebut adalah ?

a. b. c. d. e. Memasang NGT Memasang OGT Menghentikan pemberian ASI Cek gula darah Cek leukosit 90. By A dibawa ke rumah sakit karena ada penonjolan pada ubun-ubunnya. Ubun-ubun belum mengeras dan ukuran kepala yang lebih besar dari ukuran kepala sebayanya.

Dan terdapat benjolan lunak dibagian hidungnya. Ibu bayi A mengatakan bayi A sukar untuk menetek, By A semakin hari semakin rewel dan tangisannya semakin keras ketika digendong. Menurut ibunya By A jarang berganti posisi tidur. Lingkar kepala 60 cm,dahi tampak mengkilat dengan pelebaran vena kulit kepala.

Sunset phenomenon +, letargik, HR 109x/menit, RR 35 x/menit. Berdasarkan kasus di atas, sebagai deteksi dini lanugo pada bayi baru lahir dilakukan pemeriksaan berikut ini a. Pemeriksaan darah b. Pemeriksaan CT Scan c. Pemeriksaan lingkar kepala d. Pemeriksaan teksturkepala e. Pemeriksaan system syaraf cranial 91. By A dibawa ke rumah sakit karena ada penonjolan pada ubun-ubunnya. Ubun-ubun belum mengeras dan ukuran kepala yang lebih besar dari ukuran kepala sebayanya.

Dan terdapat benjolan lunak dibagian hidungnya. Ibu bayi A mengatakan bayi A sukar untuk menetek, By A semakin hari semakin rewel dan tangisannya semakin keras ketika digendong. Menurut ibunya By A jarang berganti posisi tidur. Lingkar kepala 60 cm,dahi tampak mengkilat dengan pelebaran vena kulit kepala. Sunset phenomenon +, letargik, HR 109x/menit, RR 35 x/menit Diagnosa keperawatan yang muncul pada kasus di atas… a.

Resiko tinggi peningkatan tekanan intracranial bd peningkatan jumlah cairan serebrospinal b. Perubahan nutrisi:kurang dari kebutuhan bd inadekutnya asupan nutrisi c.

Immobilitas fisik berhubungan dengan pembesaran kepala d. Nyeri bd peningkatan intrakranial 92. An.X dikaji terdengar suara murmur, sesak apabila sedang beraktivitas, anak mengeluh lelah, anak terlihat pucat, ujung-ujung jari hiperemik masalah keperawatan utama yang muncul, adalah… a. Gangguan perfusi jaringan b. Gangguan aktivitas c. Resiko tinggi gangguan pertumbuhan dan perkembangan d. Resiko tinggi gagal jantung 93. An. X, 16 tahun, datang ke RS dengan keluhan menorraghia, dan sering mengalami perdarahan di hidung dan gusi.selain itu jika terdapat laserasi maka selalu mengalami perdarahan yang cukup lama, fatigue, dan mengeluh sulit untuk konsentrasi, Terdapat melena.

Hasil pemeriksaan fisik terdapat petechie di ekstremitas, terdapat hematom di daerah mulut. Hati, limfa dan getah bening tidak membesar. Hasil lab : trombosit 9.600 per µl, terjadi leukositosis, Hb 12 mg/dl. Masa perdarahan memanjang, masa pembekuan normal, retraksi bekuan abnormal,pro¬thrombin consumption time memendek.

Tes Rumple-Leed positif. Apakah yang menyebabkan melena pada anak X? A. B. C. D. E. Adanya petechie Leukositosis Trombosit 9600 per µl Tes rumple- Lees positif Limfa dan hati membesar 94.

An. X 8 bulan dibawa ibunya ke RS untuk ditransfusi darah, menurut ibunya, an.x sdh 2 bulan ini di transfuse darah.

Program tranfusi darah yang regular ini diberikan karena kadar HB yang cukup rendah, Apakah tujuan dari transfuse darah pada an. X? A. B. C. D. E. Mengganti eritrosit yang pecah Memelihara kadar Hb minimum 9,5-10,5 g/dl Meningkatkan kadar Hb sampai normal 12,5-13 g/dl Mengganti rantai beta pada hemoglobin Menambah sel darah merah yang kurang 95. An. X 13 tahun datang ke RS bersama ayahnya untuk dilakukan transfuse darah, transfuse darah sudah dilakukan sejak berusia 8 bulan.

hasil pemeriksaan fisik : perut buncit, jantung berdebar, dan gambaran EKG aritmia. Gangguan jantung pada kasus diatas disebabkan karena Apakah penyebab gangguan jantung pada an. A. Peningkatan erithropoisis B. Peningkatan kadar besi C. Stimulasi erithropoitin di bone marrow D. Kadar Hb yang cukup rendah E. Adanya virus di dalam darah transfuse 96. Hasil pemeriksaan radiologis pada anak thalasemia didapatkan : medulla yang lebar, korteks yang tipis, trabekulla kasar, hemosiderosis pada kelenjar endokrin, hair-on-end pada tulang kepala.

Hasil pemeriksaan darah terdapat penurunan Hb yang cukup besar. An. X mendapat terapi khelasi dengan disperal. Hasil wawancara ternyata kakeknya mengalami penyakit yang sama. Apakah tujuan diberikan terapi khelasi ? A. Untuk mengurangi infeksi di dalam darah B. Untuk mengurangi peningkatan zat besi C. Untuk meningkatkan produksi hemoglobin D.

Untuk memperbaiki rantai globin yang rusak E. Untuk mengurangi pembesaran pada hati 97. Seorang anak laki-laki berusia 5 tahun penderita TB paru mengalami kesulitan bernafas, hasil pemeriksaan fisik pernafasan : 35 x/menit, auskultasi paru rocnhi di kedua lobus paru.

Apakah prioritas tindakan yang harus dilakukan untuk lanugo pada bayi baru lahir masalah tersebut ? a. Berikan hidrasi b. Lakukan suction c. Lakukan nebulasi d.

Lakukan postural drainase e. Lakukan clapping, vibrasi, dan batuk efektif 98. Seorang bayi laki-laki usia 1 bulan dirawat di ruang anak mengalami diare, hasil pemeriksaan fisik di dapatkan hasil BAB lebih dari 10 kali, konsistensi cair, suhu tubuh : 38oC, bayi tampak lemas, lanugo pada bayi baru lahir tampak cekung Apakah prioritas tindakan keperawatan yang harus dilakukan?

a. b. c. d. e. Berikan diet lunak Berikan terapi cairan Berikan terapi analgetik Berikan terapi antibiotic Berikan terapi antipiretik 99. Seorang anak perempuan usia 10 tahun menderita gizi buruk di rawat di ruang anak rumah sakit umum daerah. Hasil pemeriksaan fisik di dapatkan pernafasn : 30 x/menit, suhu : 38oC, ronchi positif di lobus kanan.

Hasil pemeriksaan laboratorium Hb : 10, hasil biakan sputum positif TB paru. Apakah masalah keperawatan utama pada kasus di atas ? a. Pola nafas tidak efektif b. Peningkatan suhu tubuh c. Perfusi jaringan inefektif d. Bersihan jalan nafas tidak efektif e.

Nutrisi kurang dari kebutuhan tubuh 100. Seorang bayi laki-laki usia 3 bulan belum pernah di imunisasi dengan alasan jika di imunisasi akan menimbulkan sakit dan cacat, ayah bayi tersebut menderita TBC.

saat petugas kesehatan datang kerumah sang ibu sangat cemas dengan memegang erat bayinya dan mengatakan tidak ingin di imunisasi, Saat di berikan pengarahan oleh petugas orangtua mau bayinya di imunisasi.

Apakah tindakan yang harus dilakukan petugas sebelum imunisasi dilakukan? a. Menyiapkan vaksin b. Memberikan vaksin c. Melakukan tes mantuk d. Memberikan penjelasan e. Memberikan pendidikan kesehatan 101. Seorang bayi perempuan berusia 3 bulan sudah waktunya datang ke posyandu untuk di berikan imunisasi, namun orangtua bayi tidak datang ke posyandu, akhirnya para kader mendatangi kediaman orangtua bayi tersebut.

Saat dilakukan wawancara dengan ibu, ibu mengatakan tidak tahu kalau anaknya harus di imunisasi lagi, status imunisasi bayi telah mendapatkan imunisasi BCG, HB 0, POLIO 1, DPT/HB 1 Apakah Diagnosa keperawatan utama yang muncul pada kasus tersebut? a. b. c. d. e. Resiko tertular penyakit berhubungan dengan ketidaklengkapan status imunisasi Kurang pengetahuan orangtua tentang jadwal imunisasi berhubungan dengan kurang terpaparnya informasi Kurang pengetahuan orangtua tentang manfaat imunisasi berhubungan dengan kurang terpaparnya informasi Cemas orangtua berhubungan dengan kurangnya pengetahuan orangtua Ketidaklengkapan status imunisasi berhubungan dengan kurang terpapar dengan informasi 102.

Seorang anak perempuan usia 10 tahun mengalami gangguan pernafasan, pada saat diauskultasi terdapat suara ronchi di kedua paru dan mengalami retensi sekresi dan gangguan oksigenasi yang memerlukan bantuan untuk mengencerkan atau mengeluarkan sekresi. Apakah Intervensi yang tepat dilakukan pada kasus tersebut? a. Suction b. Inhalasi c. Nebulasi d. Batuk efektif e. Fisioterapi dada 103. Seorang bayi usia 3 bulan dirawat di ruang rawat anak dengan diagnose medis hirschprung diseases.

Hasil pemeriksaan diperoleh distensi abdomen, suhu 37,3oC, nadi 110 x/menit dan pernafasan : 42 x/menit. Pasien sering mengalami kesulitan BAB, Dokter menyarankan pasien dioperasi, orang tua menolak karena faktor biaya. Perawat dan Dokter menyerahkan keputusan tindakan pada anak kepada orang tuanya. Apakah bentuk aspek etik yang diperhatikan oleh perawat dan dokter dalam kasus tersebut ?

a. Justice b. Fidelity c. Beneficience d. Non Maleficience e. Respect for Autonomy 104. Seorang Anak Laki-laki berumur 16 tahun dengan diagnose medis Appendiksitis akut perforasi. Pasien post appendiktomy cyto dirawat di ruang rawat anak.

Hasil pemeriksaan pasien bedrest, menolak berubah posisi, pasien mengeluh nyeri pada area luka post operasi seperti ditusuk-tusuk. Tekanan Darah 130/90 mmHg, suhu 38oC, pernafasan 30x/menit dan nadi 116 x/menit. Apakah intervensi utama yang akan anda lakukan untuk kasus tersebut? a. Melakukan kompres hangat b. Mengajarkan latihan mobilisasi post operasi c.

Melakukan kolaborasi pemberian obat penurun panas (antipiretik) d. Melakukan pengelolaan manajemen nyeri non farmakologis dan farmakologis e. Memberikan pendidikan kesehatan pentingnya nutrisi untuk penyembuhan luka operasi 105. Seorang baayi perempuan berumur 4 bulan, dirawat di ruang rawat bedah anak dengan diagnose atresia ani post colostomy 2 bulan yang lalu.

Orang tua mengatakan setelah pernah diajarkan perawatan luka operasi colostomy 2 bulan yang lalu sebelum pulang. Hasil pemeriksaan, stoma terlihat kotor, kulit sekitar stoma berwarna kemerahan, iritasi, timbul fistula, perawatan di rumah menggunakan popoksuhu 37,6oC, RR 31 x/menit nadi 118 x/menit.

Apakah diagnosa keperawatan yang tepat berdasarkan kasus tersebut? a. Resiko infeksi berhubungan dengan kolostomi b. Nyeri berhubungan dengan adanya luka kolostomi c. Hipertermi berhubungan dengan infeksi local kolostomi d. Gangguan intergritas kulit berhubungan dengan perawatan kolostomi e. Deficit knowledge orang tua berhubungan dengan kurangnya paparan informasi 106. Seorang Anak Laki-laki berumur 2 tahun masuk RS 3 hari yang lalu dengan keluhan batuk disertai dahak, suhu 39oC, pernafasan 48 x/menit nadi : 120 x/menit, terdengar ronchi basah, hasil rontgen terdapat area konsolidasi pada jaringan bronchus kiri dan kanan, klien tampak rewel dan sulit untuk didekati.

Apakah prioritas masalah keperawatan yang tepat untuk kasus tersebut? a. Peningkatan suhu berhubungan dengan respon inflamasi b. Kecemasan anak berhubungan dengan dampak hospitalisasi c. Kekurangan volume cairan berhubungan dengan peningkatan suhu tubuh d. Tidak efektif bersihan jalan nafas berhubungan dengan akumulasi sekret e. Kurang pengetahuan orang tua berhubungan dengan kurangnya informasi 107.

Bayi B usia 2 tahun sudah 2 hari dirawat di ruang anak, menurut ibu bayi dibawa ke RS dengan keluhan sulit BAB, ada riwayat sering menggunakan pencahar supaya mudah BAB, BAB keluar sedikit berbentuk pita, sudah 1 minggu belum BAB serta anak sulit makan, pemeriksaan fisik menunjukkan perut kembung dan lubang anus terasa menjepit, berat badan saat ini 4 kg, frekuensi nafas 25x menit, frekuensi nadi 128x/menit.

Apakah implementasi untuk mengatasi masalah prioritas kasus di atas? a. b. c. d. e. Pemasangan rectal tube Pemberian infus cairan N4 Lakukan pemberian oksigen Pemberian nutrisi yang lunak Pemasangan naso gastric tube 108. Seorang bayi perempuan berumur 4 hari dibawa ke Instalasi gawat darurat oleh ibunya dalam keadaan lemah, hasil pemeriksaan fisik BB 2092 gram dan BB lahir 2200 gram, bayi malas minum dan terlihat kuning pada wajah dan matanya, reflek menghisap lemah, nadi : 138 x/menit, pernafasan 44 x/menit, suhu : 36,7oC, lanugo pada bayi baru lahir pemeriksaan laboratorium kadar bilirubin total 16 gr/dl.

Apakah intervensi yang dapat dilakukan untuk menurunkan kadar bilirubin berdasarkan kasus tersebut? a. Pemberian Oksigen b. Pemeriksaan foto rontgen c. Pemberian terapi sinar UV d. Pemberian fototherapi bluelight e. Pemberian cairan dan elektrolit 109. Seorang anak perempuan berusia 3 tahun dibawa orang tuanya ke poliklinik anak. Orang tua mengatakan anaknya batuk berdahak dan muntah saat diberi makan.

Hasil pengkajian didapatkan suhu 38◦C, Frekuensi pernapasan 30 x/menit, Nadi 90 x/menit, terdapat pernapasan cuping hidung dan suara nafas ronchi lanugo pada bayi baru lahir. Apakah masalah keperawatan prioritas pada kasus diatas? a. b. c. d. e. Pola nafas tidak efektif Peningkatan suhu tubuh Gangguan pertukaran gas Perubahan kebutuhan nutrisi Bersihan jalan nafas tidak efektif 110.

Seorang perawat anak yang sedang melakukan observasi di ruang perinatologi mendengar salah satu bayi yang sedang menjalani fototerapi menangis tiba-tiba dengan keras. Setelah di periksa popok bayi bersih dan kering, suhu tubuh bayi normal dan bayi telah diberikan minum sejumlah 60 cc 2 jam yang lalu Apakah tindakan yang tepat yang harus dilakukan perawat pada kasus di atas?

a. b. c. d. e. Melakukan pemeriksaan fisik lengkap (head to toe) Melakukan pemeriksaan kadar lanugo pada bayi baru lahir Membersihkan tali pusat Memberikan minum Memberikan selimut 111. Seorang bayi perempuan usia 6 bulan terlihat aktif dan sehat karena ibu bayi selalu memperhatikan pertumbuhan dan perkembangan bayinya. Saat membawa kontrol bayinya ke poliklinik anak, hasil pemeriksaan perawat didapatkan sebagai berikut : BB meningkat 0,8 kg dari bulan lalu, panjang badan sesuai standard, anak aktif, tetapi terdapat ruam kemerahan di bokong dan lipatan paha bayi Bagaimana komunikasi yang tepat dilakukan oleh perawat kepada ibu tentang kondisi bayinya tersebut?

A. B. C. D. “Wah pertumbuhan bayi ibu sangat bagus ya, tapi kok pinggang dan bokongnya jadi kemerahan begini?” “Apakah ibu tidak pernah memperhatikan kebersihan bokong bayi ibu?” “Wah ibu sangat perhatian dengan kesehatan bayinya, tapi kayaknya ibu salah pake pempers deh” “Wah hebat ya bu, berat badan bayinya naik lagi, tetapi dibagian pinggang dan bokongnya ini kenapa ya bu?” E. “Ibu, jika menggunakan pempers harus diperhatikan kelembabannya. Jangan pake pempers basah dalam waktu yang lama” 112.

Seorang anak usia 13 tahun masuk ruang perawatan karena muntah sebanyak 5 kali dan harus mendapat terapi cairan 360 ml dalam waktu 4 jam. Berapa teteskah yang harus diberikan dalam satu menit?

a. 22 tetes per menit b. 24 tetes per menit c. 26 tetes per menit d. 28 tetes per menit e. 30 tetes per menit 113.

Satu keluarga kehilangan anaknya yang terseret banjir 6 bulan yang lalu. Ibu yang kehilangan anak tersebut tidak mau makan, menangis setiap hari, merasa gagal menyelamatkan anak dan tidak memperhatikan kebersihan diri Apakah fase berduka yang dialami oleh ibu tersebut? a. Denial b. Anger c. Bargaining d. Depresi e. Acceptance 114. Seorang kepala ruangan rawat anak bertugas memimpin kegiatan diskusi kasus setiap minggu diruang yang di pimpinnya.

Dalam setiap diskusi, kepala ruangan selalu memaksakan bahwa pendapat dia yang paling benar karena ia selalu merasa memiliki pendidikan paling tinggi diantara perawat yang ada di ruangan dan tidak mau menerima saran dari perawat lain. Apakah penyebab konflik pada kasus diatas?

a. Perbedaan nilai sikap dan kepercayaan b. Perbedaan kebutuhan dan kepribadian c. Perbedaan tanggungjawab d. Perbedaan persepsi e. Perbedaan status 115. Seorang anak berumur 2 tahun dibawa ke UGD karena paha kiri bengkak, rewel dan menangis kesakitan. Orangtua kelihatan sangat cemas, mengatakan mereka meninggalkan anak dengan pembantu rumah tangga selama 2 hari. Selain nyeri tekan dipaha, pada pemeriksaan sinar X tampak retak pada tibia dextra. Apakah jenis penganiayaan yang terjadi pada anak tersebut?

a. Penganiayaan fisik b. Penganiayaan emosional c. Penelantaran fisik d. Pemukulan e. Kelalaian fisik 116. Seorang anak usia 12 tahun dirawat dengan keluhan lemah, lesu, pucat, tidak nafsu makan, CRT >3 detik, dan cenderung ingin tidur.

Ibu mengatakan bahwa anak seperti ini sejak 1 minggu yang lalu Apakah masalah keperawatan yang utama pada anak diatas? a. b. c. d. Mobilitas Kesadaran Nutrisi Sirkulasi e. Oksigenasi 117. Seorang anak usia 2 tahun dirawat dengan leukemia. Anak tampak pucat dan tidak ada semangat. Hb 8mg/dl dan leukosit 3000. Manakah hal utama dan oksigen yang harus perawat perlukan untuk anak ini?

a. b. c. d. Membatasi pengunjung Menyiapkan ruangan khusus Menggunakan masker Menggunakan baraksot khusus 118. Anak usia 2 tahun, berat badan 7,8 kg, sesak, batuk dan pilek, T=38,5°C, wajah tampak kebiruan saat menangis, akral dingin, P= 135 /menit, R= 50 /menit. Hasil pemeriksaan penunjang menunjukkan hipertropi ventrikel kanan dan defek pada septum lanugo pada bayi baru lahir.

Ibu anak tersebut bertanya: “Mengapa anak saya perlu dibatasi aktifitasnya agar tidak sering menangis?” Apakah jawaban yang tepat untuk pertanyaan tersebut? a. b. c. d. e. Menurunkan ekspansi paru. Meningkatkan metabolisme basal. Menurunkan konsumsi oksigen. Meningkatkan kekuatan otot jantung.

Memberikan emotional support. 119. Seorang anak berusia 6 tahun akan dilakukan operasi perbaikan katup jantung. Kondisi sadar penuh terlihat ceria bersama pengasuhnya dan orangtuanya. Manakah tindakan keperawatan yang harus dilakukan untuk persiapan adaptasi stress sampai dengan rencana operasi anak tersebut?

a. b. c. d. Jelaskan secara lengkap tentang proses operasi melalui gambar. Dorong anak untuk mengekspresikan perasaan kecemasannya pada perawat. Hadirkan saudara kandung dan teman sebaya agar mereka saling berinteraksi.

lanugo pada bayi baru lahir

Jelaskan hal-hal yang berkaitan dengan tindakan operasi melalui teknik bermain. 120. Linda adalah seorang perawat dibangsal anak. Di ruangan ada seorang pasien umur 10 tahun dengan sakit DHF yang dikirim dari UGD. Hal yang pertama kali yang seharusnya dilakukan perawat Linda adalah? a. b. c. d. e. Menentukan masalah klien Menganalisis data Mengevaluasi data Mendiagnosis klien Melakukan pengkajian keperawatan 121.

Nurul datang ke RS untuk memeriksakan adiknya yang berumur 3 tahun. Nurul memberi tahu perawat bahwa adiknya BAB cair 8x/hari sudah 3 hari, tidak mau minum dan lemas. Dari pemeriksaan fisik S=38,5C, HR; 110x/menit. Masalah keperawatan yang muncul adalah: a. b. c. d. e. Pola napas tidak efektif Cemas Diare Kekurang volume cairan Hipertermi 122. Seorang gadis berusia 14 tahun memiliki BMI 18. Gadis tersebut mengeluh tidak bisa makan, mual, dan mengalami konstipasi.

Dari keterangan diatas diagnosa mana yang paling tepat? a. b. c. d. e. Multiple sclerosis Anorexia nervosa Bulimia Sclerosis sistemik Hipotensi 123. Pasien usia 5 tahun datang ke ER dengan keluhan sesak napas, batuk dan demam. Posisi pasien yang paling tepat di tempat tidur adalah… a.

b. c. d. e. Posisi Sim’s Posisi Trendelenderg Posisi dorsal recumben Posisi pronasi Posisi fowler 124. Seorang anak berumur 9 tahun datang ke ER diantar orang tuanya dengan gangguan demam ±4 hari di rumah, mual, muntah, dan diare. Hasil lab platelet: 13.000, ada mimisan 2x dirumah Diagnosa keperawatan yang paling tepat untuk kasus diatas adalah… a. b. c. d. e. Resiko terjadinya perdarahan s/d trombositopenia Shock hypovolemik s/d perdarahan Hipertermi s/d proses infeksi virus dengue Kurangnya pengetahuan keluarga s/d kurangnya informasi Kekurangan volume cairan s/d muntah & diare 125.

An. Iqbal mempunyai diagnosa keperawatan; bersihan jalan napas tidak efektif s/d batuk yang tidak efektif. Tujuan utama manakah yang paling tepat untuk diagnosa diatas?

a. b. c. d. e. Individu tidak mengalami aspirasi Tidak ada spotum Eskpansi dada baik Nyeri berkurang BGA Normal 126. Seorang bayi telah lahir dengan cukup bulan, pervagina, ketuban jernih. Bayi menangis spontan, tonus otot kuat dan bergerak aktif. Bayi dikeringkan dan tali pusat telah dipotong. Manakah tindakan yang tepat yang akan dilakukan selanjutnya? a. b. c. d. e. Letakkan bayi diatas perut ibu. Keringkan vermix bayi.

Bedong bayi dengan gurita. Tempelkan mulut bayi di payudara ibu. Meletakkan bayi di dada ibu, biarkan bayi mencari payudara ibu. 127. Anak perempuan umur 1 tahun, dibawa oleh orangtuanya ke RS karena mengalami pembesaran kepala sejak 1 bulan yang lalu, setelah di lakukan pemeriksaan fisik, didapatkan hasil: lingkar kepala 59 cm, berat badan 6,5 kg, tinggi badan 67 cm, terdapat sunset sign, belum bisa berjalan, aktifitas fisik hanya di tempat tidur atau digendong oleh orangtuanya.

Apakah masalah keperawatan utama pada kasus diatas? a. Gangguan pertumbuhan dan perkembangan b. Gangguan nutrisi kurang dari kebutuhan c.

Resiko tinggi gangguan integritas kulit d. Resiko gangguan cairan dan elektrolit e. Kurangnya pengetahuan orangtua 128. Seorang anak umur 2 tahun dibawa orang tuanya ke poli anak dengan keluhan BAB 4 kali dalam 1 hari, muntah 3 kali dalam satu hari, tidak ada napsu makan dan tidak bisa tidur.

Hasil pengkajian didapatkan suhu 38’ c, turgor jelek, mukosa kering. Apakah masalah keperawatan utama pada kasus tersebut? a. b. c. d. e. Gangguan cairan dan elektrolit Gangguan Nutrisi Gangguan rasan nyaman Gangguan istirahat Gangguan hospitalisasi 129. Seorang ibu sedang cemas melihat bayinya (8 bln) sesak dan nafas bunyi “grok-grok”. Setelah dilakukan pemeriksaan fisik didapatkan : Nadi 92 kali/mnt, Suhu 38.5’C, Pernapasan 52 kali/mnt, tampak tarikan dinding dada kedalam dan pernapasan cuping hidung.

Apakah tindakan kolaboratif yang utama pada bayi tersebut ? a. b. c. d. e. Lakukan physiotherapi dada Beri oksigen 2 ltr/mnt Posisikan bayi trendelenburg Posisikan bayi semi fowler Gunakan baju yang tipis dan longgar 130. Seorang bayi laki-laki baru saja lahir di RSU. Kondisi bayi 5 menit setelah lahir setelah dilakukan penghisapan lendir adalah badan merah kaki biru, detak jantung 88 x/mnt, menangis lemah, ekstrimitas sedikit fleksi, tonus otot kurang baik dan usaha bernafas lambat/lemah.

Berapa nilai APGAR Score pada bayi tersebut ? a. 4 b. 5 c. 6 d. 7 e. 8 131. An.M Umur 1 Tahun, Laki-laki dengan keluhan ± 8 jam sebelum masuk RS klien mengalami panas tinggi di sertai kejang terjadi 1 kali dengan waktu ± 2 menit setelah itu klien muntah dan batuk yang berulang dan di sertai penurunan kesadaran.

keluaraga memutuskan untuk membawa klien ke RSUD kota Bandung hasil TTV suhu 38 ‘c, Hasil lab leukosit 14200 mm3 Apakah diagnosa keperawatan yang utama pada anak tersebut ? a. b. c. d. e. Gangguan termogulasi Resiko gangguan nutrisi Gangguan personal hygiene Gangguan rasa aman Gangguan istirahat 132. An. D di rawat di RSU usia 1 tahun dengan diagnose keperawatan Ganguan pemenuhan kebutuhan nutrisi kurang dari kebutuhan tubuh, dimana dari hasil pemeriksaan fisik Konjungtiva anemis, klien muntah 3 kali, klien makan habis 3 sendok, HB 10,3 gr/dl, Ht 39%, BB sebelum sakit 8,5 kg, BB saat ini 7 kg, BB ideal anak 1 tahun : 10 kg, nafsu makan klien menuru?

Tentukan intervensi apakah yang paling tepat? a. b. c. d. e. Memberikan pendekatan setiap akan melakukan prosedur Anjurkan klien untuk makan dalam porsi kecil tapi sering Observasi TTV Diskusikan dengan orang tua klien cara pencegahan penyakit Diare Diskusikan dengan klien tentang pola makan yang hegiene lanugo pada bayi baru lahir. Diminggu ke-2 bulan Februari 2014 Bayi N usia 6 bulan dibawa ke posyandu oleh ibunya, bayi tersebut rencananya akan diberikan kapsul vitamin A, dari hasil pemeriksaan fisik tidak ada kelainan pada bayi tersebut.

Ada 2 jenis kapul Vitamin A yang perlu diberikan. Kapsul Vitamin A dengan warna apakah yang akan diberikan pada bayi N? a. Merah b. Kuning c. Hijau d. Biru e. Putih 134. Apakah yang anda anjurkan kepada ibu untuk pengobatan pertama yang paling tepat pada anak tersebut? a. Berikan sayuran hangat b. Berikan ASI secukupnya c. Berikan kecap manis atau madu yang dicampur dengan jeruk nipis d. Berikan air tajin e. Berikan asupan nutrisi lebih banyak 135.

Seorang ibu merasa cemas dikarenakan anaknya D berusia 3 bulan akan dioperasi karena tidak bisa BAB selama 6 hari dan menurut dokter ada kelainan pada system pencernaanya, datang seoarang perawat A memberikan penyuluhan dan penjelasan tentang penyakit dan tindakan yang akan dilakukan. Apakah tujuan yang diharapkan dari tindakan yang dilakukan oleh perawat A?

a. b. c. d. e. Ibu anak D membatalkan tindakan operasi karena semakin cemas Ibu anak D merasa tidak cemas lagi, mengerti dengan penyakit dan tindakan yang harus dilakukan serta menyerahkan segala kemungkinan yang terjadi pada yang diatas Ibu anak D merasa ragu terhadap tindakan yang akan dilakukan akan berhasil Ibu anak D tidak mengerti dengan penjelasan perawat A Ibu anak D merasa tidak mampu merawat dan menjaga anaknya 136. Perawat M dinas di poli orthopedi RSU, datang seorang ibu dengan anaknya D berusia 5 bulan, perempuan, dari hasil pengkajian didapatkan ada kelainan pada kaki anak D yaitu clubfoot menurut diagnose dokter orthopedi, telapak kaki anak D sudah keras dan kaku, sebagai seorang perawat kita bisa mengkomunikasikan kepada dokter untuk melakukan therapy pada anak D.

Therapy apakah yang kita komunikasikan kepada dokter orthopedi untuk penangan awal pada anak D? a. Melakukan bedah orthopedi ringan pada kaki anak D b. Melakukan serangkaian therapy gips selama periode 3 s.d 6 minggu c. Menganjurkan penggunaan sepatu khusus d. Tidak melakukan therapy apapun karena anak D masih 5 bulan e. Menganjurkan kekeluarga untuk menjaga anak D agar jangan sampai cidera 137.

Perawatan yang dilakukan pada pasein anak seorang laki-laki berumur 5 tahun dirawat dirumah sakit. Pada saat dilakukan anamnesa Ibunya mengatakan badan anaknya bengkak sejak 4 bulan.

Pada hasil pemeriksaan fisik didapat adanya edema pada wajah,pada abdomen, dan pada ekstremitas bagian bawah, serta tekanan darah 150/80 mmHg, nadi 87 x/menit, pernafasan 28 x/menit,suhu 37.8 o C. Dari penuturan diatas pada hasil pemeriksaan ditemukan penyebabnya adalah A. B. C. D. E. Eksresi air dan Natrium Peningkatan Sekresi ADH dan Aldosteron Penurunan Tekanan osmotik koloid Peningkatan Permeabilitas membran glomerolus Hipoalbuminemia akibat proteiuria 138.

Penanganan perawatan yang dilakukan pada seorang anak umur 3 tahundilakukan perawatan di Puskesmas dengan diagnosa medis Faringitis sedangkan dari hasil anamnesa Ibu mengatakan anaknya filek dan batuk tapi tidak disertai sesak pernafasan. pada pemeriksaan fisik didapatkan frekwensi pernapasan 33x/menit denyut nadi 90 x/menit temperatur 36,5 ºC.

lalu direncanakan untuk dilakukan fisioterapi dada yang di awali dari postural drainage,claping dan vibrating. Pertama kali perawat sebelum melakukan postural drainage adalah? a. b. c. d. e. Mengauskultasi paru Menentukan posisi klien Minum air hangat Kolaborasi dalam pemberian obat ekspektoran Melakukan perkusi/klaping 139.

Seorang bayi laki-laki usia 8 bulan dibawa oleh ibunya ke Puskesmas untuk melakukan imunisasi. Pada hasil pemeriksaan didapatkan yaitu berat badan 9 kg, suhu tubuh 36,8ºC, pernafasan 20x/menit, sebelumnya telah mendapatkan imunisasi Polio 2, BCG, dan DPT I. Dari kasus diatas Imunisasi apa yang sekarang harus diberikan? A.

BCG dan Polio II B. DPT II dan Polio III C. DPT II dan Polio IV D. Hepatitis dan Polio III E. DPT III dan Polio IV 140. Seorang anak laki-laki usia 1 tahun, dibawa oleh orangtuanya ke Puskesmas karena mengalami pembesaran kepala penuturan orang tuanya sejak usia 2 bulan yang lalu, kemudian perawat melakukan pemeriksaan fisik, didapatkan hasil: lingkar kepala 59 cm, berat badan 7 kg, tinggi badan 62 cm, terdapat sunset sign, pada motorik kasar anak belum bisa berjalan, anak sering digendong oleh orangtuanya.

hasil penanganan diatas apa yang menjadi masalah utama dalam keperawatan? A. Lanugo pada bayi baru lahir pemenuhan kebutuhan nutrisi B. Frekwensi nutrisi kurang dari kebutuhan C. Gangguan pertumbuhan dan perkembangan D. Resiko gangguan cairan dan elektrolit E.

Ketidak tahuan dalam penanganan penyakit 141. Seorang anak usia 2 tahun dia adalah anak pertama dan oleh Ibunya dibawa kepuskesmas dengan keluhan anak belum bisa berjalan dari hasil pemeriksaan didapat berat badan 7 kilo gram, tinggi 65 Cm dan anak hanya bisa merangkak sewaktu di lakukan pemeriksaan oleh perawat Dari hasil pemeriksaan anak mengalami keterlambatan ?

a. Gangguan prilaku b. Gangguan social c. Gangguan motorik kasar d. Gangguan motorik halus e. Gangguan wicara 142. Seorang anak usia 4 tahun datang ke poli klinik dengan frekuensi nafas lebih dari 30x/ menit,iramanya kadang dangkal dan dalam,suara nafas ronchi basah, pada faring terlihat sekret kental. Apakah diagnose keperawatan yang tepat untuk kasus diatas ? A.

Resiko gangguan perfusi jaringan berhubungan lanugo pada bayi baru lahir penurunan asupan oksigen dari luar. B. Tidak efektifnya bersihan jalan nafas berhububgan dengan penumpukan sekret ditrakheobronchial. C. Gangguan pertukaran gas berhubungan dengan peningkatan tekanan pembuluh kapiler paru. D. Tidak efektifnya pola nafas berhubungan dengan meningkatnya volume darah balik dalam paru. E. Intoleransi aktivitas berhubungan dengan ketidakseimbangan antara suplai dan kebutuhan oksigen.

143. Seorang anak usia 10 tahun, mengalami penambahan berat badan ,edema, wajah sembab disekitar mata timbul saat pagi berkurang saat siang hari, asites,kesulitan bernafas,pembengkakan scrotal. Apakah intervensi keperawatan yang tepat untuk masalah kasus diatas ? A. B. C. Kaji masukan yang relative terhadap keluaran Atur masukan cairan dengan cermat Pantau infuse intra vena D.

Pantau tanda vital E. Berikan perawatan kulit 144. Seorang anak usia 3 tahunmengalami serangan kejang yang berulang, setelah dilakukan pemeriksaan suhu rectal hasilnya 39,5 ◦ C. Apakah tindakan awal dirumah pada anak yang mengalami kejang berulang tersebut ?

A. B. Berikan diazepam intravena secara perlahan. Pembebasan jalan nafas dengan cara kepala dalam posisi hyperekstensi miring, pakaian dilonggarkan dan penghisapan lender.

C. Segera pindahkan anak ketempat yang aman seperti lantai yang diberi alas lunak tapi tipis dan jauhkan dari benda – benda berbahaya seperti gelas ,pisau. D. Pemberian oksigen untuk membantu kecukupan perfusi jaringan E. Pemberian kompres es untuk membantu menurunkan suhu tubuh 145. Seorang anak usia 10 tahun, sesak nafas setelah berpaparan dengan bahan alergen dan menetap beberapa saat. Repirasinya 36 kali / menit, kadang disertai batuk sehingga terlihat pucat.

Apakah yang harus dihindari anak untuk mengurangi sesaknya ? A. Terapi inhalasi bronchodilator kombinasi dengan mukolitik. B. Mengurangi anak dari kelelahan yang berlebihan tetapi jangan over proteksi. C. Jauhkan anak dari paparan alergen seperti debu, hawa dingin.

D. Pemberian oksigen sesuai advis E. Pemberian antibiotik untuk mencegah penyakit sekunder. 146. Seorang bayi perempuan berusia 8 bulan dibawa ibunya berobat ke poliklinik anak dengan keluhan sejak 2 minggu terakhir bayi BAB 4 – 5 x/hari dengan keluaran sisa makanan yang belum tercerna dengan baik. Ibu bekerja sebagai guru, memberikan asi 1 x sebelum bekerja dan 3 – 4 kali sepulang bekerja.

Sehari-hari bayi diurus oleh neneknya dengan pengaturan makan pemberian bubur susu 3x/hari dan sari jeruk peras 2 x/hari, susu buatan 3x/hari. Apakah anjuran yang paling tepat saudara berikan pada ibu bayi? A. Pemberian bubur susu dihentikan B. Pemberian sari jeruk peras dihentikan C.

Pemberian susu buatan dihentikan D. Pemberian asi dilanjutkan dengan frekuensi ditambah E. Pemberian asi dihentikan karena tidak efektif 147. Anak A berumur 7 tahun masuk rumah sakit dengan marasmus. Ibu klien mengatakan klien tidak mau makan,lemah,berat badan menurun hingga 60%,perut cekung,kulit keriput,atropi otot,cengeng,apatis Rencana keperawatan apa yang harus dilakukanpada kasus diatas ? a. Berikan makan setiap 2 jam b. Hangatkan anak dengan selimut c. Observasi tanda inflamasi d.

Berikan penjelasan perlunya kebersihan mulut e. Berikan minum sebanyak mungkin 148. Seorang anak laki-laki berumur 1 bulan dengan diare dirawat di rumah sakit. Ibu klien mengatakan klien buang air lanugo pada bayi baru lahir 8x, muntah dan tidak mau minum ASI, mata cekung, mukosa bibir kering,berat badan turun,apatis Apakah rencana keperawatan utama pada kasus diatas?

a. b. c. d. e. Berikan cairan oralit Teruskan pemberian ASI saja Berikan cairan RL dan oralit Berikan cairan Dekstros dan NaCl Berikan diet secara bervariasi 149. Seorang bayi berusia 6 tahunmasuk rumah sakit dengan hidrocephalus.Ibu klien mengatakan anaknya sering muntah dan tidak nafsu makan,lemah,konjungtiva anemis,berat badan turun,distensi vena supervisialis,kesadaran apatis Apakah diagnosakeperawatan utama pada kasus diatas?

a. b. c. Gangguan pemenuhan kebutuhan nutrisi kurang dari kebutuhan b/d muntah Nyeri b/d peningkatan tekanan intrakranial Devisit volume cairan dan elektrolit kurang dari kebutuhan tubuh b/d output cairan yang berlebihan d. Keterbatasan mobilitas fisik b/d peningkatan berat kepala e. Kurang pengetahuan b/d kurang informasi tentang penyakit 150. Seorang anak usia 2 tahun dengan hipospadia baru dilakukan tindakan operasi rekonstruksi leher bleder. Operasi sudah dilakukan 6 hari yang lalu dan kondisi klien semakin membaik, tanda-tanda vital stabil, dipasang kateter, drainage sudah diangkat,urine sudah mulai jernih Apakah rencanakeperawatanuntuk pemulangan klienpada kasus diatas?

a. Ajarkan tehnik distraksi untuk mengurangi nyeri b. Ajarkan perawatan kateter c. Menganjurkan banyak minum d. Menyanjurkan untuk tidak banyak beraktivitas e. Menganjurkan selalu mengobservasi keluaran urine 151. Anak Y berusia 1 tahun masuk RS dengan diare. Ibu klien mengatakan klien BAB sudah 6x/ hari sejak 4 hari yang lalu,berat badan klien sebelum sakit 11,5 kg dan sesudah sakit 10 kg, mata cekung, mukosa bibir kering, turgor kulit> 3 dtk,apatis Berapa jumlah kehilangan cairan dilihat dari berat badan pada kasus diatas?

a. 5% b. 10% c. 13% d. 14% e. 15% 152. Seorang anak perempuan berusia 36 bulan datang ke puskesmas diantar oleh ibunya, ibu mengeluh bahwa anaknya selalu rewel tidak mau pisah dari gendongannya sejak adiknya yang baru lahir dibawa pulang dua hari yang lalu, makan selalu habis, hasil pemeriksaan terkesan cari perhatian, berat badan 14 kilo gram, tinggi badan 89 cm, hasil pemeriksaan fisik yang lain menunjukkan kondisi normal.

Apakah masalah utama pada kasus tersebut ? A. Cemas B. Tidak nyaman C. Kurang perhatian D. Resiko gangguan sosialisasi E. Resiko gangguan pertumbuhan dan perkembangan. 153. Seorang anak laki-laki berusia 30 bulan datang ke Poli Anak dengan ibunya, ibu mengeluh bahwa anaknya selalu rewel tidak mau pisah dari gendongannya sejak adiknya yang baru lahir dibawa pulang tiga hari yang lalu, hasil pemeriksaan terkesan cari perhatian, berat badan 13,5 kilo gram, tinggi badan 88,4 cm, hasil pemeriksaan fisik yang lain menunjukkan kondisi normal.

Apakah intervensi utama untuk mengatasi permasalahan pada kasus lanugo pada bayi baru lahir ? A. B. C. Pantau perilaku sehari-hari Tanamkan kehidupan mandiri Ajarkan untuk makan sendiri D. Berikan mainan yang disukai dan ajak bermain E.

Ajak dalam perawatan bayi dan berikan hadiah kecil 154. Seorang anak laki-laki usia 24 bulan dibawa ibunya ke puskesmas untuk memeriksakan kesehatannya, ibu mengeluh bahwa anak tersebut suka mainan faesesnya jika tidak ketahuan, hasil pemeriksaan berat badan 12 kilo gram, tinggi badan 80 cm, lingkar kepala 38 cm, anak kooperatif tetapi pemalu.

Apakah pendidikan kesehatan utama kepada orang tua untuk mengatasi permasalahan kasus tersebut? A. Bersosialisasi B. Kebersihan diri C. Toilet training Lanugo pada bayi baru lahir. Bermain cilokba E. Berbahasa sederhana 155. Seorang anak perempuhan usia 30 bulan dibawa ibunya lanugo pada bayi baru lahir Posyandu memeriksakan kesehatan, ibu mengeluh bahwa anaknya suka membantah jika disuruh makan atau lanugo pada bayi baru lahir lainnya, ibu anak teesebut menanyakan apakah anaknya ada kelainan, hasil pemeriksaan berat badan 12 kilo gram, tinggi badan 87 cm, lingkar kepala 38,5 cm, anak kooperatif ,memalingkan muka jika diajak bicara dan mengatakan tidak mau.

Apakah pendidikan kesehatan yang tepat saat ini pada orang tua anak tersebut ?. A. Pertumbuhan anak usia todler B. Perkembangan usia todler C. Bersosialisasi usia todler D. Pengalihan perhatian E. Permainan 156. Seorang anak laki-laki usia 13 tahun, duduk di kelas VII, anak tersebut lari lima kali keliling lapangan, sedang mendapatkan panism karena tidak mengerjakan pekerjaan rumah yang ditugaskan oleh guru, anak tersebut berjanji tidak akan mengulang kesalahan lagi. Pada tahap perkembangan apa yang sedang terjadi sesuai data kasus tersebut ?

A. Moral B. Kognitif C. Bahasa D. Psikososial E. Temperamen 157. Seorang bayi laki-laki lahir dengan BB 2 Kg, proporsi kepala Nampak lebih besar daripada badan, kulit tipis transparan, lanugo banyak terutama pada dahi, pelipis, telinga dan lengan, lemak kulit kurang, ekstremitas Nampak kebiruan, genitalia teraba testis belum turun.

Pada pemeriksaan tanda vital diperoleh frekuensi nafas 60 x/menit, frekuensi nadi 100 x/menit, suhu 35,80C Apakah diagnose keperawatan prioritas dari kasus diatas ? a. Gangguan keseimbangan suhu tubuh; hypotermi s.d proses adaptasi dengan lingkungan luar rahim b. Resti kekurangan volume cairan dan elektrolit s.d efek dari inkubator c. Gangguan pola nafas s.d imaturitas organ pernafasan d.

Inefektifitas jalan nafas s.d penumpukan sekret e. Infeksi s.d imaturitas imonoglobulin 158. Seorang anak usia 3 tahun sedang di rawat di RS. Anak nampak ketakutan, terus menangis dan tidak mau ditinggal ibunya.

Apakah Intervensi keperawatan yang dapat diberikan untuk mengurangi dampak hospitalisasi pada anak tersebut? a. b. c. Memaksimalkan manfaat hospitalisasi Meminimalkan sressor atau penyebab stres. Memberikan permainan sesuai dengan usianya d. Memberikan dukungan pada anggota keluarga lain e. Mempersiapkan anak untuk mendapat perawatan di RS 159.

Seorang anak laki-laki berusia 6 tahun datang bersama ibunya ke RS dengan keluhan sejak 2 minggu yang lalu badannya panas menggigil, keluhan disertai pusing, mual, nafsu makan menurun. Pada pemeriksaan fisik diperoleh BB turun hingga 20%, klien tampak pucat, mukosa bibir kering, nyeri ulu hati skala 4, kadang disertai diare, muntah 4x/hr.Pada pemeriksaan tanda vital diperoleh Suhu= 380C. TD= 90/60, frekuensi nadi = 104x/mnt.

Hasil Pemeriksaan Diagnostik: Pemeriksaan darah tepi (DDR) plasmodium fositif Apakah Masalah keperawatan utama yang mungkin muncul? a. Gangguan perfusi jaringan otak b. Deficit cairan dan elektrolit c. Inefektif bersihan jalan nafas d. Ketidakseimbangan nutrisi e. Hipotermi 160. Seorang bayi berusia 3 hari datang ke RS dengan keluhan dari ibunya kuning. Pada pemeriksaan fisik diperoleh BB 2 Kg, bayi tidak mau menetek, perut tampak buncit. Pada pemeriksaan tanda-tanda vital diperoleh frekuensi nadi 120 x/menit, frekuensi nafas 50 x/menit, suhu 370.

Pada pemeriksaan laboratorium diperoleh kadar bilirubin serum 13 mg%. Apakah tindakan perawat yang harus dilakukan pada pasien diatas? a. Melakukan fototherapy b. Memberikan therapy cairan c. Mengobservasi tanda-tanda vital d.

Memasukkan klien ke dalam inkubator e. Menjaga keseimbangan suhu tubuh klien 161. Seorang bayi usia 10 hari dibawa oleh ibunya ke RS dengan keluhan kejang-kejang dan tidak dapat menetek. Pada hasil pemeriksaan ditemukan ada trismus pada otot mulut, leher kaku, terjadi opistotonus, kadang terjadi kejang pada otot pernafasan, bayi nampak sianosis.

Pemeriksaan tandatanda vital diperoleh suhu 390C, frekuensi pernafasan 65x/menit, frekuensi nadi 100 x/menit. Apakah tindakan pertama yang harus dilakukan perawat untuk mengatasi gangguan fungsi pernafasan pada bayi tersebut?

a. Atur posisi bayi dengan kepala ekstensi b. Berikan oksigen 1-2 liter/menit c. Observasi tanda-tanda vital setiap setengah jam d. Bersihkan jalan nafas e. Pasangkan sudip lidah 162.

By X dibawa ke klinik tumbuh kembang, usianya 8 bulan, ibu bayi mengatakan bahwa bayinya belum bisa melakukan kegiatan-kegiatan hal nya bayi-bayi yang lain. Apakah kegiatan-kegiatan yang dimaksud oleh ibu bayi X?

A. Belajar mengatakan dua kata B. Merangkak meraih benda C. Menirukan suara D. berdiri sendiri E. mengikuti objek dengan mata 163.

Setelah di kaji ternyata anak X mampu berbicara didepan umum, dan memahami apa yang dijelaskan oleh orang dewasa. Apakah jenis kecerdasan yang dialami oleh anak X? A. Verbal linguistic B. C. D. E. Logical mathematical Visual spatial Bodily kinestic Musical 164. an. X 6 bulan dibawa ibunya ke RS dengan keluhan sesak dan pucat, tidak mau menyusu, dan diare.

Menurut ibunya an. X rewel dan sering menangis tapi lemah, hasil pemeriksaan fisik an. X mengalami splenomegali. Apakah diagnosa medis yang dialami an. X ? A. Thalasemia mayor B. Thalasemia intermedia C. Thalasemia minor D. Thalasemia E. Leukemia 165. An. X 8 bulan dibawa ibunya ke RS untuk ditransfusi darah, menurut ibunya, an.x sdh 2 bulan ini di transfuse darah. Program tranfusi darah yang regular ini diberikan karena kadar HB yang cukup rendah.

Apakah Tujuan pemberian transfuse darah yang regular ? A. Mengganti eritrosit yang pecah B. Memelihara kadar Hb minimum 9,5-10,5 g/dl C. Meningkatkan kadar Hb sampai normal 12,5-13 g/dl D.

Mengganti rantai beta pada hemoglobin E. Menambah sel darah merah yang kurang 166. An. X 13 tahun datang ke RS bersama ayahnya untuk dilakukan transfuse darah, transfuse darah sudah dilakukan sejak berusia 8 bulan. hasil pemeriksaan fisik : perut buncit, jantung berdebar, dan gambaran EKG aritmia.

Apakah penyebab Gangguan jantung pada kasus diatas ? A. Peningkatan erithropoisis B. Peningkatan kadar besi C. Stimulasi erithropoitin di bone marrow D. Kadar Hb yang cukup rendah E. Adanya virus di dalam darah transfuse 167. Hasil pemeriksaan radiologis pada anak thalasemia didapatkan : medulla yang lebar, korteks yang tipis, trabekulla kasar, hemosiderosis pada kelenjar endokrin, hair-on-end pada tulang kepala.

Hasil pemeriksaan darah terdapat penurunan Hb yang cukup besar. An. X mendapat terapi khelasi dengan disperal. Hasil wawancara ternyata kakeknya mengalami penyakit yang sama.

Apakah Tujuan Terapi khelasi diberikan ? A. B. C. D. E. Untuk mengurangi infeksi di dalam darah Untuk mengurangi peningkatan zat besi Untuk meningkatkan produksi hemoglobin Untuk memperbaiki rantai globin yang rusak Untuk mengurangi pembesaran pada hati 168. An. 16 lanugo pada bayi baru lahir, datang ke RS dengan keluhan menorraghia, dan sering mengalami perdarahan di hidung dan gusi.selain itu jika terdapat laserasi maka selalu mengalami perdarahan yang cukup lama, fatigue, dan mengeluh sulit untuk konsentrasi, Terdapat melena.

Hasil pemeriksaan fisik terdapat petechie di ekstremitas, terdapat hematom di daerah mulut. Hati, limfa dan getah bening tidak membesar. Hasil lab : trombosit 9.600 per µl, terjadi leukositosis, Hb 12 mg/dl. Masa perdarahan memanjang, masa pembekuan normal, retraksi bekuan abnormal,pro¬thrombin consumption time memendek. Tes Rumple-Leed positif. apakah penyebab Adanya melena pada kasus diatas?

A. Adanya petechie B. Leukositosis C. Trombosit 9600 per µl D. Tes rumple- Lees positif E. Limfa dan hati membesar 169. An. X 5 tahun dibawa ke RS oleh ibunya karena edema. An. X mengeluh sakit kepala dan terlihat gampang letih. Hasil pemeriksaan fisik Edema terlihat di daerah periorbital, sacrum, skrotum dan abdomen. Pitting edema +,urine output sedikit. hasil pemeriksaan laboratorium : terdapat protein di dalam urin.

albumin 1,8 gr/dl, kolesterol 265 mg/dl. Beberapa bulan terakhir ini an.x mengalami kenaikan BB cukup besar. Apakah penyebab Edema pada kasus ? A. Kolesterol 265 mg/dl B. Albumin 1,8 gr/dl C.

Protein dalam urin D. Urin output yang sedikit E. Berat badan yang bertambah 170. An. X 5 tahun dibawa ke RS oleh ibunya karena edema. An. X mengeluh sakit kepala dan terlihat gampang letih. Hasil pemeriksaan fisik Edema terlihat di daerah periorbital, sacrum, skrotum dan abdomen.

Pitting edema +,urine output sedikit. hasil pemeriksaan laboratorium : terdapat protein di dalam urin. albumin 1,8 gr/dl, kolesterol 265 mg/dl. Beberapa bulan terakhir ini an.x mengalami kenaikan BB cukup besar. apakah masalh keperawatan yang muncul pada kasus di atas? A. Kelebihan volume cairan (tubuh total) B. Peningkatan kebutuhan nutrisi C. Infeksi D. Intoleran aktivitas E. Resiko tinggi cedera 171. An.B memilikiriwayatpenyakitpadasaluranpernafasanwaktuberusia 5 tahun.Saatiniiaberusia 15 tahundanmengeluhbatukberdahak yang tidakkunjungsembuhselama 7 hariminumobatbatuk.

Kondisilingkunganrumahsangatpadat, danIbuklienmengatakansedikitnyaventilasicahaya yang masuk di rumahnya. Pemeriksaandiagnostik yang dilakukanuntukAn.Btersebutadalah? a. Skin test b. Rontgen dada c. Tesuji tuberculin d.

Pemeriksaandarah e. Pemeriksaan sputum 172. An.A laki-laki usia 4 th bersamadenganibunyadatangkerumahsakit. Ibunyamengeluhkananaknya yang mengatakannyeritenggorokansejak 3 hari yang lalu.Hasilpemeriksaanfisikdidapatkanadanyanyeripadapalpasiringan di leher, tenggorokankemerahanagakbau, danadasedikitpembengkakanpadanoduslimph submandibular.

Apakah tindakan keperawatan utama yang perlu dilakukan perawat? a. Kompreshangat b. Memantau tanda-tanda vital c. Menyarankanpasienistirahat d. Kolaborasipemberiananalgesik e. Membantu teknik hygiene padamulut 173. An.P perempuan 5 th mengalamilukabakarakibatrumahnyakebakaran. Luka bakarpada area kepala, lengankanandankiri, serta area dada danperut.Setelahdilakukanpengkajiandiadapatkanlukabakarderajat I danklienmengeluhnyeri yang terutamapada area dada.

BerapakahpeersentaselukabakarpadaAn.Ptersebutadalah? a. 35 % b. 40 % c. 45 % d. 50 % e. 55 % 174. An.J (10 th) mengalamilukabakarderajat III. Setelahmendapatperawatan di RS selama 7 hari, kondisilukaklienbelummengalamiperbaikan, berwarnakehitaman di semua area lukabakar.Belumadatanda-tandapemisahaneskaralami.

Apakahtindakankolaborasi yang harusdilakukanuntukAn.Jtersebut? a. b. c. d. e. Graft Wound care Debridemenbedah Debridemenmekanis Pemberianantibiotiktopikal 175. Ners C melakukan anamnesa lanugo pada bayi baru lahir Ny. B tanggal 19 Oktober 2002 di poliklinik Tumbuh Kembang RS Mitra Ibu.

Ny. B mengatakan bahwa anaknya belum bisa berjalan sendiri saat ini. Anaknya lahir tanggal 27 Desember 1998 dengan usia kehamilan 38 minggu.

Berapakah usia anak Ny. B saat dikaji Ners C pada kasus diatas? A. B. C. D. 3 tahun 9 bulan 8 hari 3 tahun 9 bulan 22 hari 3 tahun 10 bulan 8 hari 3 tahun 10 bulan lanugo pada bayi baru lahir hari 176.

An. L laki-laki usia 17 bulan berada di ruang Radiologi RS Mitra kasih untuk dilakukan pemeriksaan rontgen. An. L menangis meronta-ronta dan berpegangan erat pada ibunya. Menurut ibunya, An. L pertama kali dilakukan pemeriksaan ini.

Apakah yang harus dilakukan pada An.L pada kasus diatas ? a. Memberikan mainan kesukaannya b. Memberikan music atau film anak-anak c. Memberikan minuman dan makanan kesukaannya d. Mengatakan “ibu akan menemani dan disampingmu” e. Menjelaskan bahwa prosedur tindakan tidak akan menyakiti 177. Seorang ibu membawa Anaknya, An. O perempuan usia 15 bulan ke poliklinik tumbuh kembang RS Mitra Ibu.

An O tampak bermain sendiri dengan bonekanya dan tidak menghiraukan pemeriksa. Apakah stimulasi yang diberikan pada An. O diatas ? a. Bermain cilukba b. Puzzle sederhana c. Mennyusun kubus d. Memanggil dan tersenyum e. Bermain lempar-tangkap bola 178. Nn. V usia 16 tahun mengalami anemia sel sabit sejak usia 5 tahun.

Hasil pengkajian diperoleh bibir pucat, konjungtiva anemis, membrane mukosa mulut dan kulit pucat, kapilari refill time 6 detik, dan clubbing finger Apakah diagnosa keperawatan prioritas pada kasus diatas ?

a. Gangguan pembentukan eritrosit berhubungan dengan anemia sel sabit b. Gangguan transportasi oksigen berhubungan dengan menurunnya viskositas darah c.

Risiko perdarahan berhubungan dengan menurunnya ikatan O2 dalam hemoglobin d. Gangguan perfusi jaringan berhubungan dengan menurunnya ikatan O2 dalam hemoglobin 179. Ners Z sedang memberikan imunisasi campak pada By. H perempuan usia 12 bulan, anak tersebut meronta-ronta, menangis dan menjerit dengan keras. Apakah tindakan keperawatan pada kasus tersebut diatas?

a. b. c. d. e. Terus melanjutkan penyuntikan imunisasi Meminta ibu dari anak tersebut untuk menyusui anaknya Meminta bantuan ibunya/perawat lain untuk mengambilkan benda kesayangan anak Tersenyum pada anaknya, mengelus kepala dan menghentikan kegiatan sementara Berhenti sejenak dan meminta bantuan ibunya untuk memegangi tangan dan kaki anak tersebut 180.

Bayi A perempuan usia 6 bulan mengalami Club foot dan akan dipasang cast. Apakah yang harus diwaspadai dan dilaporkan segera oleh orang tua pada kasus diatas? A. Kapiler refill 6 detik di jari-jari kaki yang terkena. B. Mati rasa jari-jari kaki yang terkena. C. Kulit hangat di kaki distal yang terkena D.

terasa gatal dan panas di bawah cast E. Edema di jari-jari kaki yang terkena dan membaik dengan elevasi. 181. Seorang bayi baru lahir berjenis kelamin laki-laki, lahir secara spontan dengan kondisi badan berwarna merah namun ekstremitasnya kebiruan dan fleksi.

Bayi tampak menyeringai. Pulse 86 kali/menit dan pernafasan tidak teratur Apakah masalah yang terjadi pada bayi tersebut ? a. Asfiksia b. Tidak asfiksia c. Asfiksia berat d. Asfiksia sedang e. Asfiksia ringan 182. Seorang bayi baru lahir berjenis kelamin laki-laki, dilakukan pemeriksaan fisik oleh perawat di ruang Perinatologi.

Saat pemeriksaan reflex, perawat meletakkan jarinya pada telapak tangan bayi Apakah nama refleks yang dimaksud pada kasus di atas ? a. Moro b. Babinsky c. Tonic neck d. Crawling e. Palmar Graps 183. Anak perempuan, usia 9 tahun, BB 25 kg, TB 122 cm. Datang ke poliklinik anak dengan keluhan perut kembung. Keluhan diawali sejak lahir BAB pertama pasien terjadi 2 hari setelah lahir, BAB tiap 5 hari sekali, sedikit-sedikit, banyak gas yang ikut keluar, BAB seperti pita, berwarna kuning.

Hasil pemeriksaan fisik didapatkan abdomen cembung, distensi abdomen (+), bising usus (+) terdengar lemah, frekuensi nadi 92 x/menit, Frekuensi nafas 24 x/menit, TD 100/70 mmHg dan Suhu 36,8oc. Apakah masalah keperawatan utama pada kasus diatas?

lanugo pada bayi baru lahir. Resiko infeksi b. Gangguan pola nafas c. Gangguan body image d. Gangguan pola eliminasi BAB : konstipasi e. Resiko gangguan pertumbuhan dan perkembangan 184. Anak laki-laki, usia 1 tahun, BB 12 kg, TB 82 cm.

Datang ke poliklinik anak dengan keluhan perut kembung. Keluhan diawali sejak lahir BAB pertama pasien terjadi 3 hari setelah lahir, BAB seminggu sekali, sedikit-sedikit, banyak gas yang ikut keluar, BAB seperti pita, berwarna kuning. Hasil pemeriksaan fisik didapatkan abdomen cembung, distensi abdomen (+), bising usus (+) terdengar lemah, frekuensi nadi 102 x/menit, Frekuensi nafas 28 x/menit, dan suhu 36,8oc.

Apakah tindakan keperawatan utama pada pasien tersebut ? a. Melakukan washout b. Memasang NGT dekompresi c. Kolaborasi pemberian laksatif d. Melakukan massage I Love You e.

Menganjurkan pasien untuk banyak minum 185. Seorang bayi laki-laki, usia 1 hari, datang ke rumah sakit dengan keluhan langit-langit mulut yang terbuka. Pasien lahir di paraji, cukup bulan, BBL 2800 gram. Ibu pasien mengatakan pasien tidak bisa menyusui dan sulit menelan. Hasil pemeriksaan pasien tampak rewel, terus menangis, ubun-ubun teraba datar dan lembut, mukosa mulut lembab, perut teraba lembut, bising usus (+). Frekuensi nadi 122 x/menit, frekuensi nafas 43 x/menit, suhu 36,80c.

Apakah intervensi keperawatan yang utama pada pasien tersebut ? a. Lakukan pemasangan infus b. Rawat bayi dalam inkubator c. Anjurkan ibu memberikan ASI sesuai permintaan bayi d. Tutupi kepala bayi dengan topi dan jaga suhu ruangan e.

Pasang oral gastric tube untuk membantu pemberian ASI 186. Seorang anak perempuan, usia 1 tahun, datang ke poliklinik anak untuk memeriksakan post operasi penutupan palatum satu bulan yang lalu. Sebelumnya pada usia 6 bulan pasien telah mendapatkan operasi bibir sumbing. Pada saat pemeriksaan BB 11 kg, frekuensi nadi 108 x/menit, frekuensi nafas 28 x/menit, suhu 36,80c. Apakah data yang harus dikaji sebagai tindak lanjut dari program operasi pada pasien tersebut ?

a. Apa jenis makanan serta frekuansi makan anak b. Bagaimana perkembangan kemampuan bicara anak c. Apakah masih terdapat kesulitan menelan pada lanugo pada bayi baru lahir d. Bagaimana cara orang tua memberikan makan pada anak e. Apakah terdapat tanda-tanda infeksi pada luka post operasi 187. Anak perempuan, usia 5 tahun, BB 12 kg, Lanugo pada bayi baru lahir 105 cm. Sejak lahir pasien tidak mempunyai anus dan telah dilakukan operasi colostomy saat berusia 5 hari. BAB lancar melalui colostomy tersebut.

Pasien mengeluh perih pada daerah sekitar stoma. Hasil pemeriksaan didapatkan abdomen datar, lembut, bising usus (+) 7 x/menit, di sekeliling stoma tampak kemerahan dan terdapat bintik-bintik merah, frekuensi nadi : 100x/menit, frekuensi nafas : 24 x/menit, Suhu : 36,8oc.

Apakah diagnosa keperawatan yang utama pada pasien tersebut ? a. b. Nyeri Ansietas c. Risiko infeksi d. Kerusakan integritas kulit e. Gangguan pola eliminasi BAB 188.

Anak perempuan, usia 5 tahun, datang ke poliklinik anak untuk melakukan kontrol post operasi anoplasty. Orang tua pasien mengatakan anaknya sulit BAB dan merasa bahwa anus anaknya mulai menyempit. Hasil pemeriksaan didapatkan abdomen datar, lembut, bising usus (+) 8 x/menit, pada pemeriksaan rectal toucher terasa adanya kontraksi dari spincter ani externa, `frekuensi nadi 100x/menit, frekuensi nafas 24 x/menit, Suhu 36,5oc.

Apakah intervensi keperawatan utama pada pasien tersebut ? a. Lakukan prosedur washout b. Kolaborasi pemberian obat pencahar c. Anjurkan ibu pasien mengajari toilet training d. Ajarkan pada ibu pasien cara melakukan anal dilatasi e. Anjurkan ibu pasien untuk memberi pasien makanan tinggi serat 189. Anak perempuan, usia 7 tahun datang ke rumah sakit dengan keluhan bengkok pada siku tangan kanan. Sejak 1 tahun yang lalu pasien terjatuh pada saat bermain dan menurut orangtua siku pasien semakin hari menjadi semakin bengkok dan sulit melakukan aktivitas.

Pada pemeriksaan didapatkan hasil adanya angulasi ke lateral, deformitas (+), Swelling (-), distal neurovascular (+), ROM pada ekstremitas atas sinistra terbatas, frekuensi nadi 80 x/menit, frekuensi nafas 22 x/menit, suhu 36,7oc.

Apakah masalah keperawatan yang utama pada pasien tersebut ? a. Nyeri b. Ansietas orangtua c. Intoleransi aktifitas d. Hambatan mobilitas fisik e. Kerusakan integritas jaringan 190. Anak laki-laki, usia 14 tahun datang ke rumah sakit dengan keluhan keluar darah dari hidung hidung setelah terkena lemparan bola basket temannya. Pasien mengeluh pusing dan nyeri pada bagian hidung dengan skala nyeri subjektif 4 (0-10). Pada pemeriksaan didapatkan adanya deformitas pada os nasal, terdapat perdarahan, tekanan darah 120/80 mmHg, frekuensi nadi 86 x/menit, frekuensi nafas 25 x/menit, suhu 36,8oc.

Apakah tindakan keperawatan yang utama pada pasien tersebut ? a. Memberikan kompres es b. Kolaborasi pemberian analgetik c. Mengatur posisi pasien semi fowler d. Memberikan cairan melalui intravena e.

Menutup lubang hidung dengan kapas 191. Anak perempuan, usia 2 tahun. TB 85 cm, BB 13 kg. Datang ke poliklinik anak dengan keluhan berjalan tertatih. Orangtua mengatakan pasien pernah terjatuh saat berusia 9 bulan. Pada saat pemeriksaan didapatkan bagian ektremitas bawah sinistra klien lebih pendek daripada dekstra.

Pasien tampak kesulitan dan tertatih saat berjalan. frekuensi nadi 115 x/menit, lanugo pada bayi baru lahir nafas 28 x/menit, suhu 36,5oc. Hasil pemeriksaan rontgen didapatkan adanya dislocation of hip. Apakah masalah keperawatan yang utama pada pasien tersebut ?

a. b. c. d. e. Nyeri Intoleransi aktifitas Hambatan mobilitas fisik Kerusakan integritas jaringan Risiko keterlambatan perkembangan 192. Bayi laki-laki, usia 1 bulan, lahir spontan, letak bokong.

Sesaat setelah proses kelahiran pasien didiagnosa dislocation of hip. Saat ini pasien dalam perawatan dan terpasang gips. Orangtua pasien mengeluh pasien tampak rewel dan gelisah.

Pada saat dilakukan pemeriksaan didapatkan palpasi bagian distal yang terpasang gips teraba dingin, tampak pucat, CRT 4 detik, frekuensi nadi 130 x/menit, frekuensi nafas 36 x/menit, suhu 37,2oc.

Apakah masalah keperawatan yang utama pada pasien tersebut ? a. Nyeri b. Hambatan mobilitas fisik c. Risiko kerusakan integritas kulit d. Risiko keterlambatan perkembangan e.

Risiko disfungsi neurovascular perifer 193. Seorang anak laki-laki berusia 30 bulan, datang ke klinik tumbuh kembang, perawat yang mengkaji melihat perkembangan motorik kasar menunjukkan dia sudah dapat mengikuti perintah untuk berdiri dan jongkok, mulai dapat mengungkapkan keinginannya pada orang lain, dan mulai tertarik untuk bermain bersama teman sebayanya.

Hal apa terkait bimbingan antisipasi yang harus dijelaskan pada orangtua? A. Mengenalkan mainan baru untuk mengembangkan kemampuan motorik dan sosial B. Mendiskusikan untuk kebutuhan anak untuk dilibakan pada setiap kegiatan C. Menyiapkan orangtua untuk mengantisipasi adanya perubahan perilaku D. Mendiskusikan kesiapan fisik dan psikologis untuk toilet training E. Mempersiapkan kehadiran adik baru 194. Seorang bayi perempuan berusia 5 bulan, dibawa oleh ibunya ke klinik anak untuk tujuan imunisasi, riwayat kelahirannya normal dengan BB lahir 3,2 Kg, PB 49 cm.

Sebelum diimunisasi, perawat melakukan pengkajian pada bayi tersebut. Berapa berat badan minimal yang seharusnya dicapai pada usia tersebut ? A. 5,7 Kg B. 6,4 Kg C. 7,2 Kg D. 7,4 Kg E. 8 Kg 195. Seorang anak laki-laki berusia 9 tahun, sudah mulai mampu berkompetisi dengan orang lain dan belajar bagaimana cara meraih suatu prestasi. Perkembangan psikososial apa yang ditunjukkan dengan kemampuan tersebut ? A. Percaya VS tdk percaya B. Industri VS inferiority C. Otonomi VS rasa ragu D.

Inititive VS rasa bersalah E. Preoperasional 196. Seorang anak perempuan berusia 14 bulan 20 hari, datang ke klinik tumbuh kembang, hari ini anak tersebut akan dievaluasi tumbuh kembangnya menggunakan format Kuesioner Pra Screening Perkembangan (KPSP). Dari 10 pertanyaan, anak tersebut mampu mengerjakan 7 pertanyaan dengan baik.

Berdasarkan interpretasinya, intervensi apa yang harus dilakukan pada anak tersebut ? A. B. C. D. E. Terus memberikan stimulasi untuk anak usia 15 bulan Lakukan stimulasi lanugo pada bayi baru lahir selama 2 minggu dan dites ulang Memberikan terapi perkembangan di bawah pengawasan spesialis Lanjutkan mengikuti progrm posyandu Menganjurkan orang tua untuk mengikuti sekolah anak berkebutuhan khusus 197.

Seorang bayi perempuan dengan usia 10 bulan, dibawa ke klinik tumbuh kembang oleh ibunya untuk berkonsultasi terkait perkembangan kemampuan motorik. Stimulasi kinetik yang sesuai untuk bayi tersebut adalah ? A. Melambungkan badannya naik dan turun B. Menggunakan ayunan atau stroller C. Menyokong untuk duduk sendiri D.

Memberikan mainan besar yang dapat didorong-dorong E. Menempatkan mainan diluar jangkauannya dan minta ia mengambilnya. 198. Seorang bayi laki-laki umur 3 hari, lahir dengan berat badan 2200 gram, usia gestasi 34 minggu, pengkajian saat ini terdapat banyak lanugo terutama di punggung, posisi testis satu masih dicanalis inguinalis, temperatur 35,50 C, APGAR score menit pertama 6, dan terpasang NGT.

Termasuk kedalam kondisi apakah pasien tersebut? a. b. c. d. e. Prematur- tanpa asfiksia Prematur- asfiksia ringan Prematur- asfiksia sedang Prematur- asfiksia berat Prematur- asfiksia sangat berat 199. Seorang bayi, usia 4 hari dengan diagnosis palato schizis di rawat di ruang rawat inap. Hasil pengkajian saat ini kesadaran compos mentis, tanda-tanda vital : temperatur 36,6 0C denyut nadi 120x/m, frekuensi napas 40x/m, berat badan 2690 gr, terdapat celah dilangit-langit mulut, reflek rooting (+), reflek sucking (+), sesak (-).

Pasien direncanakan akan dilakukan pemasangan obturator (langitlangit mulut buatan) Apakah masalah keperawatan utama pada pasien tersebut? A. B. C. D. E. 200. Risiko nutrisi : kurang dari kebutuhan Risiko tinggi terjadinya aspirasi Risiko tinggi terjadinya infeksi Cemas pada orangtua Gangguan oksigenasi An X usia laki-laki 8 tahun mengalami penganiayaan fisik, dilakukan pengkajian dengan data terdapat luka pada kepala, dan lebam pada muka dada dan tangan, ekspresi anak tampak ketakutan dan menangis dengan menutupi mukanya, badan anak tampak kurus dan baju kotor tidak terawat, tetangga membawa anak ke RS dan didapatkan data bahwa anak sering dipukul, tidak diberi makan dan ditelantarkan oleh bapaknya.

Kondisi apakah yang terjadi pada anak berdasarkan kasus diatas a. Penganiayaan fisik b. Penelatara atau Neglect c. Emotional Abuse d. Physical Abuse e. Child abuse 201. An. X usia 13 bulan dengan diagnosa medis kejang demam, dilakukan pengkajian S 39,10C, extremitas teraba dingin dan tampak cyanosis, tidak terdapat sesak, ibu anak mengatakan sudah melakukan pemberian kompres, anak baru pertama mengalami kejang, kejang terjadi pada tangan dan wajah kurang lebih 10 menit, anak sebelumnya mengalami batuk pilek, anak dan keluarga tidak mempunyai riwayat epilepsi Apakah implementasi yang dapat dilakukan pada anak berdasarkan kasus diatas a.

Pemberian kompres ulang b. Memberikan oksigen c. Melakukan observasi TTV tiap 4 jam d. Melakukan pemasangan infus e. Melakukan kolaborasi pemberian antipiretik 202. By. X, BBLdengan BB 1500 kg, badan klien masih terdapat vernik caseosa, RR 88x/menit, terdapat pernafasan cuping hidung dan retraksi dada O2 1 L/menit terdengar ronchi dan wheezing pada lapang paru, klien mendapat therapy antibiotic 130 mg dan therapy atrovent 1 cc + bisolvon 1 cc + 1 cc NaCl Apakah tindakan pertama yang dapat dilakukan pada bayi berdasarkan kasus diatas a.

b. c. d. e. Melakukan mandi minyak Melakukan pemberian nebulezer Melakukan pemberian antibiotik Memasukan bayi ke dalam inkubator Melakukan pembedongan pada bayi 203. Seorang anak laki-laki berusia 5 tahun penderita TB paru mengalami kesulitan bernafas, hasil pemeriksaan fisik pernafasan : 35 x/menit, auskultasi paru rocnhi di kedua lobus paru.

Apakah prioritas tindakan yang harus dilakukan untuk mengatasi masalah tersebut ? a. Berikan hidrasi b. Lakukan suction c. Lakukan nebulasi d. Lakukan postural drainase e. Lakukan clapping, vibrasi, dan batuk efektif 204. Seorang bayi laki-laki usia 1 bulan dirawat di ruang anak mengalami diare, hasil pemeriksaan fisik di dapatkan hasil BAB lebih dari 10 kali, konsistensi cair, suhu tubuh : 38oC, bayi tampak lemas, ubunubun tampak cekung. Apakah prioritas tindakan keperawatan yang harus dilakukan?

a. Berikan diet lunak b. Berikan terapi cairan c. Berikan terapi analgetik d. Berikan terapi antibiotic e. Berikan terapi antipiretik 205. Seorang anak perempuan usia 10 tahun menderita gizi buruk di rawat di ruang anak rumah sakit umum daerah. Hasil pemeriksaan fisik di dapatkan pernafasn : 30 x/menit, suhu : 38oC, ronchi positif di lobus kanan. Hasil pemeriksaan laboratorium Hb : 10, hasil biakan sputum positif TB paru. Apakah masalah keperawatan utama pada kasus di atas ?

a. Pola nafas tidak efektif b. Peningkatan suhu tubuh c. Perfusi jaringan inefektif d. Bersihan jalan nafas tidak efektif e. Nutrisi kurang dari kebutuhan tubuh 206. Seorang bayi laki-laki usia 3 bulan belum pernah di imunisasi dengan alasan jika di imunisasi akan menimbulkan sakit dan cacat, ayah bayi tersebut menderita TBC.

saat petugas kesehatan datang kerumah sang ibu sangat cemas dengan memegang erat bayinya dan mengatakan tidak ingin di imunisasi, Saat di berikan pengarahan oleh petugas orangtua mau bayinya di imunisasi.

Apakah tindakan yang harus dilakukan petugas sebelum imunisasi dilakukan? a. b. Menyiapkan vaksin Memberikan vaksin c. Melakukan tes mantuk d.

Memberikan penjelasan e. Memberikan pendidikan kesehatan 207. Seorang bayi perempuan berusia 3 bulan sudah waktunya datang ke posyandu untuk di berikan imunisasi, namun orangtua bayi tidak datang ke posyandu, akhirnya para kader mendatangi kediaman orangtua bayi tersebut. Saat dilakukan wawancara dengan ibu, ibu mengatakan tidak tahu kalau anaknya harus di imunisasi lagi, status imunisasi bayi telah mendapatkan imunisasi BCG, HB 0, POLIO 1, DPT/HB 1 Apakah Diagnosa keperawatan utama yang muncul pada kasus tersebut?

a. b. Resiko tertular penyakit berhubungan dengan ketidaklengkapan status imunisasi Kurang pengetahuan orangtua tentang jadwal imunisasi berhubungan dengan kurang terpaparnya informasi c. Kurang pengetahuan orangtua tentang manfaat imunisasi berhubungan dengan kurang terpaparnya informasi d.

Cemas orangtua berhubungan dengan kurangnya pengetahuan orangtua e. Ketidaklengkapan status imunisasi berhubungan dengan kurang terpapar dengan informasi 208. Seorang anak perempuan usia 10 tahun mengalami gangguan pernafasan, pada saat diauskultasi terdapat suara ronchi di kedua paru dan mengalami retensi sekresi dan gangguan oksigenasi yang memerlukan bantuan untuk mengencerkan atau mengeluarkan sekresi.

Apakah Intervensi yang tepat dilakukan pada kasus tersebut? a. Suction b. Inhalasi c. Nebulasi d. Batuk efektif e. Fisioterapi dada 209. Seorang bayi usia 3 bulan dirawat di ruang rawat anak dengan diagnose medis hirschprung diseases. Hasil pemeriksaan diperoleh distensi abdomen, suhu 37,3oC, nadi 110 x/menit dan pernafasan : 42 x/menit.

Pasien sering mengalami kesulitan BAB, Dokter menyarankan pasien dioperasi, orang tua menolak karena faktor biaya. Perawat dan Dokter menyerahkan keputusan tindakan pada anak kepada orang tuanya. Apakah bentuk aspek etik yang diperhatikan oleh perawat dan dokter dalam kasus tersebut ? a. Justice b. Fidelity c. Beneficience d. Non Maleficience e. Respect for Autonomy 210. Seorang Anak Laki-laki berumur 16 tahun dengan diagnose medis Appendiksitis akut perforasi.

Pasien post appendiktomy cyto dirawat di ruang rawat anak. Hasil pemeriksaan pasien bedrest, menolak berubah posisi, pasien mengeluh nyeri pada area luka post operasi seperti ditusuk-tusuk.

Tekanan Darah 130/90 mmHg, suhu 38oC, pernafasan 30x/menit dan nadi 116 x/menit. Apakah intervensi utama yang akan anda lakukan untuk kasus tersebut? a. Melakukan kompres hangat b. Mengajarkan latihan mobilisasi post operasi c. Melakukan kolaborasi pemberian obat penurun panas (antipiretik) d. Melakukan pengelolaan manajemen nyeri non farmakologis dan farmakologis e. Memberikan pendidikan kesehatan pentingnya nutrisi untuk penyembuhan luka operasi 211.

Seorang baayi perempuan berumur 4 bulan, dirawat di ruang rawat bedah anak dengan diagnose atresia ani post colostomy 2 bulan yang lalu. Orang tua mengatakan setelah pernah diajarkan perawatan luka operasi colostomy 2 bulan yang lalu sebelum pulang. Hasil pemeriksaan, stoma terlihat kotor, kulit sekitar stoma berwarna kemerahan, iritasi, timbul fistula, perawatan di rumah menggunakan popoksuhu 37,6oC, RR 31 x/menit nadi 118 x/menit.

Apakah diagnosa keperawatan yang tepat berdasarkan kasus tersebut? a. Resiko infeksi berhubungan dengan kolostomi b. Nyeri berhubungan dengan adanya luka kolostomi c. Hipertermi berhubungan dengan infeksi local kolostomi d.

Gangguan intergritas kulit berhubungan dengan perawatan kolostomi e. Deficit knowledge orang tua berhubungan dengan kurangnya paparan informasi 212. Bayi B usia 2 tahun sudah 2 hari dirawat di ruang anak, menurut ibu bayi dibawa ke RS dengan keluhan sulit BAB, ada riwayat sering menggunakan pencahar supaya mudah BAB, BAB keluar sedikit berbentuk pita, sudah 1 minggu belum BAB serta anak sulit makan, pemeriksaan fisik menunjukkan perut kembung dan lubang anus terasa menjepit, berat badan saat ini 4 kg, frekuensi nafas 25x menit, frekuensi nadi 128x/menit.

Apakah implementasi untuk mengatasi masalah prioritas kasus di atas? a. Pemasangan rectal tube b. Pemberian infus cairan N4 c. Lakukan pemberian oksigen d. Pemberian nutrisi yang lunak e. Pemasangan naso gastric tube 213. Seorang bayi perempuan berumur 4 hari dibawa ke Instalasi gawat darurat oleh ibunya dalam keadaan lemah, hasil pemeriksaan fisik BB 2092 gram dan BB lahir 2200 gram, bayi malas minum dan terlihat kuning pada wajah dan matanya, reflek menghisap lemah, nadi : 138 x/menit, pernafasan 44 x/menit, suhu : 36,7oC, hasil pemeriksaan laboratorium kadar bilirubin total 16 gr/dl.

Apakah intervensi yang dapat dilakukan untuk menurunkan kadar bilirubin berdasarkan kasus tersebut? a. b. c. d. e. Pemberian Oksigen Pemeriksaan foto rontgen Pemberian terapi sinar UV Pemberian fototherapi bluelight Pemberian cairan dan elektrolit 214.

Perawat Y sedang berdiskusi dengan psikolog, terapis, dan dokter spesialis anak dalam merawat An. B dengan autis untuk menentukan tindakan yang tepat pada kliennya Saat ini lanugo pada bayi baru lahir Y sedang berperan sebagai a. Advocasi b. Pendidik c. Restorative role d. Kolaboratif e. Pengambil keputusan 215. An.A, usia 2 tahun dibawa orangtuanya ke poliklinik anak, dengan keluhan utama sering BAB 3-4 x sehari, dengan konsistensi cair, dan ada darah berwarna merah marun.

Anak rewel, lesu, suhu tubuhnya 380 C, turgor kulit kembali lambat. Apakah diagnosa medis yang paling tepat pada kasus diatas? a. b. c. d. Diare. Disentri. Demam berdarah. Influenza. e. Dehidrasi. 216. Bayi laki-laki usia 8 bulan dibawa oleh ibunya ke Puskesmas untuk melakukan imunisasi.

Pada pemeriksaan didapatkan hasil yaitu berat badan 9 kg, suhu tubuh 36,8ºC, pernafasan 20x/menit, sebelumnya telah mendapatkan imunisasi BCG, DPT I dan Polio 2.

lanugo pada bayi baru lahir

Apa imunisasi yang harus diberikan sekarang? a. DPT II Polio II b. DPT II Polio III c. DPT II Polio IV d. DPT III Polio III e. DPT III Polio IV 217. Seorang anak laki-laki yang berusia 11 bulan dibawa oleh ibunya ke Poli Thalasemia dengan keluhan mudah sakit, wajah yang pucat, sklera anemis.

Hasil pemeriksaan laboratorium Hb 5 gr/dl, diagnosa medis Thalasemia Apakah implementasi utama yang dilakukan? a. Memberikan cairan infus b. Memberikan transfusi darah c. Memberikan nutrisi yang adekuat d. Memberikan informasi yang benar e. Memberikan Penyuluhan kesehatan tentang penyakit Thalasemia. 218. Bayi baru lahir akan mengeluarkan tinja pertamanya (mekonium) dalam 24 jam pertama, namun pada bayi yang menderita penyakit Hisprung (akibat dari kelumpuhan usus besar dalam menjalankan fungsinya), maka tinja tidak dapat keluar, tinja akan keluar terlambat atau bahkan tidak dapat keluar sama sekali.

Selain itu perut bayi juga akan terlihat menggembung, disertai muntah. Jika dibiarkan lebih lama, berat badan bayi tidak akan bertambah dan akan terjadi gangguan pertumbuhan.

Apakah tindakan bedah sementara pada Bayi tesebut ? a. Kolostomi b. Colok dubur c. Atresia ani d. Operasi besar e. Laparatomi 219. Seorang bayi perempuan berusia 8 bulan dibawa ibunya berobat ke poliklinik anak dengan keluhan sejak 2 minggu terakhir bayi BAB 4 – 5 x/hari dengan keluaran sisa makanan yang belum tercerna dengan baik.

Ibu bekerja sebagai guru, memberikan asi 1 x sebelum bekerja dan 3 – 4 kali sepulang bekerja. Sehari-hari bayi diurus oleh neneknya dengan pengaturan makan pemberian bubur susu 3x/hari dan sari jeruk peras 2 x/hari, susu buatan 3x/hari. Apakah anjuran yang paling tepat saudara berikan pada ibu bayi? a. Pemberian bubur susu dihentikan b. Pemberian sari jeruk peras dihentikan c. Pemberian susu buatan dihentikan d.

Pemberian asi dilanjutkan dengan frekuensi ditambah e. Pemberian asi dihentikan karena tidak efektif 220. Seorang anak umur 2 tahun dibawa orang tuanya ke poli anak dengan keluhan BAB 4 kali dalam 1 hari, muntah 3 kali dalam satu hari, tidak ada napsu makan dan tidak bisa tidur. Hasil dari pengkajian didapatkan suhu 38 0 c, turgor jelek, mukosa kering Apakah masalah keperawatan utama pada kasus tersebut?

a. b. c. Gangguan cairan dan elektrolit Gangguan Nutrisi Gangguan rasan nyaman d. Gangguan istirahat e. Gangguan hospitalisasi 221. Seorang ibu membawa anaknya yang berusia 2 tahun periksa di UGD karena Diare sudah 2 hari. Hari ini b.a.b cair sudah 5 kali. Hasil pemeriksaan didapatkan : Anaknya tampak lemah, mata cekung, mukosa bibir kering, turgor kembali lambat, dan agak rewel. Pada saat ditimbang BB ; 12 Kg.

Berapakah kebutuhan cairan Anak tersebut ? a. 1100 cc b. 1210 cc c. 1232 cc d. 1344 cc e. 1050 cc 222. Seorang anak laki-laki berusia 24 bulan dirawat di rumah sakit dengan keluhan sering rewel. Pada pemeriksaan fisik diketahui badan kurus dan perut buncit. Pemeriksaan antopometri menunjukkan berat badan 7 kg dan panjang badan 75 cm. Berapa kilogram penambahan berat anak tersebut agar mencapai berat ideal ?

a. 2,8 kg b. 3 kg c. 3,5 kg d. 5 kg e. 6,5 kg 223. Seorang bayi laki-laki baru saja lahir di RSU. Kondisi bayi 5 menit setelah lahir setelah dilakukan penghisapan lendir adalah badan merah kaki biru, detak jantung 88 x/mnt, menangis lemah, ekstrimitas sedikit fleksi, tonus otot kurang baik dan usaha bernafas lambat/lemah. Berapa nilai APGAR Score pada bayi tersebut ?

a. b. c. d. e. 4 5 6 7 8 SOAL GERONTIK 1. Seorang laki-laki berusia 75 tahun yang tinggal di panti X terlihat lemah dan kurang bersemangat. Pada saat dikaji mengenai status emosional, ia mengeluh susah tidur tetapi tidak merasa gelisah atau khawatir.

Apakah yang harus dikaji lebih lanjut oleh perawat? a. Menanyakan apakah klien merasa kesepian? b. Menanyakan kebiasaan apa yang dilakukan jika susah tidur? c. Menanyakan hal apa yang membuat klien mengalami susah tidur ? d. Menanyakan apakah keluhan baru dirasakan sejak seminggu yang lalu? e. Menanyakan apakah menggunakan obat tidur atau penenang atas anjuran dari dokter? 2. Seorang perempuan berusia 65 tahun datang bersama anaknya ke klinik mata. Anaknya mengeluhkan bahwa ibunya sudah mengalami penurunan penglihatan.Ibu tersebut memiliki riwayat penyakit diabetes melitus sejak 10 tahun yang lalu.

Apakah masalah keperawatan yang menjadi prioritas? a. Kecemasan b. Potensial mengalami injury c. Perubahan persepsi sensori (penglihatan) d. Defisit pengetahuan:efek dari diabetes terhadap mata e. Defisit perawatan diri parsial 3. Seorang laki-laki berusia 70 tahun tinggal bersama istri anaknya.

Ia mengalami stroke sejak 2 tahun yang lalu sehingga harus bedrest. Manakah kategori yang tepat bagi lansia tersebut jika dilihat berdasarkan KATZ indeks? a. Kategori C b. Kategori D c. Kategori E d. Kategori F e.

Kategori G 4. Seorang perawat gerontik (45 tahun) sedang merencanakan intervensi seorang lansia dengan usia 70 tahun dengan gangguan pola istirahat tidur di Panti Wreda Jalaksana Kabupaten Kuningan. Intervensi yang sesuai di lakukan pada lansia dengan gangguan tidur adalah? A. Berolahraga di pagi hari B. Hindari makanan yang mengandung cafein C. Mandi air dingin sebelum malam D.

Menjaga kebersihan diri E. Upaya pencegahan terhadap batuk 5. Perawat Gerontik sedang melakukan intervensi pada Lansia di sebuah Panti Wreda Sidamulya Kabupaten Kuningan dengan diagnosa Ansietas berhubungan dengan ketidak mampuan menyesuaikan krisis situasi kanker “mendorong klien untuk mengungkapkan pikiran dan perasaan”.

Rasionalisasi terhadap intervensi di atas yang sesuai adalah ? a. Membantu dalam identifikasi rasa takut dan kesalahan konsep berdasarkan pada pengalaman kanker b.

Memberikan kesempatan untuk eksplorasi rasa takut yang realistis serta kesalahan konsep tentang diagnosis c.

Memberikan keyakinan bahwa pasien tidak sendiri d. Penyimpangan sensori dapat terjadi nilai stimulasi sehingga memperberat perasaan ansietaS e. Ketrampilan koping sering rusak setelah diagnosis terjadi 6.

Seorang lansia di Desa Sukamukti Kabupaten Kuningan sedang mengalami masalah kesehaan TBC dengan gangguan pola napas di rumah .Salah satu intervensi yang di lakukan adalah edukasi stop rokok dan selama edukasi perawat akan mengobservasi perilaku adaptif dan merubah perilaku mal adaftif dari lansia tersebuT Model keperawatan yang mana di pakai perawat di atas?

A. Imogene. M. King B. Roy (1976) C. D. E Orem D. Betty neuman E. Neuman 7. Perawat lansia di sebuah panti Werdha mengidentifikasi satu permasalahan kesehatan lansia yang menjadi masalah kesehatan 75 % lansia di Panti tersebut salah satunya adalah ; Arthtitis. Pada saat Intervensi apa yang dapat di lakukan sebagai tindakan untuk mengurangi gangguan Arthtitis?

a. Kurangi garam, kontrol berat badan b. Kontrol Berat badan, Exercise c. Stop rokok d. Intake kalsium, Exercise e. Diet rendah lemak 8. Seorang perawat Gerontik sedang mempersiapkan prosedur Terapi Validasi pada lansia yang mengalami konfusi berat dan disorientasi di panti Wreda Sangkanerang Kabupaten Kuningan. Hal penting apa yang perlu di lakukan oleh perawat dalam melakukan terapi tersebut?

a. Menunjukan realitas dan menemukan arti di balik prilaku lansia tersebut b. Membuat ukuran, struktur, proses, tujuan dan kegiatan kelompok c. Melakukan upaya agar pengunjung tidak mempersingkat lanugo pada bayi baru lahir ke lansia d. Menjaga agar pertemuan dengan perawat cukup singkat untuk mencegah kepenatan (20 menit) e.

Memilih partisipan yang dapat berpartisipasi dalam diskusi 9. Seorang perawat melakukan intervensi keperawatan pada lansia dengan gangguan pencernaan dan nutrisi. Apa saja yang perlu di perhatikan oleh perawat `dalam proses intervensi dengan gangguan pencernaan dan nutrisi sbb: A. Anjurkan untuk mengkomsumsi obat Kusia B. Anjurkan menggunakan obat-obat pencahar C. Merangsang produksi saliva dengan makanan yang tdk mengandung gula D.

Penyuluhan urgensi defekasi harus setiap hari E. Hindari pemakaian fluor 10. Terapi Validasi Adalah salah satu terapi yang di terapkan pada lansia yang mengalami konfusi berat dan disorientasi. Hal penting apa yang perlu di lakukan oleh perawat dalam melakukan terapi tersebut?

a. Menunjukan realitas dan menemukan arti di balik prilaku lansia tersebut b. Membuat ukuran, struktur, proses, tujuan dan kegiatan kelompok c. Melakukan upaya agar pengunjung tidak mempersingkat kunjunganya ke lansia d. Menjaga agar pertemuan dengan perawat cukup singkat untuk mencegah kepenatan (20 menit) e. Memilih partisipan yang dapat berpartisipasi dalam diskusi 11. Seorang laki-laki berusia 75 tahun sedang menjalani masa perawatan di Panti Wredha, sudah semenjak 4 hari yang lalu mengeluh mual dan muntah, saat ini setiap diberikan 1 porsi makanan, klien hanya menghabiskan ¼ porsi saja.

Aktivitas saat ini yang sering dilakukan oleh pasien hanya terbaring lemah di tempat tidur. Aktivitas dan rutinitas lainnya tidak bisa diikuti oleh pasien. Apakah aspek lain yang sangat penting harus dikaji pada pasien tersebut ?

A. Riwayat kesehatan sebelumnya B. Riwayat kesehatan keluarga C. Jenis dan Pola makan D. Aktivitas kegiatan sehari-hari E. Pola istirahat 12. Seorang laki-laki berusia 75 tahun sudah berada di Panti Rukun Ibu selama 2 bulan. Menurut dokter, pasien didiagnosis mengalami Rematik. Berdasarkan hasil pengkajian tingkat kemandirian (Katz Index) didapatkan: dalam memenuhi kebutuhannya pasien dikategorikan mandiri dalam semua hal, kecuali mandi, berpakaian, ke kamar kecil, dan satu fungsi yang lain.

Apakah kategori Katz Index untuk pasien tersebut ? A. C B. D C. E D. F E. G 13. Dari hasil pengkajian terhadap seorang pasien perempuan berusia 80 tahun yang sudah dirawat dipanti selama 4 tahun, didapatkan data sebagai berikut: pasien terlihat bingung, cemas, paranoid, gelisah, mudah tersinggung 14. 15. 16. 17. 18. dan marah, tidak konsentrasi, sulit untuk memecahkan persoalan, pasien mengatakan sudah mengalami kemunduran dalam merasakan rasa makanan. Apakah diagnosis keperawatan yang tepat untuk kasus diatas ?

A. Sindrom stress relokasi B. Perubahan proses pikir C. Perubahan persepsi-sensori D. Kurang pengetahuan (kebutuhan belajar) mengenai kondisi, prognosis, dan pengobatan E. Ketidakefektifan koping individu Seorang perempuan berusia 63 tahun tinggal sendiri di rumahnya dan mempunyai riwayat hipertensi, nyeri leher dan punggung.

Hasil pengkajian didapatkan tekanan darah 180/110 mmHg, denyut nadi 88x/menit, respirasi 26x/menit. Pasien sering merasa sedih dan khawatir sampai akhirnya mengalami gangguan tidur karena tidak bisa melakukan pekerjaan rumah tangga dan tidak dapat bersosialisasi dengan lingkungannya.Apakah tindakan keperawatan yang tepat untuk klien di atas?

A. Mengkaji tingkat kemandirian klien B. Mengkaji kemampuan kognitif klien C. Mengkaji status psikologis klien D. Mengkaji Status Mental (SPMSQ/Short Portable Mental Status Questionare) E. Mengkaji barthel indeks klien Seorang perempuan berusia 68 tahun mengatakan saat ini sendi-sendi tangan dan jari terasa linu-linu, demikian juga panggul, pinggang dan kaki terasa sakit dan tidak kuat untuk berdiri lama.

Menurut pasien ketika bekerja seperti mencuci baju atau peralatan makan dan menyapu sering terasa mudah lelah. Keluhan tersebut sudah dirasakan oleh pasien selama kurang lebih satu tahun. kasus di atas berapakah nilai tingkat kemandirian klien? A. Tingkat kemandirian B B. Tingkat kemandirian E C. Tingkat kemandirian A D.

Tingkat kemandirian D E. Tingkat kemandirian C Klien laki-laki berusia 75 tahun masuk panti wreda dalam keadaan post stroke 2 bulan yang lalu, Klien mengalami kelumpuhan pada ektremitas kanan, sehingga perlu bantuan pemenuhan kebutuhan sehari-hari.

Apakah tindakan yang paling tepat bagi Klien tersebut? a. Memberikan kursi roda b. Melatih pergerakan sendi c. Memijat daerah ektremitas d. Memotivasi untuk ambulasi e. Memberi kebutuhan penuh Klien lanjut usia dalam keluarga binaan perawat, yang mengalami kasus diabetes memiliki kulit yang sangat kering pada kaki dan ekstremitas bawah.

Untuk mempertahankan kulit yang utuh keluarga bertanya pada perawat .Manakah intervensi yang harus diberikan oleh perawat pada kelurga? a. merendam kakinya dengan sering ke air hangat. b. menggunakan losion tanpa pewangi. c. menggunakan bedak kaki d. menghindari stoking elastis setinggi lutut. e. memberikan Penkes kepada seluruh masyarakat Klien berusia 80 tahun dengan kesadaran penuh dipindahkan ke fasilitas perawatan jangka panjang oleh keluarganya.

Pada malam kedua klien menjadi bingung dan tidak mengenali keluarganya. Pertanyaan soal : Diagnosa keperawatan apa yang paling sesuai dengan kasus di atas?

a. kurang pengetahuan b. gangguan memori. c. gangguan sensori persepsi d. perubahan proses pikir. e. Devisit perawatan diri 19. Seorang keluarga klien mengatakan kepada Anda bahwa, dalam budaya lanugo pada bayi baru lahir orang meninggal tidak boleh ditinggalkan seorang diri sebelum penguburan. Kebijakan rumah sakit menyatakan bahwa setelah jam 6 sore saat kamar jenazah ditutup, tubuh disimpan dialat pendingin kamar jenazah rumah sakit sampai hari berikutnya.

Pertanyaan soal : Bagaimana cara terbaik untuk mengatasi pada keluarga yang di tinggalkan? a. b. c. d. e. menjelaskan kebijakan rumah sakit kepada keluarga secara lembut. bertanya kepada pemilik rumah sakit mengenai kebijakan yang dapat diberikannya. menghubungi dokter klien untuk meminta saran. pindahkan jenazah keruang kosong dan tugaskan seorang asisten untuk menemaninya. menganjurkan kepada klien untuk meningkatkan kemampuan sistem imun 20.

Saat menunggu kedatangan keluarga dari klien yang sudah meninggal, jadwal dinas telah berganti. Perawat yang akan dinas belum pernah bertemu dengan kelurga dari klien yang meninggal dunia. Pertanyaan soal : Bagaimana cara perawat untuk menyatakan rasa simpati pada situasi tersebut?

a. b. c. d. 21. “saya ikut berduka atas kehilangan yang anda rasakan”. “saya akan membwa anda masuk untukmelihat jenazahnya”. “saya tidak tahu keluarga anda, tetapi saya yakin anda adalah orang yang sabar” “Berapa lama anda ingin terus menerus mengalami kesedihan keluarga yang sudah meninggal” e”saya rasa kita semua kehilangan” 22.

Perawat panti saat berkunjungan ke panti wreda x lanugo pada bayi baru lahir klien dengan kelainan obstruktif pulmonari kronik yang membutuhkan oksigen saat kunjungan tersebut. Pernyataan apa yang mengindikasikan klien membutuhkan pengajaran untuk penggunaan oksigen di rumah? a. saya membasahi bibir dan hidung dengan jeli b. saya memastikan masker oksigen terpasang kencang sehingga tidak lepas saat bernafas c. saya memasang tanda “dilarang merokok” di pintu masuk kamar saya d.

saya membersihkan masker dengan air setelah makan e. saya rasa anda perlu istirahat untuk meningkatkan stamina 23. Tn X berusia 72 tahun mengeluh sesak nafas setelah berolahraga lari pada sore hari. Klien mengeluh tubuhnya terasa dingin, denyut nadi tidak teratur. Hasil wawancara : klien memiliki riwayat hipertensi sejak 5 tahun yang lalu. Apakah tindakan keperawatan prioritas akan anda berikan?

a. Memberikan oksigen sesuai dosis b. Menganjurkan lanjut usia untuk bedrest c. Memberikan posisi semi fowler d. Menganjurkan lanjut usia istirahat. e. Memberikan perhatian pada klien 24. Ketika anda membawa obat ke pasien, ia melihat dan berkata ”Saya pikir, saya telah meminum obat tersebut. Perawat lain membawakan obat yang terlihat sama seperti ini.” Respon terbaik untuk meyakinkan pasien dalam situasi tersebut adalah? Pilihan jawaban a. “Tidak, anda belum mendapatkan obat ini.” b.

”Anda pasti bingung dengan obat kemarin. Silahkan, jangan khawatir diminum saja.” c. ”Saya yakin anda belum mendapatkan obat ini, tapi saya akan kembali dan cek untuk kepastianya” d.

”Saya telah mengecek sebelumnya, maka anda tidak perlu khawatir.” e. “Saya rasa perlu minum obat ini 25. Seorang klien berusia 70 tahun control rawat jalan karena hipertensi bersama anaknya. Klien sudah memiliki tanda – tanda penurunan fungsi kognitif, ditandai dengan sering lupa terhadap hari atau meletakan kaca mata. Pertanyaan soal : Untuk menjaga keamanan pengobatan hipertensi, apakah hal terpenting yang harus diajarkan kepada keluarga? a. Cara minum obat yang Aman b. Memberikan obat untuk satu kali minum dalam tempatnya.

c. Memberikan nomor obat sesuai tanggal dan waktu minum obat. d. Memantau klien minum obat. e. Menghubungi dokter untuk memerintahkan 26. Panti wreda W dihuni 12 lansia laki – laki, belum memiliki program kegiatan yang melibatkan lansia secara aktif. Saat pengkajian 7 lansia mengalami hipertensi dan 5 lansia mengalami sakit kepala disertai kaku kuduk. Hampir semua penghuni panti wreda W menyatakan bosan dengan kehidupan dipanti.

Apakah masalah keperawatan lansia dipanti wreda tersebut. a. Manajemen panti tidak adekuat b. Kasus hipertensi meningkat c. Resiko cedera d. Stress psikososial. e. Resiko Kehilangan Related Documents
Kebanyakan dari ibu hamil, hanya memiliki sedikit pengetahuan tentang perkembangan janin dari minggu ke minggu.

Akibatnya adalah ibu hamil tidak tahu apakah janinnya tumbuh sehat ataukah justru menjadi janin tidak berkembang. Memang dari minggu ke minggu janin akan berkembang.

Mulai dari segumpal darah sampai membentuk janin atau bayi dengan organ yang sempurna. Ibu hamil sendiri memegang peranan yang sangat penting untuk perkembangan janin yang ada di dalam kandungannya. Ibu hamil harus selalu memeriksakan kandungannya serta mendukungnya menggunakan nutrisi dan makanan yang sehat. Berikut ini akan kami ulas tentang pertumbuhan janin yang sehat selama kehamilan, dalam periode waktu : Perkembangan Janin 1 Bulan Perkembangan Janin Minggu ke-1 -4: Bulan 1 Perkembangan Janin Minggu Ke-4 (1 Bulan) Kehamilan baru bisa di deteksi jika usia kehamilan sudah mencapai usia 4 minggu.

Meski ada ibu hamil yang bisa mendeteksi kehamilan sebelum usianya 4 minggu, namun dokter kandungan baru bisa menyatakan bahwa ibu hamil tersebut benar-benar hamil jika usia kandungannya sudah 4 minggu.

Dokter kandungan akan menyuruh ibu hamil tersebut kembali lagi jika selama 4 minggu atau lebih jika belum mendapatkan menstruasi. 1. Perkembangan di Dalam Rahim Saat hamil usia 4 minggu, akan ada proses pembentukan embrio dan bakal janin di dalam rahim. Lanugo pada bayi baru lahir ini proses pembentukan embrio yang ada di dalam rahim : • Embrio atau bakal janin telah tumbuh di dalam rahim ibu. • Ukurannya baru sebiji kacang hijau.

Bahkan jika dilakukan USG maka hanya akan terlihat seperti setitik gumpalan darah. • Otak, tulangg punggung, tulang belakang dan juga syaraf mendapatkan perkembangan dan berada di lapisan atas.

• Sel plasenta mulai ada. • Sel plasenta membentuk jaringan mikrokopis. • Plasenta mampu memberikan nutrisi kepada embrio di dalam rahim. 2. Yang Dirasakan Ibu Hamil Ciri ciri orang hamil saat usia 4 minggu, ibu hamil akan merasakan bad mood. Mudah marah dan tersinggung, sangat sensitif terhadap perkataan dan bau-bau yang ada di sekitarnya.

Ibu hamil juga akan merasakan hal-hal di bawah ini : • Mual • Malas • Pusing • Kepala berat • Pegal-pegal seperti sebelum menstruasi • Kram juga dirasakan ibu hamil • Jumlah lendir lebih banyak • Payudara terasa nyeri 3. Ukuran Janin Pada saat minggu keempat atau bulan pertama kehamilan. Janin baru memiliki ukuran setitik darah atau seukuran kacang hijau. 5. Organ Yang Terbentuk Perkembangan janin yang ada di dalam rahim saar berusia empat minggu sudah membentuk organ-organ di bawah ini : • Plasenta • Otak • Tulang punggung • Tulang belakang Perkembangan Janin Minggu ke 5 : Bulan 1 Perkembangan Janin Minggu Ke-5 (1 Bulan) Saat ibu hamil menggunakan tes pendeteksi kehamilan, hormon HCG pun sudah terdeteksi.

Jumlah garis yang dihasilkan berjumlah dua atau tes menunjukkan simbol positif. Segera kunjungi dokter untuk cara menjaga kehamlan agar tetap sehat, untuk mendapatkan vitamin asam folat dan prenatal yang sangat dibutuhkan oleh embrio anda. 1. Perkembangan di Dalam Rahim Proses yang ada di rahim mulai banyak.

Embrio yang dulunya hanya sekecil biji kacang hijau kini mulai berkembang dengan pesat. Berikut ini berbagai macam proses yang ada di dalam rahim : • Embrio sudah terhubung dengan aliran darah di dalam tubuh ibu hamil.

• Embrio jika diamati menggunakan USG, sudah berbentuk seperti kecebong. • Organ utamanya mulai tumbuh yaitu hati dan ginjalnya.

• Embrio juga sedang terbentuk usus buntu. • Tabung syaraf embrio sudah terbuka, tabung tersebut akan terhubung ke otak dan juga ke bagian sumsum tulang belakang embrio. • Tangan dan kaki juga sudah mulai muncul meski bentuknya masih seperti tunas tumbuhan yang masih kecil. • Mulut juga sudah ada, meski hanya membentuk lipatan kecil saja. • Hati sudah bisa berdebar. • Kerangka tubuh mulai terbentuk.

2. Yang Dirasakan Ibu Hamil Saat minggu ke-5 kehamilan, ibu hamil masih mengalami gangguan kehamilan morning sickness. Terutama ibu hamil dengan asam lambung tinggi. Mual, muntah dan pusing masih mendominasi ibu hamil. 3. Ukuran Embrio Ukuran janin masih seperti kecebong, sehingga belum bisa dipastikan berapa berat dari embrio tersebut.

Yang terlihat adalah panjang embrio. 4. Panjang Embrio Saat embrio berusia lima minggu, panjang embrio mencapai panjang 0,118 inchi. 5. Organ Yang Terbentuk Saat usia kandungan lima minggu, embrio sudah membnetuk organ seperti di bawah ini : • Kerangka tubuh • Hati dan ginjal • Jantung • Tabung syaraf • Tangan dan kaki meski masih kecil Perkembangan Janin Minggu ke-6 : Bulan 1 Perkembangan Janin Minggu Ke-6 (1 Bulan) Pada saat minggu ke-6, perkembangan janin menjadi sangat pesat.

Berikut ini adalah perkembangannya. 1. Perkembangan di Dalam Rahim Di dalam rahim bakal janin telah mengalami perkembangan dengan pesat.

Berikut ini proses perkembangan yang terjadi di dalam rahim : • Bakal janin telah memiliki denyut jantung, denyut jantungnya 150 denyutan per menit. Denyut jantung itu dua kali lipat dari denyut jantung manusia dewasa. • Embrio juga telah membentuk kepala dan otak yang berkembang di dalamnya. Otak terlihat lebih besar dibandingkan dengan bagian yang lainnya. • Lubang hidung mulai terbentuk. • Lubang telinga terbentuk. • Tangan dan kaki lebih panjang dibandingkan sebelumnya.

• Otot dan jaringan otot telah terbentuk di dalam rahim. 2. Yang Dirasakan Ibu Hamil Ibu hamil akan mengalami perubahan hormon. Sering merasa murung kemudian bisa mudah berganti dengan perasaan senang. Hal itu adalah normal dan merupakan akibat dari hormon yang telah mengalami fluktuasi.

Ibu hamil juga merasakan lebih emosional, namun ibu hamil harus bisa menahan emosi agar tidak terkena hipertensi. Ibu hamil mengalami penurunan berat badan dan area puting lebih gelap. 3. Ukuran Embrio Embrio belum bisa terdeteksi beratnya. Berat embrio baru akan terlihat saat usia kehamilan usia tujuh minggu.

4. Panjang Embrio Saat usia kehamilan memasuki usia 6 minggu, embrio akan memiliki panjang rata-rata 2-4 mm, diukur dari atas kepala embrio sampai dengan bokong. 5. Organ Yang Terbentuk Saat embrio berusia enam minggu, organ yang terbentuk adalah : • Jantung yang mulai berdetak. • Sistem pencernaan. • Saluran pernafasan. • Kaki dan tangan yang lebih panjang dibandingkan sebelumnya. Perkembangan Janin Minggu ke-7 : Bulan 1 Perkembangan Janin Minggu Ke-7 (1 Bulan) Saat usia embrio berusia tujuh minggu, embrio sudah memiliki berat dan memiliki ukuran yang lebih panjang dibandingkan sebelumnya.

1. Perkembangan di Dalam Rahim Berikut ini berbagai macam proses yang akan terjadi di dalam rahim. Proses tersebut adalah perkembangan embrio yang ada di dalam rahim ibu hamil : • Embrio telah berukuran sebesar kacang polong. • Lengan mulai membelah jadi dua dan lebih panjang.

Lengan telah membelah menjadi bahu dan tangan yang mungil. • Jantung juga telah terbagi bagiannya. Yaitu bilik kanan jantung maupun bilik kiris. • Paru-paru juga sudah terbagi menjadi bilik kiri dan bilik kanan.

• Selaput jari kaki dan jari tangan mulai terbentuk. 2. Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan mood yang sama saat usia kandungan memasuki usia ke-6 minggu.

3. Ukuran Embrio Saat usia tujuh minggu ukuran embrio seberat 0,8 gram. 4. Panjang Embrio Saat usia kehamilan tujuh minggu, panjang embrio sepanjang 5-13 mm. 5. Organ Yang Terbentuk Embrio dengan usia tujuh minggu mulai membentuk berbagai macam organ. Diantaranya adalah : • Lengan dan bahu • Jantung dengan bilik kanan dan bilik kiri • Saluran pernafasan • Paru-paru dengan bilik kanan dan bilik kiri • Selaput jari tangan dan jari kaki Perkembangan Janin 2 Bulan Perkembangan Janin Minggu ke-8 : Bulan 2 Perkembangan Janin Usia 8 Minggu (2 Bulan) Embrio sudah banyak berkembang di dalam rahim.

Melalui berbagai proses yang ada di dalam rahim, embrio mulai mengalami perkembangan pesat. 1. Perkembangan di Dalam Rahim Di dalam rahim mengalami berbagai macam proses berikut ini : • Gigi dan langit-langit mulut mulai terbentuk • Telinga terus mengalami perkembangan • Terbentuk jaringan kulit • Pembuluh vena dapat terlihat dengan jelas • Ujung hidung sudah mulai terlihat lanugo pada bayi baru lahir Kelopak mata mulai berkembang • Terbentuklah siku pada lengan embrio • Lidah mulai lanugo pada bayi baru lahir disertai dengan perkembangan bibir 2.

Yang Dirasakan Ibu Hamil Tanda tanda kehamilan pada usia ini dapat dirasakan hal-hal seperti : • Nyeri pada payudara • Keseimbangan cairan tubuh terganggu • Morning sickness • Rahim juga akan membesar mengkuti perkembangan embrio • Tertekannya kandung kemih sehingga buang air kecil lebih sering 3.

Ukuran Embrio Saat embrio berusia 8 minggu, embrio memiliki berat 2 gram. 4. Panjang Embrio Rahim membesar mengikuti panjang dan beratnya embrio. Perkembangan janin di usia 8 minggu, memiliki panjang sekitar 14-20 mm.

5. Organ Yang Terbentuk Organ embrio memiliki perkembangan yang pesat. Diantaranya adalah : • Kelopak mata • Saluran pernafasan lebih berkembang • Siku • Lubang hidung • Pembuluh darah vena • Gigi, mulut dan lidah • Langit-langit mulut Perkembangan Janin Minggu ke-9 : Bulan 2 Perkembangan Janin Usia 9 Minggu (2 Bulan) Saat usia kehamilan memasuki usia 9 minggu, embrio berkembang semakin pesat. Perkembangan itu diikuti dengan perubahan fisik dan psikis pada ibu hamil.

1. Perkembangan di Dalam Rahim Di dalam rahim akan terjadi berbagai macam proses berikut ini : • Telinga luar mulai terbentuk • Kaki dan tangan juga terus berkembang • Embrio mulai ditumbuhi dengan jari-jari kaki dan tangan • Embrio bergerak secara halus • Detak jantung bisa didengar oleh ibu melalui bantuan alat doppler 2. Yang Dirasakan Ibu Hamil Saat usia kehamilan memasuki usia 9 minggu, ibu hamil akan merasakan mudah lelah dan lesu. Olahraga ringan diperlukan untuk membantu stamina ibu hamil.

Selain itu, makanan sehat untuk ibu hamil perlu dikonsumsi setiap harinya. 3. Ukuran Embrio Janin berukuran 4 gram ketika usianya 9 minggu. 4. Panjang Embrio Embrio memiliki panjang sekitar 2,3 cm. 5. Organ Yang Terbentuk Embrio akan membentuk organ di bawah ini : • Jari tangan dan kaki • Telinga luar Perkembangan Janin Minggu ke-10 : Bulan 2 Perkembangan Janin Usia 10 Minggu (2 Bulan) Saat usia kehamilan memasuki usia 10 minggu, embrio atau bakal janin telah berubah menjadi janin.

Jika sudah menjadi janin, embrio tidak akan berbentuk seperti kecebong lagi. Namun sudah menyerupai manusia meski bentuknya masih kecil. 1. Perkembangan Embrio Kini bakal janin tidak bisa disebut dengan embrio lagi, namun sudah disebut dengan janin atau bayi. Janin mengalami perkembangan seperti di bawah ini : • Janin sudah aktif, lebih aktif daripada saat menjadi embrio. • Janin mampu menelan cairan. • Menendang kakinya. 2. Yang Dirasakan Ibu Hamil Ibu hamil masih merasakan mood yang berubah-ubah.

Janin juga bisa dirasakan di bagian tengah atas kemaluan ibu hamil. 3. Ukuran Janin Saat usia janin memasuki usia 10 minggu, dia memiliki berat 7 gram. 4. Panjang Janin Saat usia kehamilan 10 minggu, janin memiliki panjang 32 – 43 mm. 5. Organ yang Terbentuk Janin mulai membentuk organ-organ di bawah ini : • Fungsi ginjal, hati, otak dan usus sudah bekerja • Kepala terbentuk dan membesar hampir setengah dari panjang tubuhnya • Kuku Perkembangan Janin Minggu ke-11 : Bulan 2 Perkembangan Janin Usia 11 Minggu (2 Bulan) Saat usia dua bulan, janin akan mengalami banyak perkembangan dan perubahan pesat.

Panjang janin pun sudah semakin panjang dan juga semakin berat. 1. Perkembangan Janin Berikut ini berbagai proses perkembangan janin yang ada di dalam tubuh: • Tunas dari gigi muncul • Kaki terbelah menjadi dua yaitu bagian lutut telah terbentuk • Janin mulai menendang dan melakukan peregangan otot 2. Yang Dirasakan Ibu Hamil Tidak hanya psikis saja yang terlihat, namun juga perubahan fisik.

Perubahan fisik itu adalah munculnya garis gelap secara vertikal di perut ibu hamil. Ibu hamil juga susah tidur. 3. Ukuran Janin Janin dalam usia ini memiliki ukuran sebesar 8 gram. 4. Panjang Janin Panjang janin saat usia 11 minggu adalah 6,5 cm. 5. Organ Yang Lanugo pada bayi baru lahir Saat usia 11 minggu, janin akan membentuk berbagai organ di bawah ini : • Kuku • Lutut • Tunas gigi • Tulang ekor telah terbentuk Perkembangan Janin 3 Bulan Perkembangan Janin Minggu ke-12 : Bulan 3 Perkembangan Janin Usia 12 Minggu (3 Bulan) Janin dalam usia ini sudah bertambah panjang dan berat.

Bahkan pergerakan janin di dalam rahim pun semakin meningkat dan terasa. Berikut ini perkembangan janin di usia 12 minggu.

1. Proses Perkembangan Embrio Janin akan mengalami berbagai proses perkembangan di dalam rahim seperti berikut ini : • Sel motorik janin semakin terasah dan terasa • Janin akan menggeliat • Sel-sel syaraf yang ada di janin terhubung dengan sel syaraf di otaknya • Janin bisa menutup jari-jari tangannya • Mengepalkan otot matanya • Meringkuk 2. Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan sensasi yang luar biasa.

Sebab ibu hamil dengan perut yang tipis bisa merasakan pergerakan janin. Morning sickness mulai hilang dan ibu hamil mulai mendapatkan kembali nafsu makannya. 3. Ukuran Janin Ukuran janin seberat 14 gram. 4. Panjang Janin Panjang janin sekitar 63 mm. 5. Organ Yang Terbentuk Janin mulai terbentuk bagian-bagian organnya dan juga mendekati sempurna.

Organ yang terbentuk adalah : • Telinga mulai sempurna • Otot mata telah ada • Kelopak mata telah berfungsi Perkembangan Janin Minggu ke-13 : Bulan 3 Perkembangan Janin Usia 13 Minggu (3 Bulan) Berikut ini berbagai macam perkembangan janin saat usianya 13 minggu.

1. Proses di Dalam Rahim Janin saat usia 13 minggu sudah bisa melakukan berbagai macam proses di dalam rahim ibunya. Berikut ini berbagai macam proses yang dilalui dan dilakukan oleh janin : • Janin bisa menghisap otot-otot yang ada di dalam pipinya • Janin bisa bergerak memutar di rahim, apalagi ketika ibu hamil mengusap-usap perutnya 2.

Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan gejala-gejala di bawah ini : • Kelelahan • Pandangan mata berkabut • Sering buang air kecil • Perut ibu hamil mulai membesar dan membulat 3. Ukuran Janin Dalam usia ini janin memiliki ukuran seberat 23 gram.

4. Panjang Janin Panjang janin jika diukur mulai dari ujung kepala sampai dengan pantatnya panjang janin skitar 6,7 cm. 5. Lanugo pada bayi baru lahir Yang Terbentuk • Kepala janin membesar • Kelopak mata bayi bisa menutup dan membuka sendiri • Badan bayi mulai membesar mengkuti pembesaran kepala Perkembangan Janin Minggu ke-14 : Bulan 3 Perkembangan Janin Usia 14 Minggu (3 Bulan) Saat usia 14 minggu, janin akan mengalami berbagai macam proses perkembangan.

1. Proses di dalam rahim • Detak jantung bayi mulai menguat • Kelenjar prostat bayi mulai berkembang • Kelenjar kulit mulai menutupi tubuhnya • Bulu halus mulai muncul • Alis mulai tumbuh • Janin bisa mengemut ibu jarinya • Ginjal janin memproduksi urin • Urin membentuk ketuban 2. Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan frekuensi buang air kecil lebih sering karena janin bisa memproduksi urin sendiri. 3. Ukuran Janin Janin memiliki ukuran 40 gram. 4. Panjang Janin Janin memiliki panjang sekitar 8 cm.

5. Organ Yang Terbentuk Dalam usia ini, janin akan memiliki berbagai macam organ. Diantaranya adalah : • Bulu halus termasuk alis dan rambut • Kulit menyelimuti seluruh tubuh • Wajah bayi terbentuk • Fungsi ginjal mulai mengeluarkan urin Lanugo pada bayi baru lahir Janin Minggu ke-15 : Bulan 3 Perkembangan Janin Usia 15 Minggu (3 Bulan) Bayi terus berkembang selama kebutuhan nutrisi gizi ibu hamil tercukupi di dalam tubuhnya.

1. Proses di Dalam Rahim • Janin akan memiliki sendi sehingga anggota tubuhnya bisa bergerak • Kemaluannya terus berkembang • Bayi juga mengalami cegukan 2. Yang Dirasakan Ibu Hamil Ibu hamil yang normal akan kehilangan morning sicknessnya. Sehingga usia kehamilan 15 minggu, sangat tepat bagi ibu hamil untuk melakukan berbagai macam olahraga ringan. Olahraga ini akan meningkatkan kebugaran ibu hamil.

3. Ukuran Janin Janin memiliki ukuran seberat 70 gram. 4. Panjang Janin Janin di dalam rahim memiliki panjang sekitar 9,1 cm. 5. Organ Yang terbentuk Berikut ini berbagai macam organ yang terbentuk pada bayi : • Kemaluan • Sendi di seluruh organ tubuh Perkembangan Janin 4 Bulan Perkembangan Janin Minggu ke-16 : Bulan 4 Perkembangan Janin Usia 16 Minggu (4 Bulan) Usia 16 minggu akan ada moment spesial bagi ibu hamil.

Janin yang ada di dalam rahimnya mulai memiliki nyawa dan telah diberikan jenis kelamin oleh tuhan meskipun ibu hamil baru bisa melihatnya saat usia kehamilan 18 minggu.

1. Proses di Dalam Rahim Janin di dalam rahim akan mengalami proses-proses berikut ini : • Janin akan aktif menarik-narik tali pusarnya. Tali pusar seperti mainan untuk janin di dalam rahim • Janin bisa menegakkan kepalanya saat dia merasa lelah • Fungsi peredaran darah dan juga saluran kemih telah bekerja penuh • Janin bisa menghirup dan menghembuskan cairan ketuban melalui paru-parunya 2.

Yang Dirasakan Ibu Hamil Saat usia tepat 4 bulan, ibu hamil akan merasakan sakit pada sebelah sisi perutnya. Hal itu dikarenakan ligamen ada di setiap sisi rahim dijadikan peregangan untuk janin. 3. Ukuran Janin Usia 4 bulan janin memiliki ukuran sebesar 100 gram.

4. Panjang Janin Janin memiliki panjang 10 cm. 5. Organ Yang Terbentuk Pada usia 4 bulan, organ yang terbentuk pada janin adalah sistem peredaran darah dan juga sistem saluran kemih. Perkembangan Janin Minggu ke-17 : Bulan 4 Perkembangan Janin Usia 17 Minggu (4 Bulan) Janin yang sudah memiliki nyawa akan terus berkembang. Berikut ini perkembangan yang ada pada janin dengan usia 17 minggu. 1. Proses di Dalam Rahim Janin di dalam rahim ibu hamil akan mengalami proses berikut ini : • Tulang rawan janin mulai terbentuk, tulang rawan juga mulai mengeras • Myelin mulai membungkus bagian tulang belakang janin • Kelenjar keringat mulai muncul dan ada • Tali pusar dan plasenta semakin tumbuh dan besar 2.

Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan rahim membesar dan akan mengalami kesulitan untuk tidur. Pusar sudah tidak berada di tengah namun bergeser ke kanan karena rahim yang membesar, sehingga perlu diketahui posisi tidur yang baik saat kehamilan.

3. Ukuran Janin Saat usia kehamilan memasuki 17 minggu, beratnya sebesar 140 gram. 4. Panjang Janin Panjang janin di dalam rahim sekitar 11 cm.

5. Organ Yang Terbentuk Berikut ini berbagai organ yang terbentuk saat usia janin 17 minggu: • Myelin di bagian tulang belakang • Tulang rawan • Kelenjar keringat • Penebalan dan penguatan tali pusar dan plasenta Perkembangan Janin Minggu ke-18 : Bulan 4 Perkembangan Janin Usia 18 Minggu (4 Bulan) Berikut ini berbagai macam perkembangan janin saat usia kehamilan 18 minggu.

1. Proses di Dalam Rahim Janin akan mengalami berbagai macam perkembangan. Diantaranya adalah sebagai berikut ini : • Saat bernapas dada janin akan naik dan turun • Pembuluh darah terlihat dari kulit tipisnya • Telinga sudah sedikit sempurna • Janin bisa menghisap ibu jarinya 2. Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan hal-hal seperti tendangan kaki bayi meski dalam gerakan yang lembut.

Ibu hamil tidak bisa tidur dengan posisi telentang, hal itu dikarenakan ibu hamil akan merasakan sesak pada pernafasannya. Ketika telentang uterus akan menekan vena akibatnya ibu hamil akan pusing diakibatkan kurang darah. 3. Ukuran Janin Ukuran janin sebesar 190 gram. 4. Panjang Janin Panjang janin sekitar 12 cm.

5. Organ Yang Terbentuk Janin juga akan mengalami perkembangan dan pembentukan organ. Saat usia 18 minggu organ akan mengalami penyempurnaan pembuluh darah dan juga sistem pernapasan. Perkembangan Janin Minggu ke-19 : Bulan 4 Perkembangan Janin Usia 19 Minggu (4 Bulan) Janin saat usia 19 minggu akan mengalami berbagai macam proses di dalam rahim.

Berikut ini adalah proses-prosesnya. 1. Proses di Dalam Rahim Berikut ini proses yang dilakukan janin selama berada di dalam rahim : • Janin bisa menelan cairan ketuban • Janin terus memproduksi urin • Rambut kepala semakin tumbuh • Janin mulai bisa mendengar, membau, melihat dan menyentuh 2. Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan gerakan bayi berupa peregangan dan gerakan janin.

Ibu juga mulai merasakan gesekan yang ada di dinding perutnya. Kehamilan pertama akan merasakan gerakan bayi nyata di usia 19 minggu ini. Namun kehamilan kedua dan seterusnya bisa lebih awal dirasakan oleh ibu hamil. 3. Ukuran Janin Janin memiliki ukuran seberat 240 gram.

4. Panjang Janin Panjang janin sekitar 14,2 cm. 5. Organ Yang Terbentuk Berikut ini berbagai macam organ yang terbentuk di usia kehamilan 19 minggu. • Rambut semakin tumbuh • Motor sensorik janin semakin berkembang • Sel syaraf berkembang pesat sehingga janin bisa merasakan, mendengar, melihat dan membaui • Sel syaraf semain berkembang membentuk sistem syaraf yang semakin komplek Perkembangan Janin 5 Bulan Perkembangan Janin Lanugo pada bayi baru lahir ke-20 : Bulan 5 Perkembangan Janin Usia 20 Minggu (5 Bulan) Janin di dalam rahim ibu hamil akan mengalami berbagai macam proses perkembangan baik organ maupun aktivitas di dalam rahim ibunya.

1. Proses di Dalam Rahim Janin di dalam rahim akan mengalami berbagai macam proses berikut ini : • Janin akan menelan lebih banyak air ketuban di minggu ini • Janin menyerap air lebih banyak 2. Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan mudah lapar dan perutnya mudah keroncongan. Ibu hamil juga akan merasakan gejala anemia. Oleh sebab itu mengkonsumsi makanan kaya akan zat besi sangat diperlukan lanugo pada bayi baru lahir tubuh, seperti buah buahan untuk ibu hamil.

3. Ukuran Janin Janin memiliki ukuran seberat 290 gram. 4. Panjang Janin Janin memiliki panjang sekitar 26 cm. 5. Organ Yang Terbentuk Janin akan memiliki perkembangan organ-organ di bawah ini : • Kelenjar lemak telah terbentuk.

Kelenjar lemak juga akan melindungi kulit bayi. • Sistem pencernaan mulai terbentuk dan lebih baik dibandingkan minggu-minggu sebelumnya. Perkembangan Janin Minggu ke-21 : Bulan 5 Perkembangan Janin Usia 21 Minggu (5 Bulan) Usia 5 bulan atau 21 minggu bayi mengalami berbagai macam proses di dalam rahim ibunya. 1. Proses di Dalam Rahim Janin akan mengalami atau melakukan hal-hal di bawah ini selama berada di dalam rahim sang ibu : • Alis mata janin bisa berkembang sepenuhnya • Janin bisa berkedip perlahan karena kelopak mata telah sepenuhnya terkembang 2.

Yang Dirasakan Ibu Hamil Di dalam perut, ibu hamil juga meraskaan janin semakin aktif. Akan ada dorongan dan tendangan di dalam perutnya. Ibu hamil merasakan senang dengan gerakan aktif dari janin tersebut. Ibu hamil juga merasakan nyaman. Nyeri, kelelahan dan mual sudah hilang sepenuhnya.

3. Ukuran Janin Janin memiliki ukuran 160 gram. 4. Panjang Janin Janin memiliki panjang 27 cm. 4. Organ Yang Terbentuk Janin akan membentuk alis dan kelopak mata yang sempurna sehingga bisa membuatnya berkedip. Perkembangan Janin Minggu ke-22 : Bulan 5 Perkembangan Janin Usia 22 Minggu (5 Bulan) Janin di usia 22 minggu bisa melakukan hal-hal yang tidak disangka oleh ibu hamil. Janin juga berkembang lebih sempurna dibandingkan dengan minggu sebelumnya.

1. Proses di Dalam Rahim Janin akan mengalami proses seperti di bawah ini : • Janin bisa meringkuk dengan menekuk kakinya • Lemak belum berkembang sempurna 2. Yang Dirasakan Ibu Hamil Nafsu makan ibu hamil akan terus meningkat.

Setiap minggu ibu hamil akan mendapatkan kenaikan berat badan sekitar 225 gram. Menginginkan makan makanan tertentu juga akan terjadi, termasuk makanan larangan ibu hamil. 3. Ukuran Janin Janin seberat 430 gram. 4. Panjang Janin Janin memiliki panjang 28 cm. 5. Organ Yang Terbentuk Saat janin di minggu ini, pankreas semakin berkembang pesat.

Sedangkan kelenjar lemak belum berkembang secara sempurna. Hormon di dalam pankeras pun juga akan berkembang terus. Perkembangan Janin Minggu ke-23 : Bulan 5 Perkembangan Janin Usia 23 Minggu (5 Bulan) Janin akan semakin menggemaskan di dalam rahim ibunya. Berikut ini berbagai macam proses perkembangan janin yang dilakukan menjelang bulan ke 6 ini.

1. Proses di Dalam Rahim Pada saat minggu ini bayi akan mulai merespon berbagai macam suara yang ada di sekitarnya begitu pula dengan suara ibunya. Janin juga bisa mendengar detak jantung ibunya dan juga suara perut ibunya. 2. Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan berbagai macam gangguan misalnya saja gusi berdarah, pusar semakin menjorok ke dalam.

3. Ukuran Janin Janin memiliki ukuran 500 gram. 4. Panjang Janin Panjang janin juga berkembang pesat yaitu sekitar 29 cm. 5. Organ Yang Terbentuk Organ yang terbentuk dalam minggu ini adalah pendengaran bayi lebih sempurna, paru-paru mempersiapkan diri untuk bernafas.

Perkembangan Janin 6 Bulan Perkembangan Janin Minggu ke-24 : Bulan 6 Perkembangan Janin Usia 24 Minggu (6 Bulan ) Janin dalam usia 24 minggu mengalami perkembangan pesat terutama di bagian otaknya. 1. Proses di Dalam Rahim Janin akan sering meregangkan tangan dan sering menendang menggunakan kakinya. 2. Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan perbuahan hormon di dalam tubuhnya.

Dia akan merasakan gatal saat berkeringat, payudara gatal dan kencang. Jika di garuk akan menimbulkan stretch mark di perut dan kulit. Menggunakan bra yang tepat bisa mengurangi rasa gatal pada payudara ibu hamil. Mata mudah menjadi kering dan mengalami iritasi. 3. Ukuran Janin Janin minggu ini memiliki ukuran 600 gram. 4. Panjang Janin Janin memiliki panjang 30 cm. 5. Organ Terbentuk Banyak organ yang terbentuk, diantaranya adalah sebagai berikut ini : • Otak berkembang pesat • Paru-paru berkembang • Sidik kaki dan sidik jari terbentuk Perkembangan Janin Minggu ke-25 : Bulan 6 Perkembangan Janin Usia 25 Minggu (6 Bulan) 1.

Proses di Dalam Rahim Saat janin berusia 25 minggu, janin akan mengalami proses berupa indera yang lebih canggih. Otak janin juga peka terhadap sentuhan. 1. Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan gatal karena perubahan hormon, stretch mark semakin melebar. 3. Ukuran Janin Janin memiliki ukuran 660 gram.

4. Panjang Janin Janin memiliki panjang 35 cm. 5. Organ Yang Terbentuk Berikut ini organ yang terbentuk pada minggu ini : • Indera lebih sempurna dibandingkan sebelumnya. • Bayi akan mengeluarkan keringat melalui kulit keriputnya. • Syaraf optik otak bekerja dan berfungsi. Perkembangan Janin Minggu ke-26 : Bulan 6 Perkembangan Janin Usia Minggu Ke-26 (6 Bulan) 1. Perkembangan di Dalam Rahim Bayi bisa mendengarkan suara ibunya atau ayahnya, akan merespon menggunakan gerakan.

Janin juga akan lebih tanggap dengan suasana hati ibunya. Jika sedih bayi akan terus bergerak di dalam perut. Janin juga akan sering mengambil nafas lebih sering di dalam rahim. 2. Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan gerakan bayi berupa tendangan atau peregangan kaki atau bayi yang menarik tali pusar.

Hal itu bisa terjadi ketika anda mengajaknya berbicara. 3. Ukuran Janin Janin memiliki berat 760 gram. 4. Panjang Janin Janin memiliki panjang 36 cm.

.5. Organ Terbentuk Perkembangan organ terjadi di minggu ini terutama perkembangan organ otak. Sensorik dan motoriknya juga berkembang pesat. Perkembangan Janin Minggu ke-27 : Bulan 6 Perkembangan Janin Usia 27 Minggu (6 Bulan) 1. Proses Perkembangan di Dalam Rahim Bayi saat di dalam rahim ibunya mulai aktif membuka dan menutup matanya.

Kelopak matanya mulai bekerja secara sempurna. Janin aktif menghisap ibu jari jempol. Bayi juga akan cegukan. 2. Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan peregangan dan tendangan saat janin terbangun dari tidurnya sebab saat minggu ini janin mulai tidur dan bangun. Ibu lanugo pada bayi baru lahir juga merasakan sesak nafas.

Kram, sembelit dan juga kaki bengkak akan dirasakan oleh ibu hamil. 3. Ukuran Janin Janin memilikin berat 875 gram. 4. Panjang Janin Panjang janin sekitar 36 cm. 5. Organ Terbentuk Janin akan memiliki otak dan mata yang aktif. Perkembangan Janin 7 Bulan Perkembangan Janin Minggu ke-28 : Bulan 7 Perkembangan Janin Usia 28 Minggu (7 Bulan) 7 bulan adalah saat janin sudah benar-benar membentuk manusia kecil, ibu hamil juga mulai bisa mendeteksi jenis kelamin bayinya.

1. Proses Perkembangan Di Dalam Rahim Saat janin berusia 28 minggu janin sudah bisa melakukan berbagai proses. Proses tersebut adalah berikut ini : • Janin mulai bisa membuka mata dan bisa mengubah posisi kepalanya di dalam rahim ibunya. • Janin sudah bisa berkedip secara sempurna terutama jika dia melihat cahaya terang dan terus menerus.

• Tulang janin belum keras dan juga kokoh. 2. Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan peregangan dari janin yang dikandungnya. Tidak hanya itu saja, tendangan demi tendangan pun akan dirasakan ibu hamil.

Kini janin bisa menampakkan kaki atau sikunya, sehingga perut ibu hamil menonjol-nonjol. 3. Ukuran Janin Saat janin berusia 28 minggu, maka janin akan memiliki berat 1 kg.

4. Panjang Janin Janin memiliki ukuran panjang 38 cm. 5. Organ yang Terbentuk Saat usia kandungan 28 minggu janin telah memiliki bulu mata dan lapisan lemak terbentuk lebih sempurna. Perkembangan Janin Minggu ke-29 : Bulan 7 Perkembangan Janin Minggu Ke-29 (7 Bulan) Dalam minggu ini, janin akan lebih aktif dibandingkan dengan sebelumnya. Di dalam rahim janin akan terus berkembang terutama tulang dan organ-organ yang lainnya. 1. Perkembangan di Dalam Rahim Berikut ini berbagai macam proses yang akan dialami dan dilakukan oleh bayi : • Rambut di atas kepala mulai tumbuh dengan baik • Jika jenis kelaminnya laki-laki, maka janin mengalami penurunan buah zakar dan turun mendekati ginjal.

Penurunan itu melalui pangkal paha dan mulai berjalan ke arah skrotum. • Jika perempuan, maka klitoris dari perempuan tersebut akan menonjol. Labianya belum tumbuh dengan sempurna sampai mendekati kelahiran. • Kepala bayi semakin membesar dan otaknya juga semakin berkembang. • Janin bisa bereaksi terhadap sentuhan jari ibunya di atas perut dan suara yang dia dengar. 2. Yang Dirasakan Ibu Hamil Saat fase ini, ibu hamil akan susah tidur karena bayi sangat aktif terutama bayi laki-laki.

Ibu hamil akan merasakan rambut janin, jika janin itu menempel pada dinding perutnya. Benjolan-benjolan di perut juga akan semakin terasa dan sering. 3. Ukuran Janin Janin di usia minggu ke-29 akan memiliki berat lebih dari 1 kg. 4. Panjang Janin Janin saat usia memasuki 19 minggu dia memiliki panjang 39 cm. Di ukur dari atas kepala sampai dengan bokong. 5. Organ Yang Terbentuk Organ yang terbentuk lebih sempurna adalah kepala dan otak. Selain itu ada clitoris dan skrotum yang mulai berkembang dan muncul meski belum sempurna.

Perkembangan Janin Minggu ke-30 : Bulan 7 Perkembangan Janin Minggu Ke- 30 (7 Bulan) Janin mengalami perkembangan secara pesat terutama di bagian paru-paru. Bayi yang dilahirkan kurang dari usia 30 minggu banyak yang mengalami masalah di paru-parunya sebab saat lanugo pada bayi baru lahir berusia 30 minggu paru-paru hampir terbentuk sempurna.

1. Proses yang Terjadi di Dalam Rahim Proses yang dialami oleh janin di dalam rahim adalah : • Janin bisa melacak datangnya sumber cahaya yang dia lihat. • Jika perut disinari, janin bisa menggerakkan kepalanya mengikuti kemana cahaya tersebut bergerak. • Bayi juga memiliki perkembangan visual.

2. Yang Dirasakan Ibu Hamil Ibu sering merasakan sesak nafas, hal itu dikarenakan bayi atau janin mulai menekan diafragma sang ibu. Ibu hamil seolah-olah kekurangan udara, untuk mengatasinya ibu hamil bisa berjalan-jalan ringan atau melakukan senam hamil, untuk mengatur pernafasannya. Bagi kehamilan kedua dan ketiga, ibu hamil akan merasakan janinnya bergerak ke arah panggul dan membuat pernafasan lebih mudah dan lega.

3. Ukuran Janin Janin dalam usia ini memiliki berat 1,3 kg. 4. Panjang Janin Panjang janin sekitar 39 cm. 5. Organ Yang Terbentuk Organ yang terbentuk pada tubuh janin adalah paru-paru dan sistem pencernaannya yang mendekati sempurna.

Perkembangan Janin Minggu ke-31 : Bulan 7 Perkembangan Janin Usia 31 Minggu lanugo pada bayi baru lahir Bulan) Janin pada usia ini akan memiliki berbagai macam proses dan perkembangan.

Baik itu pergerakan tubuhnya maupun dengan organ-organnya. 1. Perkembangan di Dalam Rahim Janin di dalam rahim akan mengalami berbagai macam proses. Jari kaki dan tangannya terus bergerak. Pergerakan bayi pun semakin meningkat. Bayi bisa menggeliat dan menendang. Banyak pertumbuhan yang masih harus dia lewatkan atau lalui. 2. Yang Dirasakan Ibu Hamil Janin di dalam tubuh akan menggeliat sehingga ibu hamil akan merasakannya.

Janin juga menendang, ibu hamil akan merasakannya. Dalam seminggu berat badan ibu hamil bisa naik sebanyak 450 gram. Hal itu merupakan hal normal. 3. Ukuran Janin Janin memiliki berat 1,5 kg. 4. Panjang Janin Janin memiliki panjang 41 cm. Panjang tersebut merupakan panjang proporsional bagi janin di dalam rahim.

5. Organ Yang Terbentuk Tangan terutama lengan dan kaki akan terus tumbuh. Jari tangan dan kaki semakin meningkat. Tubuh janin akan menyesuaikan dengan kepala bayi. Perkembangan Janin 8 Bulan Perkembangan Janin Minggu ke-32 : Bulan 8 Perkembangan Janin Usia 32 Minggu (8 Bulan) Proses yang akan dilalui janin adalah berikut ini : 1.

Perkembangan Bayi Janin dalam tahap ini memiliki rambut yang tumbuh. Pada bayi yang rambutnya lebat, bayi akan suka mengelus-eluskan rambutnya pada dinding perut ibunya. Bayi yang berambut halus rambut hanya bisa muncul beberapa helai saja. 2. Yang Dirasakan Ibu Hamil Ibu hamil akan mendapatkan berat badan yang lebih, yaitu lebih dari 450 gram selama seminggu.

Benjolan di perut juga semakin besar dibandingkan sebelumnya. 3. Ukuran Janin Janin akan memiliki berat 1,7 kg 4. Panjang Janin Janin akan memiliki panjang sekitar 42 cm. 5. Organ Yang Terbentuk Dalam tahap ini, janin akan mengalami pertumbuhan organ lanugo pada bayi baru lahir adalah sebagai berikut : • Kulit bayi akan lebih tebal dibandingkan minggu sebelumnya, kulitnya juga lembut dan halus.

• Laki-laki akan mengalami perkembangan organ berupa buah zakar turun dari perut menuju skrotum. Namun pada kelahiran bayi laki-laki tertentu, testis tidak akan turun sampai bayi berumur satu tahun.

• Untuk janin perempuan, labia mulai berkembang sedikit demi sedikit. Perkembangan Janin Minggu ke-33 : Bulan 8 Perkembangan Janin Usia 33 Minggu (8 Bulan) Janin pada usia 33 minggu sudah bersiap-siap lahir, sehingga posisinya sudah mendekati panggul. 1. Perkembangan Janin Janin akan mengalami dan melakukan hal-hal di bawah ini : • Janin suka berputar-putar dan posisinya suka terbalik-balik. • Kepala janin sering menunjuk ke bawah atau berada di bawah.

• Bidan akan melakukan pengawasan terhadap pergerakan dan perputaran bayi dalam beberapa minggu selanjutnya. 2. Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan kepala bayi berada di panggul sedangkan ibu yang sudah berkali-kali menghadapi kehamilan, hal itu akan terjadi seminggu sebelum ibu hamil tersebut menghadapi persalinan. Ibu hamil juga akan merasakan bengkak di kedua kakinya. Ibu hamil juga merasakan dehidrasi yang tinggi. Frekuensi buang air kecil pun semakin lanugo pada bayi baru lahir.

3. Ukuran Janin Janin akan memiliki ukuran 2,2 kg. 4. Lanugo pada bayi baru lahir Janin Panjang janin di dalam rahim adalah 44 cm. 5. Organ yang Terbentuk Berikut ini berbagai macam organ yang mengalami perkembangan dan pembentukan : • Tengkorak bayi terus tumbuh meski masih lentur.

• Pelat tengkorak saling menyatu satu sama lain. • Tulang-tulang tubuh janin mulai mengeras. • Pembentukan lemak mulai sempurna dan menumpuk pada lapisan bawah kulit. Perkembangan Janin Minggu ke-34 : Bulan 8 Perkembangan Janin Usia 34 Minggu ( #8 Bulan ) Janin akan mengalami berbagai macam perkembangan.

Berikut ini berbagai macam perkembangan yang dialami oleh bayi usia 34 minggu. 1. Proses Perkembangan Janin Usia 34 Minggu Pada saat usia 34 minggu janin bisa mendengarkan semua perkataan ibunya.

Hal itu dikarenakan organ pendengaran janin hampir terbentuk dengan sempurna. 2. Yang Dirasakan Ibu Hamil Ibu hamil saat usia kandungannya 34 minggu, dia akan suka mengobrol pada janin yang ada di dalam perutnya. Ibu hamil juga akan merasakan kesemutan dengan daerah panggul mereka.

Hal itu dikarenakan panggul akan longgar dan siap untuk melakukan persalinan. Kesemutan berbeda dengan sakit. Jika panggul sakit konsultasikan dengan bidan atau dokter tempat ibu hamil periksa. 3. Ukuran Janin Janin pada saat ini memiliki berat 2,2 kg. 4. Panjang Janin Janin memiliki panjang sekitar 45 cm. 5. Organ Terbentuk Janin pada usia ini akan memiliki organ pendengaran yang hampir sempurna.

Paru-paru hampir sempurna dan syaraf pusat janin belum terbentuk dengan baik. Bagi kelahiran prematur, janin dengan usia 34 minggu bisa bertahan di luar rahim sebanyak 99 persen, namun sementara waktu diletakkan di ruang inkubator. Lanugo pada bayi baru lahir Janin Minggu ke-35 : Bulan 8 Perkembangan Janin Usia 35 Minggu (8 Bulan) Berbagai macam proses akan dilakukan oleh bayi. Proses tersebut adalah berikut ini : 1. Proses di Dalam Rahim Janin akan menggeliat terutama saat bangun tidur, janin juga akan mengembangkan berbagai hal yang selama ini dia lakukan selama di dalam rahim.

Misalnya saja menggeliat lebih sering, menendang lebih sering. 2. Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan hal-hal di bawah ini : • Siku janin akan menonjol di perut ibu hamil. • Ibu hamil mengalami kelonjakan berat badan 11 kg sampai dengan 13,6 kg. • Pusar ibu hamil bisa menyembul keluar dan terlihat lebih besar dan lebar. • Sesak nafas dan gangguan pencernaan karena rahim bersama janin tepat berada di bawah tulang rusuk.

• Merangkak bisa membuat ibu hamil memiliki nafas lega. • Mendapatkan tekanan di kandung kemih sehingga sering buang air kecil. 3. Ukuran Janin Janin memiliki ukuran seberat 2,4 kg. 4. Panjang Janin Janin memiliki panjang 46 cm. 5. Organ Yang Terbentuk Janin memiliki perkembangan organ seperti dibawah ini : • Kuku kaki dan kuku tangan telah lengkap terisi • Ginjal berkembang dan menghasilkan urin • Hati juga mengeluarkan limbah atau bersekresi Perkembangan Janin 9 Bulan Perkembangan Janin Minggu ke-36 : Bulan 9 Perkembangan Janin Usia 36 Minggu (9 Bulan) Usia 9 bulan adalah masa yang dinanti-nanti.

Sebab kelahiran malaikat kecil sudah hampir tiba. Ibu hamil banyak yang nerves dan merasa khawatir saat kandungannya memasuki usia ini. 1. Proses Perkembangan Janin Di dalam rahim, janin sudah memposisikan kepalanya di dekat panggul sang ibu. 2. Yang Dirasakan Ibu Hamil Ibu hamil akan merasakan hal-hal yang tidak nyaman namun normal. Rasa itu adalah : • Tekanan pada perut meningkat karena janin bertahap menurun sedikit demi sedikit.

• Ibu hamil merasakan tidak nyaman saat berjalan. • Ibu hamil merasakan bayi akan rontok ke bawah karena bayi terasa di bawah perut mereka. • Ibu hamil sering pergi ke toilet. • Banyak ibu hamil yang melahirkan di usia kandungan tepat 9 bulan.

• Payudara ibu hamil seperti bocor dan mengeluarkan cairan. 3. Ukuran Janin Janin memiliki ukuran 28 gram atau 2,8 kg 4. Panjang Janin Panjang janin sekitar 47 cm. 5. Organ Yang Terbentuk Paru-paru, ginjal dan hati bekerja secara sempurna. Mengeluarkan urin dan sekresi. Perkembangan Janin Minggu ke-37 : Bulan 9 Perkembangan Janin Usia 37 Minggu (9 Bulan) 1. Proses Yang Terjadi Di Dalam Rahim Janin akan memiliki banyak rambut namun ada juga bayi yang dilahirkan tanpa rambut sama sekali.

Bulu-bulu halus juga mulai muncul. Substansi berwarna putih juga akan menutupi tubuh janin. Janin bisa menelan lanugo dan menyimpannya di dalam perut mereka. Lanugo pada bayi baru lahir mengeluarkan limbah berupa mekonium yang berwarna kehitaman. 2. Yang Dirasakan Ibu Hamil Ibu hamil banyak yang khawatir dengan persalinan mereka.

Tidur tidak nyenyak, tidur telentang juga akan merasakan sesak nafas. 3. Ukuran Janin Janin memiliki ukuran seberat 2,9 kg.

4. Panjang Janin Panjang janin akan sekitar 48,6 cm. 5. Organ Yang Terbentuk Organ janin yang terbentuk adalah selaput keputihan penutup tubuh bayi.

Perkembangan Janin Minggu ke-38 : Bulan 9 Perkembangan Janin Minggu Ke-38 (9 Bulan) 1. Perkembangan Bayi di Dalam Rahim Bayi akan terus membangun kelenjar lemak di dalam tubuhnya. Janin juga aktif berkedip bahkan bergerak di dekat panggul, membuat ibu hamil merasakan kesemutan lebih sering di daerah panggul. 2. Yang Dirasakan Ibu Hmil Ibu hamil akan merasakan kesemutan. Ibu hamil juga merasakan perut bawah terasa berat untuk dibawa kemanapun. 3. Ukuran Janin Janin memiliki ukuran seberat 3 kg bahkan sampai 3,2 kg.

4. Panjang Janin Janin akan memiliki panjang sekitar 39 cm. 5. Organ Janin Yang Terbentuk Paru-paru sudah sepenuhnya sempurna.

Banyak juga yang ibu hamil melahirkan di usia 9 bulan lebih 3 minggu. Perkembangan Janin Minggu ke-39 : Bulan 9 Perkembangan Janin Usia 39 Minggu ( #9 Bulan ) Sebenarnya orang Indonesia memiliki waktu atau masa kelahiran sekitar 9 bulan lebih 11 hari, 9 bulan lebih 2 minggu.

Namun orang luar dan sedikitnya orang Indonesia mengalami kehamilan 39 minggu sampai dengan usia 40 minggu. 1. Perkembangan Janin di Dalam Rahim Janin tidak berpindah tempat, kepala tetap berada di sekitar panggul. Namun lanugo pada bayi baru lahir hamil dengan banyak ketuban bisa membuat janinnya berpindah-pindah posisi. Bayi bisa memiliki minyak, minyak itu bisa melindungi kulitnya.

Jaringan kulit dan lapisan kulit telah sempurna. 2. Yang Dirasakan Ibu Hamil Ibu hamil dengan usia kandungan ini dan belum merasakan tanda-tanda kelahiran akan khawatir.

Kesemutan, pegal dan perut bawah semakin terasa berat. 3. Ukuran Janin Ukuran janin saat minggu ini 3,4 kg. 4. Panjang Janin Janin memiliki panjang 50 cm. 5. Organ Terbentuk Organ yang terbentuk adalah kelenjar minyak. Lapisan kulit luar dan rambut janin lebih menebal. Usia minggu ini tengkorak bayi belum menyatu. Perkembangan Janin Minggu ke-40 : Bulan 10 Perkembangan Janin Usia 40 Minggu (10 Bulan) Minggu ke-40 adalah tahap terakhir kehamilan.

Jika ibu hamil belum merasakan tanda-tanda kelahiran, periksakan diri ke dokter dan bidan. 1. Proses Perkembangan Janin Si Dalam Rahim Janin terus membentuk kelenjar minyak dan juga membentuk zat vernix caseosa yang bisa melindungi kulit tubuh janin. Oleh sebab itu bayi yang baru dilahirkan akan berkulit putih, namun saat keluar dari rahim selama seminggu zat putih itu akan hilang.

Naluri janin bisa menemukan ibu jari dan menghisapnya. 2. Yang Dirasakan Ibu Hamil Ibu hamil saat usia kehamilan ini ada yang mengalami kontraksi dan air ketuban pecah, punggung pegal dan perut mulas.

Hal itu menandakan ibu hamil akan segera melahirkan, jika belum ada tanda itu, ibu hamil harus segera di induksi. 3. Ukuran Janin Janin bisa mencapai ukuran 3,8 kg. 4. Panjang Janin Panjang janin sekitar 51 cm. 5. Organ Terbentuk Cairan ketuban telah terbentuk sempurna, selain itu organ-organ yang lainnya juga telah sempurna. Semua indera janin juga sudah lengkap sehingga dia siap untuk dilahirkan di dunia ini. Video Lengkap Masa kehamilan merupakan hal yang paling penting untuk wanita, karena akan melahirkan keturunan keluarga yang menjadi dambaan.

Untuk itu, diperlukan kesiapan baik fisik dan mental untuk menghadapinya, termasuk mempersiapkan pengetahuan tentang seluk-beluk kehamilan ini. Melihat janin di dalam kandungan yang sehat menjadi suatu hal yang diharapkan terjadi setiap bulannya oleh ibu hamil. Dengan kondisi janin yang sehat serta perkembangan normal maka harapan ibu hamil agar nantinya janin terlahir sebagai bayi dalam kondisi prima, sehat, dan sempurna dapat terwujud. Selama kehamilan, ibu hamil tidak dapat secara langsung memperhatikan kondisi janinnya […] Kehamilan menjadi sebuah peristiwa penting yang akan dilewati oleh setiap wanita dalam prosesnya untuk dapat memperoleh keturunan.

Fase demi fase dalam proses kehamilan akan dilewati oleh setiap ibu hamil penuh dengan keajaiban dan hal yang akan menjadikannya terus berucap syukur melihat anugerah yang diberikan oleh sang penguasa. Dalam proses kehamilan, ibu harus melewati banyak hal […] Kehamilan merupakan salah satu proses yang sangat penting bagi seorang wanita dimana di dalam kandungannya terdapat janin yang sedang berkembang untuk nantinya lahir sebagai seorang bayi.

Jalannya proses kehamilan yang setidaknya akan berangsung selama kurang lebih 40 minggu tersebut sangat menentukan bagaimana kondisi bayi nantinya terlahir apakah dalam keadaan yang sehat atau memiliki kondisi permasalahan […] Dalam proses kehamilan, ada beberapa tanda tanda yang dapat menjadi petunjuk apakah kondisi janin di dalam kandungan memiliki kondisi yang sehat serta perkembangannya normal.

Tanda tanda kehamilan yang normla dan sehat tersebut harus dipahami dengan baik dalam kaitannya untuk menjadikan kondisi janin di dalam kandungan selalu sehat dan tidak mengalami berbagai macam gangguan kehamilan. Kondisi […] Related Posts • 22 Tips Mengurangi Mual saat Hamil Muda secara Alami • 6 Penyebab Anak Mual Setiap Makan Dan Cara Mengatasinya • Bahaya Kucing Pada Ibu Hamil dan Pencegahannya • Tekanan Darah Rendah Saat Melahirkan – Dampak dan Cara Mengatasi • 5 Bahaya Mewarnai Rambut saat Hamil Bagi Ibu hamil dan Janin Setiap ibu hamil tentu ingin menjalani kehamilanya dengan baik meskipun secara umum akan ada beberapa gejala dan tanda kehamilan yang cukup berat di awal awal proses kehamilan seperti mual dan muntah atau morning sickness, nyeri perut, kembung, sakit pada payudara, sering buang air kecil, flek darah, dan lain sebagainya.

Perubahan tersebut adalah kondisi normal yang […] Ibu hamil pasti akan merasakan tidak nyaman saat baru masuk awal kehamilan.

Bahkan pertanda kehamilan seperti morning sickness bisa sangat mengganggu. Namun ketika kehamilan ibu sudah semakin berkembang maka bisa merasa sangat takjub. Salah satunya adalah ketika perkembangan janin sudah menunjukkan beberapa gerakan. Ibu pasti akan merasakan bahwa janin dalam rahim ibu benar-benar tumbuh dengan […] Perkembangan janin dari waktu ke waktu akan membuat calon orang tua merasa sangat takjub.

Semua janin berkembang dari mulai trimester pertama sampai ketiga. Ada masa ketika baru awal kehamilan ibu tidak bisa merasakan apa-apa.

Kemudian saat sudah masuk ke trimester kedua maka janin sudah mulai bergerak. Perkembangan ini akan semakin baik saat sudah masuk ke […] Selamat Anda sudah mendapatkan kehamilan yang selama ini didambakan! Ibu masuk ke tahap kehidupan yang sangat penting, karena janin terus tumbuh dalam rahim.

Saat ini ketika usia kehamilan ibu masuk ke 1 bulan maka ibu merasakan hal-hal yang tidak nyaman. Selain mengalami morning sickness maka ibu juga merasa tubuh yang sangat tidak nyaman seperti mudah […] Selama masa kehamilan yang berlangsung kurang lebih 40 minggu hingga datangnya proses persalinan sebagai akhir dari masa tersebut, setiap ibu hamil pasti menginginkan kondisi kehamilan yang dijalaninya berlansung dengan baik, lancar, normal, dan tidak muncul berbagai macam masalah atau gangguan kehamilan yang dapat berakibat buruk baik bagi kondisi kesehatan ibu maupun kondisi kesehatan bayi dan […] Ketika bayi lahir dengan proses persalinan baik itu normal atau caesar maka bayi Anda sudah lahir dengan indra yang lengkap dan normal.

Kecuali jika bayi Anda memang membawa kelainan seperti cacat janin sejak dalam kandungan. Harapan untuk memiliki bayi yang sehat dan normal sudah bisa Anda pupuk sejak bayi masih dalam kandungan. Ini karena bayi […]
Pembagian trimester kehamilan Saat Anda dinyatakan hamil, janin yang ada di dalam rahim akan berkembang sekitar 40 minggu dan dibagi menjadi tiga trimester sesuai usia kehamilanyaitu: • Trimester pertama usia kandungan 1 – 13 minggu + 6 hari • Trimester kedua usia kandungan 14 – 27 minggu + 6 hari • Trimester ketiga usia kandungan 28 – 41 minggu + 6 hari Pada umumnya setiap trimester kehamilan berlangsung antara 12 – 14 minggu, atau per tiga bulan.

Sementara itu berdasarkan panduan dari American College of Obstetrician and Gynecologists ( ACOG ), ada beberapa tahapan kelahiran bayi sesuai dengan usia kandungan, yaitu: • Prematur: bayi lahir di usia kehamilan 20-37 minggu. • Lahir lebih awal: 37 minggu 0 hari – 38 minggu 6 hari. • Lahir tepat waktu: 39 minggu 0 hari – 40 minggu 6 hari.

• Terlambat lahir: 41 minggu 0 hari – 41 minggu 6 hari. • Telat lahir: 42 minggu 0 hari. Anda bisa berkonsultasi dengan dokter untuk mengetahui waktu kelahiran si kecil. Perkembangan trimester kehamilan pertama Trimester kehamilan pertama terhitung sejak usia kehamilan 1 minggu sampai 13 minggu.

Perhitungan hari pertama kehamilan sudah dimulai pada hari pertama haid terakhir. Sejak saat itu sampai hari menstruasi yang terakhir, Anda sudah terhitung satu minggu hamil. 1. Perubahan tubuh ibu di trimester pertama kehamilan Di trimester pertama fase ini, Anda mungkin belum kelihatan hamil, tapi tubuh sedang mengalami perombakan fungsi besar-besaran untuk mempersiapkan tumbuh kembang janin.

Peningkatan hormon kehamilan HCG akan memengaruhi hampir setiap organ dalam tubuh. Selama trimester pertama, ada berbagai perubahan tubuh ibu yang menandakan ciri-ciri hamil muda, seperti: • Badan cepat lelah • Sakit perut seperti sembelit dan mulas • Mual dan muntah (emesis gravidarum ) • Mood atau suasana hati berubah • Payudara nyeri dan bengkak • Berat badan bertambah • Sakit kepala • Mengidam atau tidak menyukai makanan tertentu Namun ada juga beberapa ibu hamil muda yang tidak merasakan gejala-gejala ini sama sekali saat trimester pertama.

2. Perkembangan janin pada trimester pertama kehamilan Pada hari pertama hamil yang juga hari pertama menstruasi terakhir, belum ada janin di dalam rahim. Pembuahan yang menciptakan cikal bakal janin baru akan terjadi sekitar 10 hingga 14 hari setelahnya. Seiring waktu, janin baru mulai terbentuk perlahan. Perkembangan janin usia 1 minggu sampai 12 minggu dimulai dari otak, sumsum tulang belakang, dan organ-organ vital lain, termasuk jantung yang mulai berdetak.

Selain itu, secara umum, semua pembentukkan organ selesai di usia kehamilan 8 minggu. Idealnya, berat bayi sekitar 28 gram dengan panjang sekitar 2,5 cm pada akhir trimester satu kehamilan. 3. Tes kesehatan di trimester pertama kehamilan Setelah mengetahui positif hamil, sebaiknya langsung periksakan diri ke dokter kandungan.

Sepanjang trimester pertama, dokter akan melakukan tes skrining, meliputi: • USG untuk menentukan ukuran dan posisi bayi, juga membantu memprediksi risiko janin cacat lahir.

• Pap smear. • Cek tekanan darah. • Tes darah untuk mendeteksi kelainan kromosom. • Tes darah TORCH untuk menentukan risiko penyakit menular pada bayi. • Tes infeksi menular seksual, seperti HIV dan hepatitis.

• Menghitung usia kehamilan dan hari perkiraan lahir. • Memeriksa kadar tiroid. • Tes genetik lewat nuchal translucency (NT). Bila dokter tidak menawarkan skrining, Anda bisa lanugo pada bayi baru lahir terlebih dahulu.

Perkembangan trimester kehamilan kedua Trimester kedua diawali usia kehamilan 13 minggu hingga 27 minggu. Di trimester kedua ini adalah momen yang paling nyaman bagi sebagian besar calon ibu. Pasalnya, tubuh sudah berhasil menyesuaikan diri dengan perubahan besar yang terjadi selama 3 bulan sebelumnya.

1. Perubahan tubuh ibu di trimester kedua kehamilan Sebagian besar tanda awal kehamilan secara bertahap mulai mereda. Ada beberapa perubahan lainnya yang terjadi pada ibu hamil di trimester kedua, yakni: • Perut mulai membesar karena r ahim berkembang.

• Mudah pusing karena tekanan darah rendah. • Mulai merasakan gerakan janin di dalam perut • Badan pegal-pegal • Nafsu makan meningkat • Mulai muncul stretch mark pada perut, payudara, paha, atau bokong • Ada beberapa bagian kulit yang menggelap, contohnya di puting • Badan gatal-gatal • Pergelangan kaki atau tangan bengkak • Mual berkurang Frekuensi mual dan muntah sudah jauh berkurang, dan ibu hamil kembali mendapatkan energi yang sempat hilang di trimester pertama kehamilan.

2. Perkembangan janin di trimester kedua Selama trimester kehamilan ini, hampir seluruh organ janin diharapkan sudah berkembang sempurna. Janin juga mulai dapat mendengar dan menelan makanan sehat ibu hamil yang masuk ke perut. Selain itu, sudah mulai tumbuh rambut-rambut kecil di tubuh janin yang biasa disebut lanugo. Menurut American Pregnancy Association, pada akhir trimester kedua panjang janin diharapkan mencapai sekitar 10 cm dan beratnya lebih dari 1 kilogram.

3. Tes kesehatan di trimester kedua Bukan cuma di tiga bulan pertama kehamilan, calon ibu harus tetap rutin berkunjung ke dokter setiap dua sampai empat minggu selama trimester kedua kehamilan.

Tes yang mungkin dilakukan dokter selama kunjungan pada trimester kedua kehamilan, meliputi: • Mengukur tekanan darah • Memeriksa perubahan berat badan saat hamil • Skrining diabetes dengan tes darah Untuk USG, di trimester kedua ini khusus untuk menentukan jenis kelamin, memeriksa kondisi plasenta, dan memantau pertumbuhan janin secara keseluruhan. Perkembangan trimester ketiga kehamilan Trimester ketiga umumnya berlangsung dari awal minggu ke-28 kehamilan sampai 41 minggu plus 6 hari.

Di akhir masa kehamilan ini, tidak jarang banyak calon ibu yang mulai mengalami kontraksi palsu. Munculnya rasa cemas menjelang melahirkan juga termasuk wajar dan banyak dialami oleh calon ibu. 1. Perubahan tubuh ibu di trimester ketiga Menjelang hari-H persalinan, perut akan semakin membesar sehingga keluhan pegal-pegal dan susah tidur lanugo pada bayi baru lahir umum dirasakan.

Umumnya leher rahim ibu hamil juga akan meregang jadi lebih tipis dan lebih lembut semakin dekat dengan tanggal kelahiran bayi. Ini bertujuan untuk membuka jalur keluar bayi selama proses persalinan. Berikut adalah kondisi lain yang harus diperhatikan ibu pada trimester kehamilan ini, seperti: • Gerakan janin dalam perut yang semakin kencang dan banyak • Mengalami kontraksi palsu • Jadi lebih sering buang kencing • Merasa mulas • Pergelangan lanugo pada bayi baru lahir, jari, atau wajah yang bengkak lanugo pada bayi baru lahir Mengalami wasir • Payudara bengkak dan kadang air susu bocor • Sulit menemukan posisi tidur yang nyaman Selain itu, Anda juga perlu mewaspadai tanda bahaya kehamilan di trimester ketiga.

2. Perkembangan janin trimester ketiga Pada trimester ketiga kehamilan, tepatnya di minggu ke-32, tulang dan kerangka badan janin sudah terbentuk sempurna. Janin di dalam kandungan pun sudah bisa membuka dan menutup mata, serta merasakan cahaya dari luar perut ibu.

Di akhir usia kehamilan 37 minggu, umumnya semua organ tubuh janin sudah bisa berfungsi dengan baik secara mandiri. Berat akhir janin idealnya mencapai sekitar 2.500 gram (2,5 kg) atau lebih, dan panjang badan janin mencapai 50 cm. Minggu-minggu terakhir mendekati persalinan, posisi kepala janin idealnya harus sudah turun menghadap ke bawah. Jika belum, dokter akan mencoba memindahkan posisi kepala bayi.

Bila posisi kepala janin tidak berubah, kemungkinan ibu akan disarankan melahirkan lewat caesar. 3. Tes kesehatan di trimester ketiga Di awal trimester ketiga kehamilan, dokter akan memandu dalam mempersiapkan persalinan dan kelahiran. Termasuk cara membedakan mana kontraksi palsu dan kontraksi tanda persalinan, juga bagaimana cara menghadapi dan mengatasi rasa sakit melahirkan. Dokter juga akan terus memantau ukuran besar perut Anda setiap kali konsultasi untuk memeriksa pertumbuhan bayi.

Selain itu, konsultasi di akhir trimester kehamilan ini juga sekaligus untuk memeriksa kondisi vagina. Apakah ada risiko infeksi dan melihat kondisi leher rahim sudah membuka atau belum.

Di trimester ketiga ini, ibu hamil harus mendapatkan tes GBS (tes infeksi grup B streptococcus) di antara minggu ke-35 dan 37 untuk menghindari risiko infeksi pada bayi selama persalinan nanti. Jika tidak ditawarkan oleh dokter, Anda dapat memintanya dari jauh-jauh hari.

Second Trimester - American Pregnancy Association. (2012). Retrieved 14 October 2020, from https://americanpregnancy.org/healthy-pregnancy/pregnancy-health-wellness/second-trimester-1290 Drugs, H.

(2020). Isotretinoin: MedlinePlus Drug Information. Retrieved 14 October 2020, from https://medlineplus.gov/druginfo/meds/a681043.html Folic Acid. (2020). Retrieved 14 October 2020, from https://www.cdc.gov/ncbddd/folicacid/about.html default – Stanford Children’s Health.

(2020). Retrieved 14 October 2020, from https://www.stanfordchildrens.org/en/topic/default?id=fetal-circulation-90-P01790 Development of Blood Vessels and Fetal Circulation - Anatomy and Physiology II. (2020). Retrieved 14 October 2020, from https://courses.lumenlearning.com/suny-ap2/chapter/development-of-blood-vessels-and-fetal-circulation/ Fetal Heart Monitoring.

(2020). Retrieved 14 October 2020, from https://www.hopkinsmedicine.org/health/treatment-tests-and-therapies/fetal-heart-monitoring Fetal ultrasound – Mayo Clinic. (2020). Retrieved 14 October 2020, from https://www.mayoclinic.org/tests-procedures/fetal-ultrasound/about/pac-20394149 Encyclopedia, M., & development, F. (2020). Fetal development: MedlinePlus Medical Encyclopedia. Retrieved 14 October 2020, from https://medlineplus.gov/ency/article/002398.htm Fetal development: What happens during the 1st trimester?.

(2020). Retrieved 14 October 2020, from https://www.mayoclinic.org/healthy-lifestyle/pregnancy-week-by-week/in-depth/prenatal-care/art-20045302#main Encyclopedia, M., & development, F. (2020). Fetal development: MedlinePlus Medical Encyclopedia.

Retrieved 14 October 2020, from https://medlineplus.gov/ency/article/002398.htm Studholme, C. (2011). Mapping Fetal Brain Development In Utero Using Magnetic Resonance Imaging: The Big Bang of Brain Mapping. Annual Review Of Biomedical Engineering, 13(1), 345-368.

doi: 10.1146/annurev-bioeng-071910-124654 Fetal development: Month-By-Month Stages of Pregnancy. (2020). Retrieved 14 October 2020, from https://my.clevelandclinic.org/health/articles/7247-fetal-development-stages-of-growth Neural tube defects. (2020). Retrieved 14 October 2020, from https://www.marchofdimes.org/complications/neural-tube-defects.aspx Baby’s Brain Begins Now: Conception to Age 3.

(2020). Retrieved 14 October 2020, from http://www.urbanchildinstitute.org/why-0-3/baby-and-brain

Menghilangkan BULU HALUS PADA BAYI - Saat memandikan bayi




2022 www.videocon.com