Pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan

pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan

Ikut jam dari kiri: buaya katak ( Crocodylus porosus), aligator Amerika ( Alligator mississippiensis), dan gharial ( Gavialis gangeticus) Pengelasan saintifik Alam: Haiwan Filum: Kordata Kelas: Reptilia Klad: Eusuchia Order: Crocodilia Owen, 1842 Subkumpulan • † Borealosuchus • † Planocraniidae • † Pristichampsidae • Gavialoidea • Brevirostres • Alligatoroidea • Crocodyloidea Taburan buaya Buaya merupakan rumpun reptilia pemangsa besar separa akuatik yang tergolong dalam order Crocodilia (atau Crocodylia).

Buaya mula-mula muncul 83.5 juta tahun dahulu pada Akhir Usia Kapur (tahap Campanian) dan merupakan saudara hidup terdekat bagi burung kerana kedua-dua rumpun ini adalah ahli Archosauria yang tinggal. Ahli-ahli total group order ini, iaitu klad Pseudosuchia, muncul kira-kira 250 tahun dahulu pada usia Awal Trias lalu berdiversifikasi sepanjang era Mesozoik. Order Crocodilia termasuklah suku "buaya sejati" (keluarga Crocodylidae), suku aligator (keluarga Alligatoridae), dan suku gharial dan jejulung (keluarga Gavialidae).

Sebagai biawak yang berbadan seakan biawak yang besar dan sasa, buaya mempunyai jongor yang panjang dan leper, ekor yang termampat sisi, dan mata, telinga dan liang hidung di atas kepala. Buaya berenang dengan baik dan dapat berjalan di atas darat dengan mengangkat atau menurunkan badan, malah spesies kecil-kecil pun dapat berjalan menderap.

Kulitnya tebal dilitupi sisik yang tidak bertindan. Buaya mempunyai gigi berbentuk kon seakan pepaku dengan gigitan yang kencang. Jantungnya berkebuk empat seakan-akan seperti burung. Dalam paru-parunya adalah sistem peredaran berpusing-pusing satu arah. Seperti semua reptilia bukan avian yang lain, buaya bersifat ektoterma (berdarah sejuk). Buaya umumnya terdapat di kawasan tanah panah tropika, tetapi suku aligator juga tinggal di Amerika Syarikat tenggara dan Sungai Yangtze di China.

Rata-ratanya haiwan daging, memakan haiwan-haiwan lain seperti ikan, ketam, udang, sotong, siput, burung mahupun mamalia. Sesetengah spesies seperti gharial India makan benda tertentu, sementara yang lain seperti buaya katak makan bermacam-macam sahaja. Buaya lazimnya hidup bersendirian dan menjaga wilayah, tetapi adakalanya makan beramai-ramai.

Sewaktu membiak, jantan dominan cuba membolot betina-betina yang sedia ada. Betina bertelur dalam lubang atau guar. Tidak seperti kebanyakan reptilia lain, buaya menjaga anak yang baru menetas.

Diketahuinya lapan spesies buaya yang pernah menyerang manusia. Jumlah serangan terbesar datang daripada buaya Nil. Manusia merupakan ancaman terbesar bagi populasi buaya menerusi aktiviti seperti pemburuan dan pembasmian habitat, tetapi penternakan buaya telah banyak mengurangkan perdagangan kulit buaya liar haram.

Buaya banyak terdapat dalam seni dan sastera seluruh dunia sejak seawal zaman Mesir Kuno. Cerita paling awal tentang buaya yang meratapi mangsa keluar pada abad ke-9, kemudian disebarkan oleh Sir John Mandeville pada 1400 dan sekali lagi oleh William Shakespeare pada peralihan abad ke-17.

Isi kandungan • 1 Etimologi • 2 Morfologi dan fisiologi • 2.1 Gerak alih • 2.2 Rahang dan gigi • 2.3 Kulit dan sisik • 2.4 Peredaran • 2.5 Pernafasan • 2.6 Pencernaan • 2.7 Kawalan suhu • 2.8 Kawalan osmosis • 3 Ekologi dan sejarah hidup • 3.1 Taburan dan habitat • 3.2 Pemakanan • 3.3 Pembiakan dan penjagaan anak • 3.4 Komunikasi • 3.5 Tumbesaran dan mortaliti • 3.6 Peranan ekologi • 4 Evolusi dan pengelasan • 4.1 Evolusi • 4.2 Hubungan • 4.3 Taksonomi • 5 Hubungan buaya dengan manusia • 5.1 Penternakan • 5.2 Serangan • 5.3 Sebagai peliharaan • 5.4 Dalam perubatan • 6 Pemuliharaan • 7 Gambaran budaya • 7.1 Dalam mitos dan budaya rakyat • 7.2 Dalam sastera • 7.3 Dalam media dan sukan • 8 Rujukan • 8.1 Bibliografi • 9 Pautan luar Etimologi [ sunting - sunting sumber ] Perkataan buaya dalam bahasa Melayu diturunkan dari perkataan leluhur bahasa Melayu-Polinesia buqaya yang bermaksud "buaya" dan juga "tamak".

[1] Perkataan yang sama diturunkan kepada pelbagai bahasa yang dituturkan Nusantara dan juga memaksudkan haiwan yang sama. Nama keluarga Crocodilia berupa " pelatinan" bagi perkataan Yunani κροκόδειλος ( crocodeilos), yang memaksudkan makhluk dalam rumpun biawak atau buaya Nil. [2] Crocodylia, seperti yang dicipta oleh Wermuth sempena genus Crocodylus nampaknya datang dari bahasa Yunani kuno [3] κρόκη ( kroke) yang bermaksud batu kelikir, dan δρîλος or δρεîλος ( dr(e)ilos) yang bermaksud cacing.

Nama itu mungkin sempena tabiat buaya yang berjemur di atas tebing kelikir Sungai Nil. [4] Morfologi dan fisiologi [ sunting - sunting sumber ] Buaya seperti spectacled caiman ini boleh menyorok dalam air dengan hanya timbul liang hidung, mata dan telinga.

Saiz rumpun buaya adalah dari sekecil spesies Paleosuchus dan Osteolaemus yang mencapai 1–1.5 m (3 ka 3 in–4 ka 11 in) hingga sebesar buaya katak yang mencapai 7 m (23 ka) dan berat sebanyak 2,000 kg (4,400 lb), namun sesetengah spesies prasejarah seperti Deinosuchus dari akhir Usia Kapur jauh lebih besar pada panjang 11 m (36 ka) [5] dan berat 3,450 kg (7,610 lb).

Buaya jantan selalunya jauh lebih besar daripada betina. [6] Biarpun pelbagai bentuk muncung dan giginya, semua spesies buaya sama sahaja morfologi badannya. Buaya mempunyai badan seakan biawak yang tegap dan sasa dengan muncung yang rata dan ekor yang termampat sisi.

Kakinya semua pendek; kaki depan ada lima jari dengan sedikit selaput, sementara kaki depan ada empat jari berselaput dengan jari kelima rudimen. [7] Rangkanya cukup tipikal bagi haiwan berkaki empat tetapi tengkorak, pelvis (tulang punggung) dan tulang rusuknya terbina khusus; terutama sekali, proses-proses rawan dalam tulang rusuk membolehkan toraks untuk kendur sewaktu menyelam sementara struktur pelvis dapat menampung jumlah ambilan makanan yang besar, ataupun lebih banyak udara dalam paru-paru.

Jantan dan betina pun ada kloaka, iaitu kebuk dan salur keluar tunggal di dasar ekor yang berhubung dengan salur usus, kencing dan kelamin sekali gus. Dalam kloaka bertempatlah zakar jantan dan klitoris betina. [8] Zakar buaya tegak kekal dan bergantung pada otot kloaka untuk membokong, dan ligamen elastik dan tendon untuk menyentak. [9] Testis atau ovari terletak hampir dengan ginjal. [10] Mata, telinga dan liang hidung buaya terletak di atas kepala. Ini membolehkan buaya untuk menghendap mangsa dengan kebanyakan air di bawah permukaan air.

[11] Buaya mempunyai tapetum lucidum yang memudahkan penglihatan dalam cahaya malap. Penglihatan jelas di udara tetapi banyak merosot di dalam air. [12] Fovea vertebrat lain biasanya berbentuk bulat tetapi bagi buaya pula ia berbentuk garisan mendatar yang padat dengan reseptor yang merentasi bahagian tengah retina.

Apabila buaya tenggelam sepenuhnya, matanya dilitupi oleh membran kelipan ( nictitating membrane). Selain itu, kelenjar pada membran kelipan merembeskan bahan pelincir bergaram yang menjaga kebersihan mata. Apabila buaya keluar dari air dan mengering, bahan ini kelihatan seperti "air mata". Telinga buaya tersesuai untuk pendengaran dalam udara dan air. Gegendang telinganya dilindungi oleh kelepak yang bole ditutup buka oleh otot.

[13] Buaya mempunyai julat pendengaran yang luas dengan kepekaan yang setanding dengan kebanyakan burung dan mamalia. [14] Buaya ada satu kebuk pembauan sahaja, malah yang dewasa pula tiada organ vomeronasal, [15] menunjukkan semua persepsi pembauan terhad kepada sistem pembauan.

Eksperimen kelakuan dan olfaktometer (ukuran bau) menunjukkan bahawa buaya mengesan bahan kimia bawaan udara dan larutan air serta menggunakan sistem pembauan untuk memburu. Apabila di atas air, buaya meningkatan kebolehannya untuk mengesan bahan pembau mudah meruap dengan "mengepam kerongkong" ( gular pumping), iaitu pergerakan beritma pada dasar farinks. [16] [17] Saraf trigeminal yang cukup matang membolehkan buaya untuk mengesan getaran dalam air (seperti yang dibuat oleh mangsa potensi).

[18] Lidahnya tidak dapat bergerak dengan bebas tetapi dipegan oleh membran yang berlipat. Sungguhpun agak kecil otaknya, buaya mampu belajar lebih pantas daripada reptilia lain. [19] Biarpun tiada lipatan vokal seperti mamalia mahupun sirinks burung, [20] buaya dapat bersuara dengan menggetarkan tiga helai kelepak di dalam larinksnya.

[21] Gerak alih [ sunting - sunting sumber ] Buaya Nil berenang. Turutan dari kanan ke kiri. Buaya tangkas sekali berenang. Sewaktu bergerak dalam air, ekornya beralun dari sebelah ke sebelah untuk memacu buaya dalam air sementara kaki dirapatkan dengan badan untuk mengurangkan seretan.

[22] Apabila buaya perlu berhenti, berkemudi, atau berubah arah, kakinya kembang. Buaya umumnya berenang perlahan di permukaan mahupun dasar air dengan menggerakkan ekor pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan gemalai dan meliuk-liuk, tetapi apabila dikejar atau mengejar mangsa ia boleh bergerak pantas. [23] Buaya kurang tersesuai untuk berjalan di atas daratan, malah berada di luar kebiasaan vertebrat dengan mempunyai dua kaedah pergerakan atas darat, iaitu berjalan tinggi (mengangkat badan) dan berjalan rendah (menurunkan badan).

Sendi buku lalinya berlentur tegang lain daripada reptilia lain, tetapi serupa dengan sesetengah archosaur purba. Salah sebatang tulang dari pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan atas iaitu astragalus, bergerak bersama tibia dan fibula.

Yang satu lagi iaitu calcaneum secara fungsinya menganggotai kaki dan mempunyai soket untuk dipasang oleh pepaku dari astragalus. Hasilnya, paha boleh ditegakkan di bawah badan apabila di daraat, dan kakinya dapat berputar ketika berjalan dengan pergerakan buku lali berpusing.

[24] Buaya seperti aligator Amerika ini dapat "berjalan angkat badan" dengan paha tegak, tidak seperti reptilia lain. Jalan tinggi buaya dengan mengangkat perut dan pangkal ekor dari tanah, adalah unik dalam kalangan reptilia yang wujud. Seakan-akan jalan kaki mamalia dengan turutan jalan kaki yang sama: kiri depan, kanan belakang, kanan depan, kiri belakang.

Jalan rendah pula serupa dengan jalan tinggi tetapi tanpa mengangkat badan, malah agak berbeza dengan jalan terbongkong salamander dan biawak. Buaya boleh bertukar ragam jalannya dengan sekelip mata tetapi jalan tinggilah kebiasaannya ketika di darat. Buaya boleh terus mengangkat badan dan berjalan tinggi dengan segera, membuat selangkah dua jalan rendah sebelum menaikkan badan.

Tidak seperti vertebrat daratan yang lain, apabila meningkatkan rentak jalan buaya meningkatkan kelajuan ayunan ke depan setiap betis kaki; dengan cara ini, panjang langkah makin meningkat sementara tempoh makin singkat. [25] Biarpun lazimnya perlahan di atas daratan, buaya dapat memecut sekejap. Ada yang boleh berlari sepantas 12 hingga 14 km/j (7.5 hingga 8.7 mph) untuk jarak dekat. [26] Kemasukan pantas ke dalam air dari tebing berlumpur dapat dilakukan dengan terjun ke dalam tanah, berbelok-belok dari sisi ke sisi dan mengembangkan kaki.

Dalam beberapa spesies kecil seperti buaya air tawar, gaya jalan berlari boleh beransur meningkat jadi derapan melonjak. Untuk ini, kaki belakang melancarkan badan kemudian kaki depan menanggung berat.

Seterusnya, kaki belakang mengayun ke depan sementara tulang belakang berlentur tegang ke depan dan belakang, dan urutan pergerakan ini berulang-ulang. [27] Sewaktu bergerak di atas darat, buaya dapat meluruskan belakang dan ekor kerana sisiknya melekap pada vertebra dengan otot.

Baik di darat mahupun di air, buaya dapat melompat dengan menekankan ekor dan kaki belakang ke atas substrat (dasar) dan kemudian melancarkan diri ke dalam udara. [28] Rahang dan gigi [ sunting - sunting sumber ] Tengkorak buaya Nil ( Crocodylus niloticus) berbanding tengkorak manusia.

Bentuk muncung buaya berbeza antara spesies. Suku buaya sejati mempunyai muncung yang lebar mahupun runcing, sedangkan suku aligator rata-rata bermuncung lebar. Gharial mempunyai muncung yang teramat panjang. Otot yang menutup rahang jauh lebih besar dan berkuasa daripada yang membuka, malah rahang buaya boleh ditahan tutup oleh orang dengan cukup senang, tetapi teramat sukar untuk dipaksa buka.

[29] Otot penutup yang kuat melekap di bahagian median rahang bawah sementara engsel rahang melekap pada sendi atlantooksiput, membolehkan buaya untuk membuka mulut luas-luas. Buaya mempunyai daya cakupan (gigitan) yang terkuat di seluruh alam haiwan. Dalam kajian terbitan 2003, daya cakupan aligator Amerika berukuran sebanyak 2,125 lbf (9,450 N). [30] Dalam kajian 2012, daya cakupan buaya katak pula jauh lebih tinggi ukurannya pada 3,700 lbf (16,000 N). Kajian ini juga mendapati tiada korelasi antara daya cakupan dan bentuk muncung.

Apapun, rahang jelujung yang terlalu runcing agak lemah dan lebih tersesuai untuk menutup rahang dengan pantas. Daya cakupan Deinosuchus mungkin berukuran 23,000 lbf (100,000 N), [31] jauh lebih hebat daripada dinosaur berkaki dua seperti Tyrannosaurus. Gigi buaya ada yang tumpul dan ada yang tajam hingga bak jarum. Spesies muncung lebar mempunyai gigi pelbagai saiz, sementara yang bermuncung runcing rata-rata sama bentuk sahaja giginya. Gigi buaya sejati dan jelujung selalunya lebih ketara daripada gigi aligator apabila rahang tutup.

[32] Cara yang paling senang untuk membezakan buaya sejati dan aligator ialah memperhatikan garis rahangnya. Gigi pada rahang bawah aligator muat ke dalam soket rahang atas, jadi hanya gigi atas yang kelihatan apabila mulut tutup. Buaya sejati pula gigi bawah muat ke dalam alur di luar rahang atas, jadi kedua-dua gigi atas dan bawah kelihatan apabila mulut tutup.

[33] Buaya dapat menggantikan setiap satu daripada kira-kira 80 batang giginya sebanyak 50 kali dalam jangka hayat 35 hingga 75 tahun.

[34] Buayalah satu-satunya vertebrat bukan mamalia yang mempunyai soket gigi. [35] Di sebelah setiap gigi yang tumbuh matang terdapat sebatang gigi ganti kecil dan sel tunjang odontogenik (pengembang gigi) yang sedia menunggu untuk dihidupkan apabila perlu. [36] Makin tua si buaya, makin perlahanlah pergantian gigi sehingga akhirnya berhenti. Kulit dan sisik [ sunting - sunting sumber ] Kulit buaya Nil muda Kulit buaya tebal berkematu, dilitupi oleh sisik yang tidak bertindih-tindih yang dipanggil "skut", tersusun dalam baris-baris dan corak yang nalar.

Sisik ini dihasilkan secara berterusan oleh pembahagian sel di dalam lapisan bawah epidermis, iaitu stratum germinativum, dan permukaan skut sebutir demi sebutir bersalin dari masa ke semasa. Permukaan luar skut terdiri daripada beta-keratin yang agak tegar sementara bahagian pelekat antara skut-skut hanya mengandungi alpha-keratin yang lebih lentur.

[37] Kebanyakan skut diperkuat oleh plat-plat bertulang yang dipanggil osteoderma, yang sama saiz dan bentuk dengan sisik-sisik luar tetapi tumbuh di bawah sisik. Skut paling banyak tumbuh di belakang dan leher buaya dan boleh menjadi perisai perlindungan. Skut selalunya mempunyai rabung-rabung yang menonjol dan berketul-ketul, dilitupi dengan beta-keratin tahan lasak. Kebanyakan kulit kepala terlakur pada tengkorak.

[38] Kulit leher dan rusuknya longgar sementara kulit perut dan bahagian bawah ekor bersarungkan skut-skut berbentuk petak yang besar dan rata, tersusun dalam baris yang kemas-kemas. [39] Skut mengandungi salur darah dan boleh bertindak untuk menyerap atau memancarkan haba ketika mengawal suhu badan.

Kajian juga mendapati bahawa ion-ion alkali yang terlepas ke dalam darah daripada kalsium dan magnesium dalam tulang ini bertindak sebagai penimbal sewaktu menyelam lama-lama, apabila peningkatan tahap karbon dioksida dapat menyebabkan kandungan asid berlebihan.

[40] Sesetengah skut mengandungi liang tunggal yang dipanggil "organ deria integumen". Buaya sejati dan gharial mempunyai anggota ini di hampir seluruh badan sementara bagi suku aligator hanya terdapat di kepala. Fungsi sebenarnya tidak difahami sepenuhnya, tetapi dihujahkan bahawa ia merupakan organ deria pergerakan. [41] Mungkin juga bahawa organ ini boleh menghasilkan rembesan berminyak yang mencegah lekapan lumpur pada kulit.

Terdapat kelenjar integumen berpasangan yang ketara pada lipatan kulit pada kerongkong dan juga dinding sisi kloaka. Pernah dihujahkan pelbagai fungsinya. Ia mungkin memainkan peranan dalam komunikasi kerana bukti tak langsung menunjukkan bahawa ia mengeluarkan feromon yang digunakan untuk mengawan dan membuat sarang.

Kulit buaya keras sekali dan dapat menahan kerosakan daripada buaya lain, malah sistem imunnya cukup berkesan untuk menyembuhkan luka dalam beberapa hari. [42] Peredaran [ sunting - sunting sumber ] Barangkali bahawa buaya mempunyai sistem peredaran yang paling kompleks bagi mana-mana verterbrat. Jantungnya berkebuk empat dengan dua ventrikel, sifat yang luar biasa sekali bagi semua reptilia yang hidup. [43] Juga terdapat aorta kiri dan kanan yang tersambung dengan lubang "foramen Panizza".

Seperti burung dan mamalia, buaya mempunyai injap jantung yang mengaruhkan darah ke dalam satu arah melalui kebuk-kebuk jantung. Juga terdapat injap seakan gerigi kog yang unik yang apabila saling berkunci mengaruhkan darah ke dalam aorta kiri dan jauh dari paru-paru, dan kemudian kembali mengitari badan.

[44] Sistem ini mungkin membolehkan buaya untuk menyelam lama-lama, [45] tetapi penjelasan ini telah dipertikaikan. [46] Lain-lain sebab yang berkemungkinan bagi sistem peredaran unik ini termasuk bantuan dengan keperluan mengawal suhu, mencegah sembap paru-paru, ataupun cepat sembuh dari asidosis metabolik. Menyimpan karbon dioksida dalam badan membolehkan peningkatan kadar rembesan asid gastrik dan ole itu kecekapan pencernaan, malah organ-organ gastrousus lain seperti pankreas, simpa, usus kecil, dan hati juga berfungsi dengan lebih cekap.

[47] Apabila menyelam, jantung buaya memperlahan hingga satu dua denyutan seminit, manakala aliran darah ke dalam otot dikurangkan.

Apabila buaya naik untuk bernafas, kadar jantungnya naik mendadak dalam beberapa saat, sementara otot menerima darah teroksigen baharu. [48] Tidak seperti kebannyakan mamalia laut, buaya mempunyai sedikit mioglobin untuk menyimpan oksigen di dalam otot.

Ketika menyelam, otot dibekali dengan oksigen apabila tumpuan ion bikarbonat yang meningkat menyebabkan hemoglobin dalam darah melepaskan oksigen. [49] Pernafasan [ sunting - sunting sumber ] Pada asalnya buaya disangka bernafas seperti mamalia dengan aliran udara keluar masuk seperti pasang surut, tetapi kajian yang disiarkan pada 2010 dan 2013 menyimpulkan bahawa buaya bernafas lebih seakan burung dengan aliran udara bergerak dalam pusingan satu arah di dalam paru-paru.

Apabila buaya menyedut, udara mengalir melalui trakea ke dalam dua bronkus (jalan udara) primer yang bercabang ke dalam laluan sekunder yang lebih sempit. Udara terus bergerak melalui semua ini, kemudian ke dalam jalan udara yang makin sempit, dan kemudian ke dalam jalan udara sekunder yang dilangkau dahulu. Kemudian udara itu beralir kembali ke dalam salur udara primer dan dihembuskan.

Injap-injap aerodinamik dalam pepohon bronkus ini telah dihipotesiskan untuk menjelaskan bagaimana buaya boleh mempunyai aliran udara satu arah tanpa bantuan pundi udara seakan burung. [50] [51] Paru-paru buaya melekap pada hati dan pelvis dengan pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan diafragmatikus" (yang sama fungsinya dengan diafragma mamalia).

Ketika menyedut, otot-otot interkostal luar mengembangkan tulang rusuk, membolehkan buaya untuk menyedut lebih udara, sementara otot iskiopubis menyebabkan pinggul berayun ke bawah serta menolak perut ke luar, dan diaphragmaticus menarik hati ke belakang. Apabila menghembus, otot-otot interkostal dalam menolak tulang rusuk ke dalam, sementara rektus abdominis menarik pinggul dan hati ke hadpaan dan perut ke dalam.

[52] [53] Oleh sebab paru-paru berkembang ke dalam ruang yang dahulu diisi oleh hati bahkan termampat apabila bergerak kembali ke posisi asal, pergerakan ini kadangkala digelar " hepatic piston" (omboh hati). Buaya boleh juga menggunakan otot-otot ini untuk melaraskan kedudukan paru-paru; dan oleh itu mengawal keapungan dalam air. Buaya tenggelam apabila paru-parunya tertarik ke arah ekor; buaya timbul apabila paru-paru bergerak kembali ke arah kepala.

Ini membolehkan buaya untuk bergerak melalui air tanpa membuat gangguan yang boleh menjagakan mangsa. Selain itu, buaya boleh juga berputar dan berpusing dengan menggerakan paru-paru ke sisi.

[54] Buaya yang berenang dan menyelam kelihatan bergantung pada isipadu paru-paru lebih untuk berapung daripada menyimpan oksigen. Sejurus sebelum menyelam, buaya mengembus untuk mengurangkan isipadu paru-paru dan mencapai keapungan negatif.

[55] Sekali tenggelam, liang hidungnya tutup rapat. Semua spesies mempunyai injap lelangit, iaitu kelepak kulit bermembran di belakang rongga mulut yang menghalang air daripada mengalir ke dalam kerongkong, esofagus, dan trakea. Ini membolehkan buaya untuk membuka mulut di dalam air tanpa lemas. Buaya biasanya kekal dalam air selama 15 minit ke bawah sekali, tetapi ada yang boleh menahan nafas selama dua jam dalam keadaan yang ideal.

[56] Kedalaman menyelam maksimumnya tidak dipastikan tetapi buaya mampu menyelam sekurang-kurangnya 20 m (66 ka). [57] Pencernaan [ sunting - sunting sumber ] Gigi buaya tersesuai untuk mencakup dan menggonggong mangsa.

Makanan ditelan terus tanpa dikunyah. Saluran pencernaannya agak pendek kerana daging agak senang untuk dihadam. Perutnya ada dua bahagian, iaitu hempedal berotot yang mengisar makanan, dan kebuk pencernaan di mana enzim bertindak. [58] Perut buaya lebih berasid daripada mana-mana perut vertebrat yang lain, bahkan mengandungi rabung-rabung untuk gastrolitos yang memainkan peranan dalam pemecahan makanan secara mekanik.

Pencernaan lebih cpeat dalam suhu tinggi. Buaya mempunyai tahap metabolisme yang amat rendah dan oleh itu kurang memerlukan tenaga. Oleh itu buaya dapat hidup berbulan-bulan dengan hanya sekali makan besar-besar, mencerna makanan dengan perlahan-lahan.

Buaya dapat bertahan dengan "puasa" berlarutan, bergantung pada lemak simpanan antara masa makan. Anak buaya yang baru menetas pun mampu hidup selama 58 hari tanpa makanan, susut 23% berat badan sepanjang tempoh itu. Buaya dewasa memerlukan dari 1/10 hingga 1/5 daripada jumlah makanam yang perlu bagi singa yang sama berat, malah boleh hidup separuh tahun tanpa makan.

[59] Kawalan suhu [ sunting - sunting sumber ] Gharial India tawanan berjemur sambil ternganga Buaya adalah haiwan ektoterma (berdarah sejuk), menghasilkan haba dalaman yang agak sedikit dan bergantung pada sumber luar untuk menaikkan suhu badan. Haba matahari merupakan kaedah pemanasan utama bagi sebarang buaya, sementara merendam dalam air boleh menaikkan suhunya secara pengaliran haba ataupun menyejukkan buaya dalam cuaca panas. Kaedah utama bagi mengawal suhunya bercirikan kelakuan.

Contohnya, buaya di kawasan beriklim sederhana boleh memulakan harinya dengan berjemur di bawah matahari di atas darat. Buaya yang besar dan tebal memanaskan badan dengan perlahan tetapi pada lewat siang ia bergerak ke dalam air dan masih mendedahkan belakangnya kepada matahari.

Pada waktu malam buaya kekal menyelam dan suhunya beransur-ansur menurun. Tempoh berjemur lebih panjang pada musim sejuk dan lebih singkat pada musim panas. Bagi buaya di tropika, isu utama ialah mengelakkan pemanasan berlebihan. Buaya boleh berjemur sejenak pada waktu pagi tetapi kemudian bergerak ke dalam teduhan dan kekal berteduh sampai malam, ataupun menyelam dalam air untuk kekal nyaman.

Mulut ternganga boleh menyejukkan badan menerusi penyejatan dari lapis mulut. [60] Dengan cara-cara inilah julat suhu buaya dikekalkan antara 25 dan 35 °C (77 dan 95 °F), dan kekal terutamnya dalam julat 30 hingga 33 °C (86 hingga 91 °F).

[61] Taburan aligator Amerika dan aligator Cina menjangkau kawasan-kawasan yang kadang-kadang mengalami tempoh fros pada musim sejuk. Sebagai haiwan ejtoterma, suhu dalam badan buaya jatuh apabila suhu menurun, maka buaya itu menjadi lembab. Secergas mana pun pada musim panas, buaya lazimnya langsung tidak makan pada musim sejuk.

Dalam cuaca sejuk, buaya itu kekal menyelam dengan ekor masuk air yang lebih dalam dan kurang sejuk, dan liang hidungnya timbul di permukaan.

Jika ais terbentuk, buaya menjaga liang pernafasan bebas ais, malah ada kalanya muncung buaya beku dalam ais. Alat prob mengesan suhu yang terpasang dalam aligator Amerika liar mendapati bahawa suhu badan terasnya boleh jatuh kepada sekitar 5 °C (41 °F), tetapi selagi buaya itu dapat bernafas maka tiadanya kesan mudarat apabila cuaca memanas.

Kawalan osmosis [ sunting - sunting sumber ] Buaya katak berehat di pantai Tiada satu pun spesies buaya yang boleh dikira haiwan laut; sungguhpun buaya katak dan buaya Amerika dapat berenang jauh ke laut, namun habitat normalnya ialah mulut sungai, muara, hutan paya bakau, dan tasik hipersalinus, tetapi ada beberapa spesies pupus yang berhabitatkan laut, termasuklah "Gavialis" papuensis yang pupus baru-baru ini, yang pernah wujud di habitat lautan sepenuhnya di pesisir Kepulauan Solomon.

[62] Semua buaya perlu mengekalkan kepekatan garam dalam bendalir badan pada tahap yang sesuai. Pengosmokawalaturan ( osmoregulation) berkenaan dengan jumlah garam dan air yang ditukarkan dengan persekitaran. Pengambilan air dan garam berlaku di sepanjang lapis mulut, apabila air diminum, baik secara kebetulan sewaktu makan, mahupun air yang hadir dalam makanan. [63] Air hilang dari badan ketika bernafas, malah garam dan air sekali gus tersingkir dalam kencing dan tinja, melalui kulit, dan melalui kelenjar kumuh garam pada lidah (yang hadir pada buaya sejati dan jelujung).

[64] [65] Kulitnya merupakan penebat yang cukup berkesan kepada air mahupun ion. Mulut ternganga menyebabkan penyingkiran air secara penyejatan daripada lapis mulut, malah di daratan, air juga tersingkir melalui kulit. Buaya besar lebih mampu mengekalkan homeostasis ketika tekanan osmotik daripada yang kecil.

Anak buaya yang baru menetas jauh kurang menahan keterdedahan kepada air garam daripada anak-anak yang lebih tua, mungkin kerana lebih tinggi nisbah luas permukaan ke isipadu. Sistem kinjal dan perkumuhannya lebih kurang sama dengan reptilia lain, tetapi buaya tiada pundi kencing. Dalam air tawar, keosmolalan (kepekatan zat terlarut yang menyumbang kepada tekanan osmotik larutan) dalam plasma lebih tinggi berbanding air sekeliling. Buaya sudah cukup hidrasi, air kencing dalam kloaka banyak dan cair, nitrogen dikumuhkan sebagai amonium bikarbonat.

[66] Penyingkiran natrium rendah dan banyak berlaku di seluruh kulit dalam keadaan air tawar. Bertentangan pula air masin, di mana keosmolalan dalam plasma rendah daripada air sekeliling, menyebabkan nyahhidrasi. Kencing kloaka lebih pekat, putih dan legap, dengan bahan buangan bernitrogen rata-rata dikumuhkan sebagai asid urik yang tidak terlarut. Ekologi dan sejarah pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan [ sunting - sunting sumber ] Taburan dan habitat [ sunting - sunting sumber ] Spectacled caiman merendam dalam air yang dilitupi dedaun Buaya merupakan reptilia amfibia yang membahagikan masa antara air dan daratan.

Genus daratan sepenuhnya yang terakhir, iaitu Mekosuchus, pupus kira-kira 3000 tahun dahulu setelah manusia tiba di kepulauan Pasifik yang didiaminya, maka kepupusan itu mungkin disebabkan oleh manusia.

[67] Rata-ratanya buaya haiwan tropika; kecualinya aligator Amerika dan China yang masing-masing menjangkau taburan sejauh Amerika Syarikat tenggara dan Sungai Yangtze.

Hanya di Florida, Amerika Syarikat di mana buaya sejati dan aligator hidup bersampingan. [68] Kebanyakan buaya hidup di tanah pamah. Hanya sedikit yang terdapat di atas paras 1,000 meter (3,300 ka), di mana suhu lazimnya kira-kira 5 °C (9 °F) lebih rendah daripada pesisir. Tiada satu pun yang kekal hidup dalam laut, tetapi ada yang boleh merenangi laut, malah beberapa spesies dapat menahan air payau kuala, paya bakau, dan kemasinan melampau dalam tasik hipersalinus.

[69] Buaya katak mempunyai taburan terluas daripada segala jenis buaya dengan taburan dari India timur ke New Guinea dan Australia utara. Kejayaannya antara lain disebabkan kemampuannya untuk berenang jauh ke laut dan menjajah lokasi baru, tetapi tidak terhad kepada persekitaran laut dan banyak meluangkan masa di muara, sungai dan tasik besar. [70] Buaya menggunakan pelbagai jenis habitat akuatik. Sesetengah spesies lebih gemar berjalan di atas darat dan menggemari paya, kolam dan tepi tasik di mana ia dapat berjemur di bawah matahari dan terdapat banyak hidupan tumbuhan yang menampung fauna yang pelbagai.

Yang lain pula gemar berendam dalam air dan menduduki hilir sungai, paya bakau dan kuala. Habitat-habitat ini juga kaya dengan flora dan sumber makanan. Buaya gharial mencari ikan untuk dimakan di dalam kolam dan air mati dari sungai deras. Caiman kerdil Amerika Selatan menduduki anak sungai yang nyaman dan mengalir cepat, biasanya berdekatan air terjun, sementara caiman lain tinggal di tasik keruh yang lebih panas dan sungai yang mengalir perlahan. Buaya sejati rata-rata tinggal di sungai, sementara aligator Cina terdapat di sungai keruh yang mengalir perlahan di seluruh dataran banjir China.

Aligator Amerika senang menyesuaikan diri dan menduduki kawasan paya, sungai atau tasik dengan air yang pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan mahupun keruh.

Faktor iklim juga mempengaruhi taburan buaya tempatan. Pada musim kemarau, caiman boleh terhad kepada kolam jeluk di sungai selama berbulan-bulan; pada musim tengkujuh, kebanyakan savana di llanos Venezuela dibanjiri, maka caiman itu bertempiran di seluruh dataran.

[71] Buaya gurun di Mauritania tersesuai dengan persekitaran gersangnya dengan tinggal dalam gua atau lubang dalam ekadaan pengestivatan tatkala paling kering. Apabila hujan, buaya gurun itu berkumpul di guelta.

[72] Buaya Amerika berjemur Darat kering juga penting untuk dapat berjemur, bersarang dan berteduh dari suhu melampau. Mulut menganga membolehkan penyejatan kelembapan dari lapis mulut serta menyejukkan badan, malah beberapa spesies memanfaatkan lubang cetek di atas tanah untuk menyejuk. Berkubang dalam lumpur juga boleh mencegah pemanasan berlebihan.

[73] Empat spesies buaya memanjat pokok untuk berjemur di kawasan yang tiada pesisir pantai. [74] Jenis tumbuhan di tepi sungai dan tasik yang didiami buaya rata-ratanya hutan tropika lembap, dengan paya bakau di kawasan muara.

Hutan-hutan ini amat penting bagi buaya dengan mewujudkan mikrohabitat yang sesuai untuk buaya mekar. Akar pokoknya menyerap air ketika hujan, kemudian melepaskan air itu perlahan-lahan ke dalam alam sekitar. Apabila hutan dibasmi untuk pertanian, sungai akan berbelah, air deras mengalir, dan alur air boleh kontang pada musim kemarau sementara banjir boleh berlaku pada musim tengkujuh.

Pemusnahan habitat hutan mungkin lebih menggugat buaya daripada memburu. [75] Pemakanan [ sunting - sunting sumber ] Buaya Nil menyerang hendap gnu yang menyeberangi Sungai Mara Rata-ratanya buaya haiwan karnivor. Lain spesies, lain juga mangsanya, mengikut bentuk muncung dan ketajaman gigi.

Spesies yang tajam gigi dan panjang runcing muncungnya seperti gharial India dan buaya air tawar Australia terkhusus untuk makan ikan, serangga dan krustasia, sementara yang lebar muncung dan tumpul gigi seperti aligator Cina dan caiman bermuncung lebar khusus untuk makan moluska bercangkerang keras. Spesies-spesies yang sederhana muncung dan giginya seperti buaya katak dan aligator Amerika mempunyai pemakanan yang lebih pelbagai dan mengambil kesempatan untuk makan serangga, krustasia, ikan, amfibia, reptilia lain, burung, dan mamalia.

Biarpun rata-ratanya maging, ada segelintir buaya yang didapati makan buah-buahan, mungkin untuk menyebarkan benih. [76] Pada umumnya, buaya adalah pemangsa serang hendap, tetapi strategi memburu berbeza mengikut spesies buaya dan mangsa. Mangsa daratan dihendap dari tepi air lalu dicakup dan dilemaskan. [77] Gharial dan lain-lain spesies makan ikan menghayunkan rahang ke sisi untuk mencakup mangsa, bahkan boleh melompat keluar dari air untuk menangkap burung, kelawar, dan ikan yang melompat-lompat.

Haiwan kecil dapat dibunuh dengan tandukan buaya menggelengkan kepala. Caiman menggunakan ekor dan badan untuk menggiring ikan ke dalam air cetek. Ia juga boleh mengorek untuk invertebrat yang hidup di dasar, malah smooth-fronted caiman juga akan memburu di daratan. Sesetengah spesies buaya telah diperhatikan menggunakan ranting dan dahan untuk mengumpan burung yang membina sarang. [78] Buaya Nil diketahui memburu secara berkumpulan, malah boleh jadi berbilang ekor berkongsi makan satu bangkai.

Kebanyakan spesies akan makan apa-apa sahaja yang dekat dan juga merupakan pebangkai yang oportunis. Gharial makan ikan Buaya tidak dapat mengunyah dan perlu menelan makanan bulat-bulat, maka mangsa yang terlalu besar untuk ditelan perlu disiat-siat. Buaya mungkin sukar menguruskan haiwan yang tebal kulit, dan oleh itu perlu menunggu sehingga bangkai menjadi reput dan mudah pecah. Untuk menyiat tisu dari bangkai besar, buaya memusing-musingkan bangkai sambil menggonggong dengan rahang, iaitu pergerakan yang dipanggil " death roll" (golekan maut).

[79] Ketika makan berkumpulan, boleh jadi bahawa beberapa pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan memegang mangsa sementara yang lain membuat golekan. Buaya-buaya tidak bergaduh, sebaliknya setiap seekor mengambil sahaja secebis daging sambil menunggu giliran seterusnya. [80] Buaya biasanya makan dengan kepala di atas air. Makanan digonggong dengan hujung rahang, dilambungkan ke arah belakang mulut dengan kepala menyentak ke atas dan akhirnya ditelan.

Buaya Nil boleh juga menyimpan bangkai di dasar air untuk dimakan kemudian. Pembiakan dan penjagaan anak [ sunting - sunting sumber ] Ibu aligator Amerika dengan sarang dan anak-anak Buaya pada umumnya bersifat polygini, iaitu setiap ekor jantan cuba mengawan dengan sebanyak mana betina yang boleh. Pernah dicatatkan pasangan monogami dalam kalangan buaya Amerika. [81] Buaya jantan dominan meronda dan mempertahankan wilayah yang merangkumi beberapa ekor betina.

Jantan sesetengah spesies seperti aligator Amerika ciba menarik betina dengan lagak-lagak memikat yang teliti. Sewaktu memikat, buaya jantan dan betina boleh saling menggosok, berpusing-pusing dan berenang dengan lagak. Persetubuhan biasanya berlaku di dalam air. Betina yang bersedia untuk mengawan melengkungkan belakang sambil menyelamkan kepala dan ekor. Jantan bergosok di atas leher betina lalu mencengkam badan betina dengan kaki belakang.

Si jantan meletakkan ekornya di bawah ekor betina supaya kloaka kedua-duanya sejajar untuk memasukkan zakar. Mengawan boleh mengambil masa sebanyak 15 minit, sementara pasangan terus tenggelam timbul. [82] Sedangkan jantan dominan membolot betina yang boleh membiak, diketahui bahawa aligator Amerika boleh jadi banyak bapa, iaitu sebanyak tiga ekor jantan dapat menurunkan seperinduk anak.

Dalam sebulan setelah mengawan, buaya betina mula membuat sarang. Telur buaya Nil Bergantung pada spesiesnya, buaya betina boleh membina lubang atau guar sebagai sarang.

Sarang guar diperbuat daripada dedaun, pasir kumbahan, pasir atau tanih. Sarang buaya selalunya ditemui berdekatan jerumun atau gua. Kadang-kadang ada sarang-sarang lain betina yang berdekatan, pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan dalam spesies bersarangkan lubang.

Jumlah telur seperinduk adalah 10 hingga 50 biji. Telur buaya dilindungi oleh kulit keras buatan kalsium karbonat. Tempoh mengeram dua ke tiga bulan. Suhu eraman telur menentukan jantina anaknya. Suhu sarang nalar lebih 32 °C (90 °F) menghasilkan lebih jantan, sementara yang bawah 31 °C (88 °F) lebih betina.

Namun begitu, jantina buaya boleh ditentukan dalam selang yang singkat, malah sarang tertakluk pada perubahan suhu. Kebanyakan sarang semula jadi menghasilkan anak kedua-dua jantina, tetapi boleh jadi juga seperinduk satu jantina sahaja. Anak buaya boleh semua menetas dalam satu malam. Buaya lain daripada reptilia lain dari segi jumlah jagaan induk selepas anak menetas. Ibu buaya tolong mengeluarkan anak-anak dari sarang dan mengangkut mereka dalam mulut hingga ke air.

Anak buaya baru menetas berhimpun dan bergerak rapat dengan ibu. [83] Bagi spectacled caiman di dataran Venezuela, diketahui bahawa ibu buaya berbanyak-banyak meninggalkan anak di sebuah "pusat jagaan anak" yang dijaga oleh salah seekor ibu.

[84] Anak buaya pelbagai spesies cenderung berjemur secara berkumpulan pada waktu siang dan bersurai untuk makan pada waktu malam. Berbagai-bagai juga masa yang diambil oleh anak buaya untuk berdikari. Bagi aligator Amerika, anak-anak berkumpulan bergaul dengan dewasa selama setahun dua, sementara anak buaya Nil dan buaya katak menjadi berdikari dalam beberapa bulan.

Komunikasi [ sunting - sunting sumber ] Kehidupan sosial buaya bermula apabila ia masih di dalam telur, kerana anak kecil sudah mula saling berhubung sebelum menetas. Ditunjukkan bahawa bunyi ketuk-ketuk yang lembut berdekatan sarang akan diulangi oleh anak-anak satu demi satu.

Komnikasi awal begini mungkin membantu mereka untuk menetas serentak. Sebaik sahaja keluar dari telur, anak itu membuat bunyi dengking dan dengus dan buaya dewasa yang bukan saudara-mara pun cepat membalas panggilan kecemasan.

[85] Anak buaya yang bersurai kerap berteriak, begitu juga apabila berhimpun semula pada waktu pagi. Dewasa yang berdekatan turut mengeluarkan isyarat tentang kehadiran pemangsa mahupun makanan. Lain spesies lain jumlah bunyinya. Aligator adalah yang paling bising, sementara ada spesies buaya sejati yang senyap sama sekali. Buaya New Guinea dan buaya Siam betina mengaum apabila dihampiri dewasa lain, sementara buaya Nil mendengus atau melenguh dalam situasi serupa.

Aligator Amerika sungguh bising; ia mengeluarkan tujuh lenguhan parau serangkai, setiap satu dua tiga saat sahaja dengan selang 10 saat, di samping juga membuat pelbagai jenis dengusan dan desisan. Jantan membuat getaran dalam air untuk menghantar isyarat infrasonik untuk menarik betina atau menakutkan lawan.

[86] Cembung gharial jantan boleh dijadikan "penggema". [87] Satu lagi bentuk komunikasi berbunyi ialah berdetap. Mula-mula buaya pegun dalam air mengangkat muncung sambil. Selepas beberapa ketika, rahangnya dibuka tutup dengan pantas dengan cakupan yang membuat bunyi detap-detap yang kuat, kemudian disusuli oleh percikan kuat, kemudian kepala direndamkan dan keluar banyak buih.

Kemudian sesetengah spesies mengaum, sementara yang lain menghentak air dengan ekor. Lama-kelamaan seluruh kawanan turut berdetap. Tujuannya berbagai-bagai tetapi rupanya untuk mengeratkan hubungan antara buaya dan juga untuk memikat. Individu yang dominan boleh juga menayangkan saiz badan sambil berenang di permukaan air, kemudian buaya bawahan akan tunduk dengan mendongak pada sudut tirus dengan membuka rahang sebelum menyelam undur.

Tumbesaran dan mortaliti [ sunting - sunting sumber ] Anak buaya katak dalam tawanan Kadar mortaliti tinggi bagi telur dan anak baru menetas, malah sarang digugat oleh banjir, terlebih panas dan pemangsa. Banjir punca utama kegagalan buaya untuk berjaya membiak kerana apabila sarang tenggelam, embrio yang berkembang terputus bekalan oksigen dan anak-anak buaya pun terhanyut. Pelbagai pemangsa, baik mamalia mahupun reptilia, boleh menceroboh sarang dan makan telur buaya.

[88] [89] Sebaik mana pun dijaga oleh ibu, anak buaya yang baru menetas sering jatuh kepada pemangsa. [90] Apabila si ibu mengangkut sedikit anak ke tempat penjagaan, yang lain pula dicekup oleh pemangsa yang menanti berhampiran sarang. Selain daripada pemangsa darat, anak buaya pun terdedah kepada serangan oleh ikan dalam air. Burung pemangsa turut memberi kesan, malah dalam setiap seperinduk adanya individu cacat yang kurang berpeluang untuk hidup.

Di Australia utara, kadar kemandirian anak buaya katak baru menetas hanya 25%, tetapi meningkat saban tahun hinggalah 60% menjelang lima tahun. Kadar mortaliti bagi remaja dan dewasa pula cukup rendah, biarpun kadangkala menjadi mangsa kepada kucing besar dan ular. Jaguar [91] dan memerang gergasi [92] boleh memangsakan caiman di Amerika Selatan.

Di benua lain pula, gajah dan badak air boleh membunuh buaya demi pertahanan. Dipertikaikan juga sama ada buaya makan sesama sendiri. Buaya dewasa biasanya tidak makan anak sendiri, tetapi adanya bukti tentang remaja yang makan anak serta dewasa menyerang remaja. Bagi buaya Nil, jantan lawan kadangkala berbunuhan sewaktu musim membiak.

Tumbesaran buaya muda bergantung pada bekalan makanan, dan kematangan seksual dikaitkan dengan panjang badan daripada umur. Buaya katak betina mencapai kematangan pada 2.2–2.5 m (7–8 ka), dan jantan pula 3 m (10 ka). Buaya air tawar Australia mengambil 10 tahun untuk matang pada 1.4 m (4 ka 7 pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan.

Spectacled caiman matang lebih awal dengan mencapai panjang matangnya iaitu 1.2 m (4 ka) dalam empat hingga tujuh tahun. Buaya terus membesar sepanjang hayat, terutama sekali jantan yang makin tua makin berat, tetapi ini pun lebih kepada lilitan daripada panjang badan.

[93] Buaya boleh hidup 35–75 tahun, dan usianya dapat ditentukan oleh gegelang pertumbuhan pada badan. Peranan ekologi [ sunting - sunting sumber ] Gharial menyamar dengan rumpai terapung Sebagai pemangsa yang cukup efisien, buaya selalunya menduduki kemuncak rantai makanan dalam persekitaran berair. [94] Guar sarang yang dibina oleh sesetengah spesies buaya turut digunakan oleh haiwan lain untuk tujuan sendiri.

Guar aligator Amerika digunakan oleh kura-kura dan ular untuk berjemur dan bertelur. Khususnya kura-kura perut merah Florida yang boleh pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan beberapa biji di dalam sarang aligator di samping telur aligator.

[95] Aligator mengubah suai habitat tanah lembap di kawasan-kawasan rata (misalnya di Everglades selatan benua Amerika Utara) dengan membina kolam-kolam kecil yang dipanggil "lubang buaya" ( alligator holes). Ini mewujudkan habitat yang lebih lembap atau kering untuk organisma lain seperti tumbuhan, ikan, invertebrat, amfibia, reptilia atau mamalia.

Dalam lekukan batu kapur di paya sipres, lubang buaya selalunya besar dan dalam. Yang terdapat di marl prairie dan cerang batuan pula selalunya kecil dan cetek, sementara yang ada di lekukan gambut di tanah lembap berabung berselut pula berbagai-bagai ragamnya.

Lubang buatan manusia tidak kelihatan meninggalkan kesan sebaik lubang buaya. [96] Di lembangan Amazon, apabila buaya caiman menjadi kurang akibat pemburuan berlebihan pada abad ke-20, bilangan ikan tempatan seperti arapaima ( Arapaima gigas) yang penting turut berkurangan. Airnya kurang zat di mana kencing dan tinja caiman dapat meningkatkan pengeluaran primer dengan memberikan zat kepada tumbuhan. Maka kehadiran caiman sewajarnya memanfaatkan populasi ikan; [97] nampaknya jumlah buaya di sesebuah kawasan air berkorelasi dengan populasi ikan setempat.

[98] Evolusi dan pengelasan [ sunting - sunting sumber ] Evolusi [ sunting - sunting sumber ] Ciri-ciri pembeza utama tetrapod diapsid ialah kehadiran dua bukaan ( fenestra temporal) di kedua-dua belah tengkorak di belakang mata. Antara diapsid yang hidup termasuk semua jenis buaya, cicak, biawak, ular dan burung. [99] Ciri-ciri yang membezakan arkosaur daripada diapsid-diapsid yang lain ialah sepasang bukaan tambahan pada tengkorak (fenestra antorbital) di hadapan soket mata.

Archosauria merupakan crown group yang mengandungi leluhur sepunya paling akhir bagi buaya dan burung dan segala keturunannya; terdiri daripada Pseudosuchia atau "buaya palsu", dan Ornithosuchia yang terdiri daripada dinosaur dan saudara-maranya, pterosaur dan burung-burung. [100] Pseudosuchia ditakrifkan sebagai buaya hidup dan semua arkosaur yang bertalian rapat dengan buaya daripada burung.

Pecahan Pseudosuchia–burung difikirkan berlaku menjelang peristiwa kepupusan besar-besaran Perm–Trias. [101] Pada buaya moden, fenestra antorbital disekat di luar dinding dan wujud hanya sebagai sinus.

[102] Anggota badan ini hadir pada kebanyakan leluhur fosil sebagai bukaan kecil. [103] Restorasi makhluk berbentuk buaya purba Protosuchus Makhluk-makhluk Crocodylomorpha (bentuk buaya) merupakan satu-satunya cabang Pseudosuchia yang terselamat daripada peristiwa kepupusan Trias–Jura 201.3 juta tahun dahulu.

Ketika awal usia Jurasik, dinosaur menguasai daratan sementara Crocodylomorpha menjalani proses adaptasi menyeluruh untuk mengisi ceruk-ceruk ekologi yang ditinggalkan oleh makhluk yang baru pupus. Bukti fosil menunjukkan bahawa makhluk bentuk buaya Mesozoik ini lebih pelbagai bentuknya daripada buaya moden. Ada yang menjadi insektivor yang kecil dan bergerak pantas, ada yang menjadi khusus makan ikan, ada lagi yang menjadi karnivor laut mahupun darat, dan sedikit lagi menjadi herbivor.

[104] Tahap terawal evolusi buaya ialah Protosuchia yang berevolusi pada akhir Trias dan awal Jura, diikuti oleh Mesosuchia yang berbagai-bagai ketika usia Jura dan Tertier. Satu lagi kumpulan iaitu Eusuchia muncul pada akhir Usia Kapur 80 juta tahun dahlu dan mencakupi semua buaya yang hidup pada hari ini.

Susunan rangka buaya gergasi Deinosuchus dari akhir Usia Kapur di Amerika Utara Protosuchia merupakan haiwan darat yang rata-rata kecil dengan muncung yang pendek serta kaki yang panjang. Ia mempunyai perisai bertulang dalam bentuk dua jalur plat yang menjangkau hingga kepala dan ekor, dan perisai inilah yang dikekalkan oleh kebanyakan buaya moden.

Vertebranya (ruas tulang belakang) cembung pada dua permukaan besendi utama, dan lelangit bertulangnya kurang berkembang. Mesosuchia menyaksikan lakuran tulang lelangit yang membentuk lelangit bertulang kedua serta lorongan hidung yang lebih panjang hingga menghampiri tulang pterigoid (kepak). Ini membolehkan makhluk itu untuk bernafas melalui liang hidung sementara mulutnya terbuka dalam air Eusuchia meneruskan proses ini dengan liang hidung dalam kini terbuka melalui bukaan dalam tulang pterigoid.

Vertebra Eusuchia mempunyai satu permukaan bersendi yang cekung dan satu yang cembung, membolehkan pergerakan seakan-akan sendi lesung antara vertebra, meningkatkan fleksibiliti dan kekuatan. Eusuchia yang tertua dikenali ialah Hylaeochampsa vectiana dari awal Usia Kapur di Pulau Wight, United Kingdom, [105] disusuli oleh makhluk-makhluk seperti Pristichampsidae (buaya bertelapuk) pada zaman Paleogen. [106] Menjangkau usia Kapur dan Paleogen ialah genus Borealosuchus di Amerika Utara dengan enam spesies, namun kedudukan filogenetiknya tidak tentu.

[107] Ketiga-tiga cabang utama Crocodilia sudah bercapah pada akhir Mesozoik. Ahli-ahli yang terawal dikenali ialah alligatoroid dan gavialoid yang hidup di Amerika Utara dan Eropah pada usia Campagne (kira-kira 83.6–72.1 juta tahun dahulu). Biarpun crocodyloid yang pertama dikenali muncul pada usia Maastricht (kira-kira 72.1–66.0 jtd), namun salasilah itu tentu sudah hadir pada usia Campagne, malah alligatoroid dan gavialoid terawal merangkumi bentuk-bentuk terbitan yang ketara, menunjukkan bahawa masa percapahan sebenar antara ketiga-tiga salasilah mestilah peristiwa sebelum Campagne.

[108] Hubungan [ sunting - sunting sumber ] Borealosuchus wilsoni Hubungan filogenetik sesama buaya dijadikan perbualan hangat dengan hasil bercanggah-canggah. Banyak kajian serta hasilnya dalam kladogram atau "salasilah" buaya, mendapati bahawa keluarga "muncung pendek" Crocodylidae dan Alligatoridae bertalian rapat sementara Gavialidae yang bermuncung panjang jauh bercapah.

Yang terhasil kelompok spesies bermuncung pendek Brevirostres disokong rata-ratanya oleh kajian yang hanya menganalisis ciri-ciri rangka. [109] Pada 2012, Erickson et al. menghasilkan filogeni yang terbentuk daripada penjujukan DNA untuk menjadikan kladogram kebarangkalian maksimum tentang pertalian antara jenis-jenis buaya yang hidup (kecuali yacare caiman yang ketiadaan bukti DNA). Dalam yang ini, kewujudan kumpulan Brevirostres ditolak, dengan gavalid (jejulong) bermuncung panjang lebih rapat pertaliannya dengan buaya jati berbanding aligator.

Crocodilia Alligatoridae Caiman Melanosuchus Paleosuchus Alligator Crocodylidae Crocodylus Mecistops Osteolaemus Gavialidae Gavialis Tomistoma Taksonomi [ sunting - sunting sumber ] Gharial jantan mempunyai muncung panjang runcing dengan cembung di hujung. • Keluarga Gavialidae • Genus Gavialis • Gharial ( Gavialis gangeticus) • Genus Tomistoma • Buaya jejulong ( Tomistoma schlegelii) Gavialidae ada dua spesies ekstan, iaitu gharial dan jolong-jolong ( false gharial).

Gharial dikenali dengan muncung panjang runcing dengan cembung yang ketara di hujung. Jenis ini jarang ditemui dan hanya terdapat di Asia Selatan. Gigi bawah aligator dan caiman, seperti yacare caiman ini, biasanya tidak kelihatan apabila mulut tutup. • Keluarga Alligatoridae • Genus Alligator • Aligator Amerika ( Alligator mississippiensis) • Aligator Cina ( Alligator sinensis) • Genus Paleosuchus • Caiman kerdil Cuvier ( Paleosuchus palpebrosus) • Smooth-fronted caiman ( Paleosuchus trigonatus) • Genus Caiman • Caiman Yacare ( Caiman yacare) • Spectacled caiman ( Caiman crocodilus) • Broad-snouted caiman ( Caiman latirostris) • Genus Melanosuchus • Caiman hitam ( Melanosuchus niger) Alligatoridae yang ekstan merupakan dua spesies dalam genus Alligator, dan enam spesies yang bergelar caiman yang terbahagi kepada tiga genus.

Dikenali dengan muncung yang lebar, di mana gigi keempat rahang bawah tidak kelihatan apabila mulutnya tutup. Gigi bawah keempat buaya sejati, seperti buaya penyamun ini, terdedah apabila mulutnya tutup. • Keluarga Crocodylidae • Genus Crocodylus • Buaya Amerika ( Crocodylus acutus) • Buaya Orinoco ( Crocodylus intermedius) • Buaya air tawar ( Crocodylus johnsoni) • Buaya Filipina ( Crocodylus mindorensis) • Buaya Morelet ( Crocodylus moreletii) • Buaya Nil ( Crocodylus niloticus) • Buaya gurun ( Crocodylus suchus) • Buaya New Guinea ( Pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan novaeguineae) • Buaya penyamun ( Crocodylus palustris) • Buaya katak ( Crocodylus porosus) • Buaya Cuba ( Crocodylus rhombifer) • Buaya Siam ( Crocodylus siamensis) Buaya kerdil Afrika Barat pendek mancungnya.

• • Genus Mecistops • Buaya muncung runcing ( Mecistops [Crocodylus] cataphractus) • Genus Osteolaemus • Buaya kerdil ( Osteolaemus tetraspis) Crocodylidae yang ekstan adalah 12 spesies dan genus Crocodylus dan dua spesies dalam genus lain. Terdapat pelbagai bentuk muncung, tetapi dikenali dengan gigi keempat rahang bawah yang kelihatan apabila mulut ditutup. Hubungan buaya dengan manusia [ sunting - sunting sumber ] Penternakan [ sunting - sunting sumber ] Pemandangan ladang buaya dari atas di negara Kemboja Buaya mula-mula diternak pada awal abad ke-20 tetapi kemudahannya seakan-akan zoo dan punca pendapatan utamanya ialah pelancong.

Pada awal 1960-an, kebolehlaksanaan menternak buaya secara komersial disiasat atas tindak balas terhadap penurunan banyak spesies buaya di dunia. Penternakan melibatkan pembiakbakaan dan pemeliharaan buaya yang ditawan sejak menetas, manakala pengambilbelaan ( ranching) melibatkan pengambilan telur, anak mahupun dewasa dari liar saban tahun. Pihak-pihak yang menternak buaya mesti memenuhi kriteria Convention on International Trade in Endangered Species (CITES) dengan menunjukkan bahawa mereka tidak menjejaskan populasi liar di kawasan berkenaan.

[110] Penternakan buaya bermula disebabkan permintaan terhadap kulitnya sebagai bahan, tetapi kini hampir semua anggota buaya dipergunakan. Kulit rusuk dan perut paling elok, dagingnya dimakan, pundi hempedunya ternilai di Asia Timur, dan ada kalanya kepala buaya dijadikan hiasan. [111] Dalam perubatan Cina tradisional, daging aligator dikatakan merawat selesema serta mencegah barah, sementara pelbagai organ buaya dipercayai bersifat penawar.

[112] Serangan [ sunting - sunting sumber ] Buaya merupakan pemangsa oportunis yang paling berbahaya di dalam air dan tepi air.

Diketahui lapan spesies menyerang manusia atas pelbagai sebab, sama ada untuk melindungi wilayah, sarang dan anak-anak; secara tidak sengaja apabila menyerang haiwan peliharaan seperti anjing; atau untuk makanan, kerana buaya besar-besar dapat mengambil mangsa sebesar manusia atau lebih.

Spesies yang paling banyak datanya dalam hal ini ialah buaya katak, buaya Nil, dan aligator Amerika. Spesies-spesies lain yang kadang-kadang menyerang manusia termasuklah caiman hitam, buaya Morelet, buaya penyamun, buaya Amerika, gharial, dan buaya air tawar.

[113] Papan tand amaran tentang aligator di Florida Buaya Nil digeruni sebagai pembunuh terbesar bagi haiwan besar, termasuk manusia, di benua Afrika. Taburannya luas, terdapat di pelbagai habitat dan berwarna samar-samar. Daripada posisi menunggu dengan hanya mata dan liang hidung yang timbul, ia mampu menerkam haiwan-haiwan yang minum air sungai, nelayan, orang mandi, ataupun orang yang menadah air atau mencuci pakaian.

Sekali dicakup dan diheret ke dalam air, tipislah peluang untuk mangsa melepaskan diri. Analisis serangan menunjukkan bahawa kebanyakan kejadian berlaku pada musim membiak atau ketika buaya menjaga sarang atau anak yang baru menetas. [114] Biarpun banyak kes tidak dilaporkan, dianggarkan terdapat lebih 300 kali setahun, 63% daripadanya adalah maut. Buaya katak liar di Australia melakukan 62 serangan disahkan tanpa diberangsangkan, menyebabkan kecederaan dan maut dari 1971 hingga 2004.

Buaya katak turut telah menyebabkan kematian di Malaysia, New Guinea, dan lain-lain, bahkan di Sarawak terdapat khabar angin mengenai seekor buaya katak gergasi yang makan manusia digelar Bujang Senang. Buaya amat membenci pencerobohan wilayah oleh buaya lain, manusia, perahu mahupun kanu. Buaya yang besar mahupun kecil mampu menyerang, tetapi yang menyebabkan kematian rata-ratanya jantan besar-besar.

Makin besar buaya itu, makin perlunya mengejar mangsa besar, terutamanya babi, lembu, kuda dan manusia. Kebanyakan orang yang diserang oleh buaya adalah berenang atau berendam, tetapi ada dua kali mangsa manusia tidur dalam khemah.

[115] Dicatatkan bahawa aligator Amerika membuat 242 serangan tanpa berangsang dari 1948 hingga 2004, menyebabkan 16 kematian manusia. 10 daripada itu dalam air dan dua lagi di darat; empat lagi itu tidak diketahui keadaannya. Kebanyakan serangan berlaku pada bulan-bulan anas, tetapi di Florida yang panas iklimnya, serangan boleh jadi bila-bila masa.

Aligator dianggap kurang agresif berbanding buaya Nil atau buaya katak, [116] tetapi meningkatnya kepadatan penduduk manusia di Everglades telah mendekatkan manusia dengan aligator dan oleh itu menaikkan risiko serangan aligator.

Sebaliknya di Mauritania, di mana pertumbuhan buaya terbantut oleh keadaan gersang, orang tempatan berenang dengan pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan bersama buaya. Sebagai peliharaan [ sunting - sunting sumber ] Sesetengah spesies buaya diperdagangkan sebagai haiwan peliharaan eksotik.

Comel ketika kecil, dan oleh itu senang dijual oleh penjual, namun buaya tidak sesuai dibela kerana ia tumbuh besar-besar dan menjadi mahal dan berbahaya untuk disimpan. Buaya belaann yang makin tua sering dilepaskan oleh pemilik, maka populasi spectacled caiman yang jalang pun wujud di AS dan Kanada.

Kebanyakan negara mempunyai peraturan ketat untuk membela buaya. [117] Dalam perubatan [ sunting - sunting sumber ] Darah buaya jati dan aligator mengandungi peptida yang ciri-ciri antibiotik.

Ini mungkin menyumbang kepada ubat-ubat antibakteria akan datang. [118] Pemuliharaan [ sunting - sunting sumber ] Beg tangan yang dibuat daripada kulit buaya kerdil Afrika Barat ( Osteolaemus tetraspis) di Natural History Museum, London. Ancaman utama terhadap buaya sedunia ialah kegiatan manusia, termasuklah memburu dan kemusnahan habitat. Pada awal 1970-an, lebih 2 juta kulit buaya liar dari pelbagai spesies telah diperdagangkan, menyebabkan kemerosotan majoriti populasi buaya, ada kalanya hampir pupus.

Mulai 1973, CITES cuba untuk mencegah perdagangan anggota haiwan terancam seperti kulit buaya. Ini terbukti sukar pada 1980-an kerana buaya adalah banyak dan berbahaya kepada manusia di sesetengah kawasan di Afrika, dan oleh itu dihalalkan memburu buaya. Di Sidang Pihak-Pihak di Botswana pada 1983, dihujahkan bagi pihak masyarakat terjejas bahawa menjual kulit buaya yang diburu secara sah adalah munasabah.

Pada akhir 1970-an, buaya mula diternak di pelbagai negara, bermula dengan telur yang diambil dari liar. Menjelang 1980-an, kulit buaya ternak dihasilkan secukupnya untuk mematahkan perdagangan haram buaya liar.

Dekat tahun 2000, hasil kulit dari 12 spesies buaya, sama ada yang diperoleh secara pemburuan sah ataupun ternakan, diperdagangkan oleh 30 buah negara, pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan perdagangan haram hampir lesap. [119] Gharial muda di Hutan Rizab Kukrail Buaya gharial telah mengalami kemerosotan jangka panjang kronik disusuli kejatuhan jangka pendek mendadak, maka IUCN menggolongkan spesies ini sebagai terancam genting.

Pada 1946, populasi gharial meluas dengan kira-kira 5,000 hingga 10,000 ekor; tetapi dekat 2006, jumlahnya susut sebanyak 96–98%, hanya tinggal 235 ekor individu yang berpecah-belah populasinya. Penurunan jangka panjang ini pelbagai sebabnya, termasuklah mencuri telur dan memburu, misalnya untuk perubatan pribumi. Penurunan mendadak sebanyak 58% antara 1997 dan 2006 disebabkan oleh penggunaan pukat hanyut serta pembasmian habitat sungai.

[120] Populasi gharial terus diancam oleh bahaya persekitaran seperti logam berat dan parasit protozoa, [121] tetapi setakat 2013 jumlahnya bertambah disebabkan perlindungan sarang daripada pemangsa telur.

[122] Aligator Cina dahulu meluas di seluruh sistem Sungai Yangtze timur tetapi kini terhad kepada beberapa kawasan di wilayah Anhui tenggara disebabkan fragmentasi dan degradasi habitat.

Populasi liar dipercayai wujud hanya di kolam yang terpencar. Pada 1972, spesies ini diisytiharkan spesies terancam Kelas I oleh kerajaan China dan menerima perlindungan undang-undang maksimum.

Sejak 1979, program pembiakan dalam tawanan ditubuhkan di China dan Amerika Utara, menghasilkan populasi tawanan yang sihat. [123] Pada 2008, aligator yang dibesarkan di Zoo Bronx berjaya diperkenalkan semula ke Pulau Chongming. [124] Buaya Filipina dikatakan buaya yang paling terancam dan dianggap terancam genting oleh IUCN. Pemburuan dan tabiat perikanan memusnah telah mengurangkan populasinya kepada kira-kira 100 ekor pada 2009.

Pada tahun yang sama, 50 buaya tawanan telah dilepaskan ke dalam alam liar untuk menambah populasi. Sokongan orang tempatan penting untuk kelestarian spesies. [125] Aligator Amerika turut terjejas teruk akibat pemburuan dan kemusnahan habitat sehingga hampir pupus. Pada 1967 ia tergolong dalam spesies terancam, tetapi Perkhidmatan Perikanan dan Hidupan Liar AS serta agensi perhilitan setempat di Amerika Syarikat Selatan telah berusaha untuk memulihkan spesies tersebut.

Aligator Amerika berjaya pulih dengan perlindungan, dan pada 1987 ia digugurkan dari senarai spesies terancam. [126] Kebanyakan kajian terhadap pengambilan aligator untuk penternakan telah dijalankan di Rockefeller Wildlife Refuge, sebuah kawasan rawang yang luas di negeri Louisiana. Hasil datanya telah meningkatkan kefahaman mengenai perkandangan, kadar simpanan, pengeraman telur, penetasan, pembelaan dan pemakanan buaya ini, malah maklumat ini digunakan di lain-lain pertubuhan sedunia.

Pendapatan dari aligator yang disimpan di Rockefeller Wildlife Refuge menyumbang kepada pemuliharaan tanah rawang tersebut. [127] Kajian yang mengkaji ladang-ladang aligator di AS menunjukkan bahawa semuanya menjana peningkatan pemuliharaan yang ketara, malah kegiatan pemburuan aligator liar haram banyak merosot.

[128] Gambaran budaya [ sunting - sunting sumber ] Dalam mitos dan budaya rakyat [ sunting - sunting sumber ] Ukiran dewa Mesir Sobek Buaya mendapat peranan penting dalam mitos dan legenda pelbagai budaya serata dunia, malah mungkin telah mengilhami kisah-kisah makhluk naga. [129] Dalam agama Mesir Purba, Ammit si syaitan pelahap roh-roh pendosa, dan Sobek si dewa kuasa, perlindungan dan kesuburan, semuanya digambarkan berkepala buaya.

Ini mencerminkan pandangan masyarakat Mesir purba bahawa buaya ialah pemangsa yang menggerunkan dan juga sebahagian penting dalam ekosistem Sungai Nil.

Buaya adalah antara haiwan-haiwan yang di mumiakan oleh orang Mesir. [130] Buaya juga dikaitkan dengan pelbagai dewa air oleh masyarakat Afrika Barat.

[131] Ketika Empayar Benin, buaya dianggap "mata-mata air" dan melambangkan kuasa raja atau oba untuk menghukum pesalah. [132] Makhluk Leviathan yang dihuraikan dalam Kitab Ayub (Bible) mungkin berasaskan buaya. [133] Di Mesoamerika, suku Aztek mempunyai dewa kesuburan berupa buaya Cipactli yang melindungi tanaman. Dalam mitos Aztek, dewa tanah Tlaltecuhtli kadang-kadang digambarkan sebagai raksasa berupa buaya.

[134] Kaum Maya juga mengaitkan buaya dengan kesuburan dan kematian. [135] Buaya gharial terdapat dalam cerita rakyat India. Dalam satu cerita, sang gharial berkawan dengan seekor monyet apabila si monyet memberinya buah-buahan. Isteri sang gharial menuntut suaminya untuk membawa si monyet pulang untuk dimakan kerana percaya bahawa buah-buahan itu memaniskan jantung si monyet. Sang gharial mula-mula akur dan cuba mengumpan si monyet ke tempat tinggalnya, tetapi akhirnya berterus terang kepada si monyet, maka putuslah persahabatan mereka.

[136] Kisah-kisah seumpamanya pun terdapat dalam legenda pribumi Amerika, apalagi dalam cerita rakyat Afrika-Amerika tentang seekor aligator bersama Br'er Rabbit. [137] Dalam cerita rakyat Melayu, terdapat kisah mengenai sekawan buaya yang diperdaya oleh Sang Kancil. Sang Kancil mahu menyeberangi sungai untuk makan buah-buahan di pokok seberang, tetapi Sang Buaya menunggu di tebing sungai mahu makan Sang Kancil. Maka Sang Kancil meminta semua buaya untuk berbaris merentas sungai supaya ia dapat mengira jumlah mereka bagi pihak raja, malah memohon mereka jangan makan dirinya sambil kiraan dibuat.

Kemudian Sang Kancil memijak-mijak kepala semua buaya sambil membilang hingga habis. Sebaik tiba di seberang, Sang Kancil berterima kasih kepada buaya kerana membantunya menyeberangi sungai lalu makan buah-buahan. Sang Buaya malang sekali kerana buaya-buaya lain marah padanya kerana membiarkan Sang Kancil memperdaya mereka semua.

[138] Adanya kisah dari Timor Leste mengenai seorang budak yang menyelamatkan seekor buaya gergasi yang terkandas. Sebagai balasan, si buaya melindungi si budak sepanjang umur, dan apabila ia mati, belakangnya yang berabung bersisik menjadi bukit-bukau Timor. [139] Ada pula sebuah kisah Pribumi Australia mengenai leluhur buaya yang membolot api untuk dirinya sendiri, hinggalah pada suatu hari, seekor "burung pelangi" mencuri kayu api daripada si buaya untuk diberikan kepada manusia, dan oleh sebab itulah buaya hidup dalam air.

[140] Dalam sastera [ sunting - sunting sumber ] Buaya dalam gambar Rochester Bestiary, akhir abad ke-13 Sejarawan purba telah memerikan makhluk-makhluk buaya dari catatan sejarah yang awal sekali, biarpun huraiannya banyak mengandungi unsur legenda daripada fakta.

Ahli sejarah Yunani Purba Herodotus (c. 440 SM) memerikan buaya secara terperinci, tetapi itu pun kebanyakannya bersifat angan-angan; beliau berhujah bahawa buaya membuka mulutnya untuk membolehkan burung " trochilus" (yang barangkalinya burung kedidi Mesir) untuk masuk dan mencabut semua lintah yang ada.

[141] Buaya adalah antara satwa-satwa yang diperikan dalam Rochester Bestiary akhir abad ke-13, berasaskan sumber-sumber klasik, termasuklah Historia naturalis oleh Plinius (c. 79 M) [142] dan Etimologi oleh Isidore dari Seville. [143] [144] Isidore berhujah bahawa buaya ( crocodilus) dinamakan sempena warna safronnya (Latin croceus, 'safron'), malah berukuran dalam 20 cubit (10 m (33 ka)).

Hujahnya lagi, buaya boleh dibunuh oleh ikan berjambul gerigi yang menusuk perutnya yang lembut, malah jantan dan betina bergilir-gilir menjaga telur. [145] Buaya dikhabarkan meratapi mangsa dalam Bibliotheca abad ke-9 oleh Photios I dari Constantinople. [146] Kisahnya diulangi dalam catatan lanjutan seperti kisah Bartholomeus Anglicus pada abad ke-13.

[147] Kisah air mata buaya menjadi meluas pada 1400 apabila pengembara Inggeris, Sir John Mandeville menulis tentang "cockodrills": [148] "Di negara [Prester John] itu dan seluruh Ind [India] banyaklah cockodrills [buaya] yang berupa ular panjang, seperti yang pernah hamba khabarkan. Pada waktu malam ia menghuni dalam air, dan pada waktu siang pula dalam batuan dan gua. Dan ia tidak makan sebarang daging pada musim sejuk, sebaliknya berbaring seolah-olah bermimpi, sama seperti ular.

Ular-ular [buaya] ini membunuh manusia lalu memakan sambil menangis; dan apabila makan ia menggerakkan rahang atas, dan tiadanya lidah." William Shakespeare menyebut tentang air mata buaya dalam kisah Othello (Babak IV, Adegan 1), Henry VI, Part 2 (Babak III, Adegan 1), dan Antonius dan Cleopatra (Babak II, Adegan 7).

Sang buaya menarik belalai Anak Gajah dalam sebuah kisah Rudyard Kipling dalam himpunan Just So Stories. Ilustrasi oleh Kipling, 1902 Buaya sering muncul dalam cerita kanak-kanak zaman moden. Alice's Adventures in Wonderland karya Lewis Carroll (1865) mengandungi syair How Doth the Little Crocodile, [149] yang menyindir syair moral Isaac Watts, iaitu Against Idleness and Mischief. [150] Dalam novel J. M. Barrie, Peter and Wendy (1911), watak Kapten Hook kehilangan sebelah tangan kepada sang buaya.

Maka Hook takut kepada buaya, tetapi diamarkan tentang kehadiran sang buaya oleh detikan jam yang pernah ditelannya. [151] Dalam Just So Stories oleh Rudyard Kipling (1902), Sang Anak Gajah mendapat belalai apabila hidung pendeknya ditarik kuas-kuat oleh Sang Buaya di tebing Sungai Limpopo yang licin.

Hidung yang baru dipanjangkan itu membolehkan Sang Anak Gajah untuk memetik buah-buahan daripada menunggu buah gugur, dan banyak lagi perkara berguna.

[152] Karya Roald Dahl, The Enormous Crocodile (1978) menceritakan tentang seekor buaya yang berkeliaran di hutan memburu kanak-kanak untuk dimakan dengan mencuba helah demi helah.

[153] Dalam media dan sukan [ sunting - sunting sumber ] Buaya merupakan salah satu haiwan yang dijadikan maskot untuk pasukan sukan. Contohnya maskot buaya yang dijadikan maskot pasukan bola sepak Sarawak FA.

Dalam filem dan TV, buaya digambarkan sebagai halangan berbahaya di tasik dan sungai, seperti filem komedi Australia 1986 "Crocodile" Dundee, [154] mahupun raksasa pemakan manusia dalam filem seram seperti Eaten Alive (1977), Alligator (1980), Lake Placid (1999), Primeval (2007), dan Black Water (2007). [155] Sesetengah media telah cuba untuk memberikan gambaran positif dan berpendidikan terhadap buaya, seperti siri dokumentari Steve Irwin, The Crocodile Hunter.

[156] Buaya yang tampil dalam animasi termasuklah watak Hanna-Barbera Wally Gator, dan Ben Ali Gator dari segmen Dance of the Hours dalam filem Disney 1940, Fantasia. Rujukan [ sunting - sunting sumber ] • pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan "ACD - Austronesian Comparative Dictionary - Cognate Sets - *buqaya".

Dicapai pada 2018-02-14. Cite has empty unknown parameter: -dead-url= ( bantuan) • ^ Liddell, Henry George; Scott, Robert (1901). "An Intermediate Greek-English Lexicon". Tufts University. Dicapai pada 22 October 2013. • ^ Gove, Philip B., penyunting (1986). "Crocodile". Webster's Third New International Dictionary. Encyclopædia Britannica. • ^ Kelly, 2006. p. xiii. • ^ Schwimmer, David R. (2002). "The Size of Deinosuchus". King of the Crocodylians: The Paleobiology of Deinosuchus.

Indiana University Press. m/s. 42–63. ISBN 0-253-34087-X. • ^ Grigg and Gans, pp. 326–327. • ^ Kelly, pp. 70–75. • ^ Grigg and Gans, p. 336. • ^ Kelly, D. A. (2013). "Penile anatomy and hypotheses of erectile function in the American Alligator ( Alligator mississippiensis): muscular eversion and elastic retraction". Anatomical Record. 296 (3): 488–494. doi: 10.1002/ar.22644. • ^ Huchzermeyer, p. 19. • ^ Lang, J. W. (2002). "Crocodilians". Dalam Halliday, T.; Adler, K. (penyunting). The Firefly Encyclopedia of Reptiles and Amphibians.

Firefly Books. m/s. 212–221. ISBN 1-55297-613-0. • ^ Fleishman, L. J.; Howland, H. C.; Howland, M. J.; Rand, A. S., Davenport, M. L. (1988). "Crocodiles don't focus underwater". Journal of Comparative Physiology A. 163 (4): 441–443. doi: 10.1007/BF00604898. PMID 3184006. CS1 maint: multiple names: authors list ( link)CS1 maint: Multiple names: authors list ( link) • ^ Grigg and Gans, p. 335. • ^ Wever, E. G. (1971). "Hearing in the crocodilia". Proceedings of the National Academy of Sciences.

68 (7): 1498–1500. Bibcode: 1971PNAS.68.1498W. doi: 10.1073/pnas.68.7.1498. JSTOR 60727. PMC 389226. PMID 5283940. • ^ Hansen, A (2007). "Olfactory and solitary chemosensory cells: two different chemosensory systems in the nasal cavity of the American alligator, Alligator mississippiensis". BMC Neuroscience. 8: 64. doi: 10.1186/1471-2202-8-64. • ^ Gans, C.; Clark, B. (1976). "Studies on ventilation of Caiman crocodilus (Crocodilia: Reptilia)".

Respir. Physiol. 26: 285–301. doi: 10.1016/0034-5687(76)90001-3. • ^ Putterill, J.F.; Soley, J.T. (2006). "Morphology of the gular valve of the Nile crocodile, Crocodylus niloticus (Laurenti, 1768)".

J. Morphol. 267: 924–939. doi: 10.1002/jmor.10448. • ^ George, I. D.; Holliday, C. M. (2013). "Trigeminal nerve morphology in Alligator mississippiensis and its significance for crocodyliform facial sensation and evolution".

The Anatomical Record. 296 (4): 670–680. doi: 10.1002/ar.22666. PMID 23408584. • ^ Dieter, C. T. (2000). The Ultimate Guide to Crocodilians in Captivity. Crocodile Encounter publishing. m/s. 7. ISBN 978-1-891429-10-1. • ^ Huchzermeyer, p. 13. • ^ Senter, P. (2008). "Voices of the past: a review of Paleozoic and Mesozoic animal sounds". Historical Biology. 20 (4): 255–287.

doi: 10.1080/08912960903033327. • ^ Fish, F. E. (1984). "Kinematics of undulatory swimming in the American alligator" (PDF). Copeia. 1984 (4): 839–843. doi: 10.2307/1445326. Diarkibkan daripada yang asal (PDF) pada 21 Oktober 2013. Unknown parameter -deadurl= ignored ( bantuan) • ^ Mazzotti, pp. 43–46. • ^ Sues, p.

21. • ^ Reilly, S. M.; Elias, J. A. (1998). "Locomotion in Alligator mississippiensis: kinematic effects of speed and posture and their relevance to the sprawling-to-erect paradigm" (PDF). The Journal of Experimental Biology. 201 (18): 2559–2574. PMID 9716509. • ^ Kelly, pp. 81–82. • ^ Renous, S.; Gasc, J.-P.; Bels, V. L.; Wicker, R.

(2002). "Asymmetrical gaits of juvenile Crocodylus johnstoni, galloping Australian crocodiles" (PDF). Journal of Zoology. 256 (3): 311–325. doi: 10.1017/S0952836902000353. • ^ Grigg and Gans, p. 329. • ^ Kelly, p. 69. • ^ Erickson, Gregory M.; Lappin, A. Kristopher; Vliet, Kent A. (2003). "The ontogeny of bite-force performance in American alligator ( Alligator mississippiensis)" (PDF). Journal of Zoology. 260 (3): 317–327. doi: 10.1017/S0952836903003819. • ^ Erickson, G. M.; Gignac, P. M.; Steppan, S.

J.; Lappin, A. K.; Vliet, K. A.; Brueggen, J. A.; Inouye, B. D.; Kledzik, D.; Webb, G. J. W. (2012). Claessens, Leon (penyunting). "Insights into the ecology and evolutionary success of crocodilians revealed through bite-force and tooth-pressure experimentation".

PLoS ONE. 7 (3): e31781. Bibcode: 2012PLoSO.731781E. doi: 10.1371/journal.pone.0031781. PMC 3303775. PMID 22431965. • ^ Grigg and Gans, pp. 227–228. • ^ Grigg, Gordon; Kirshner, David (2015). Biology and Evolution of Crocodylians. CSIRO Publishing. ISBN 9781486300662. • ^ Nuwer, Rachel (13 May 2013). "Solving an alligator mystery may help humans regrow lost teeth". Smithsonian.com. Dicapai pada 4 November 2013. • ^ LeBlanc, A. R. H.; Reisz, R. R. (2013). Viriot, Laurent (penyunting).

"Periodontal ligament, cementum, and alveolar bone in the oldest herbivorous tetrapods, and their evolutionary significance". PLoS ONE. 8 (9): e74697. Bibcode: 2013PLoSO.874697L. doi: 10.1371/journal.pone.0074697. PMC 3762739. PMID 24023957. • ^ Wu, Ping; Wu, Xiaoshan; Jiang, Ting-Xin; Elsey, Ruth M.; Temple, Bradley L.; Divers, Stephen J.; Glenn, Travis C.; Yuan, Kuo; Chen, Min-Huey; Widelitz, Randall B.; Chuon, Cheng-Ming (2013).

"Specialized stem cell niche enables repetitive renewal of alligator teeth" (PDF). Proceedings of the National Academy of Sciences of the United States of America. 110 (22): E2009–E2018.

Bibcode: 2013PNAS.110E2009W. doi: 10.1073/pnas.1213202110. PMC 3670376. PMID 23671090. Diarkibkan daripada yang asal (PDF) pada 2013-11-04. Unknown parameter -deadurl= ignored ( bantuan) • ^ Ebling, F. John G. "Integument: Reptiles". Encyclopædia Britannica. Dicapai pada 25 October 2013. • ^ Huchzermeyer, pp. 7–10. • ^ Scott, C. (2004). Endangered and Threatened Animals of Florida and Their Habitats. University of Texas Press.

m/s. 213. ISBN 978-0-292-70529-6. • ^ Salleh, Anna (25 April 2012). "Antacid armour key to tetrapod survival". ABC Science. Dicapai pada 20 November 2014. • ^ Jackson, K.; Butler, D. G.; Youson, J. H. (1996). "Morphology and ultrastructure of possible integumentary sense organs in the estuarine crocodile ( Crocodylus porosus)" (PDF).

Journal of Morphology. 229 (3): 315–324. doi: 10.1002/(SICI)1097-4687(199609)229:3<315::AID-JMOR6>3.0.CO;2-X. Diarkibkan daripada yang asal (PDF) pada 2013-10-21. Dicapai pada 2018-02-13. • ^ Kelly, p. 85. • ^ Grigg and Gans, pp. 331–332. • ^ Franklin, C. E.; Axelsson, M. (2000). "Physiology: An actively controlled heart valve".

Nature. 406 (6798): 847–848. doi: 10.1038/35022652. PMID 10972278. • ^ Axelsson, M.; Franklin, C. E.; Löfman, Löfman; C. O.; Nilsson, S.; Grigg G. C. (1996). "Dynamic anatomical study of cardiac shunting in crocodiles using high-resolution angioscopy". The Journal of Experimental Biology. 199 (Pt 2): 359–365. PMID 9317958. • ^ Milius, S. (2000). "Toothy valves control crocodile hearts".

Science News. 158 (9): 133. doi: 10.2307/3981407. • ^ Farmer, C. G.; Uriona, T. J.; Olsen, D. B.; Steenblik, M.; Sanders, K. (2008). "The right-to-left shunt of crocodilians serves digestion" (PDF).

Physiological and Biochemical Zoology. 81 (2): 125–137. doi: 10.1086/524150. PMID 18194087. • ^ Kelly, p. 78. • ^ Komiyama, N.

H.; Miyazaki, G.; Tame, J.; Nagai, K. (1995). "Transplanting a unique allosteric effect from crocodile into human haemoglobin". Nature. 373 (6511): 244–246. Bibcode: 1995Natur.373.244K. doi: 10.1038/373244a0. PMID 7816138. • ^ Farmer, C. G.; Sanders, K. (2010). "Unidirectional airflow in the pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan of alligators" (PDF).

Science. 327 (5963): 338–340. Bibcode: 2010Sci.327.338F. doi: 10.1126/science.1180219. PMID 20075253. Diarkibkan daripada yang asal (PDF) pada 2016-06-24. Dicapai pada 2018-02-13. • ^ Schachner, E. R.; Hutchinson, J. R.; Farmer, C. (2013). "Pulmonary anatomy in the Nile crocodile and the evolution of unidirectional airflow in Archosauria". PeerJ. 1: e60. doi: 10.7717/peerj.60. PMC 3628916. PMID 23638399. • ^ Farmer, C. G.; Carrier D. R. (2000). "Pelvic aspiration in the American alligator ( Alligator mississippiensis)".

Journal of Experimental Biology. 203 (11): 1679–1687. PMID 10804158. • ^ Munns, S. L.; Owerkowicz, T.; Andrewartha, S. J.; Frappell, P. B. (2012). "The accessory role of the diaphragmaticus muscle in lung ventilation in the estuarine crocodile Crocodylus porosus".

Journal of Experimental Biology. 215 (5): 845–852. doi: 10.1242/jeb.061952. PMID 22323207. • ^ Uriona, T. J.; Farmer, C. G. (2008). "Recruitment of the diaphragmaticus, ischiopubis and other respiratory muscles to control pitch and roll in the American alligator ( Alligator mississippiensis)".

Journal of Experimental Biology. 211 (7): 1141–1147. doi: 10.1242/jeb.015339. PMID 18344489. • ^ Wright, J. C.; Kirshner, D. S. (1987). "Allometry of lung volume during voluntary submergence in the saltwater crocodile Crocodylus porosus" (PDF). Journal of Experimental Biology. 130 (1): 433–436. • ^ "AquaFacts: Crocodilians".

Vancouver Aquarium. Diarkibkan daripada yang asal pada 1 November 2013. Dicapai pada 30 October 2013. Unknown parameter -deadurl= ignored ( bantuan) • ^ Webb, Grahame; Manolis, Charlie (2009). Green Guide to Crocodiles of Australia (PDF). New Holland. m/s. 45. ISBN 1-74110-848-9. Diarkibkan daripada yang asal (PDF) pada 4 October 2009. Unknown parameter -deadurl= ignored ( bantuan) • ^ Mazzotti, p. 54. • ^ Garnett, S.

T. (1986). "Metabolism and survival of fasting estuarine crocodiles". Journal of Zoology. 208 (4): 493–502. doi: 10.1111/j.1469-7998.1986.tb01518.x. • ^ Mazzotti, pp. 48–51. • ^ Grigg and Gans, p. 330. • ^ Rauhe, M., Frey, E., Pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan, D.

S., and Rossmann, T. (1999) Fossil crocodilians from the Late Miocene Baynunah Formation of the Emirate of Abu Dhabi, United Arab Emirates: osteology and palaeoecology. In: Whybrow, P. J. and Hill, A., eds., Fossil vertebrates of Arabia New Haven.

Yale University Press, pp. 163–185. • ^ Mazzotti, Frank J; Dunson, William A. (1989). "Osmoregulation in Crocodilians". American Zoologist. 29 (3): 903–920. doi: 10.1093/icb/29.3.903. JSTOR 3883493. • ^ Mazzotti, pp. 52–55. • ^ Kelly, p. 68. • ^ Grigg and Gans, pp. 333–334. • ^ Mead, Jim I.; Steadman, David W.; Bedford, Stuart H.; Bell, Christopher J. Bell; Spriggs, Matthew (2002).

"New Extinct Mekosuchine Crocodile from Vanuatu, South Pacific". Copeia. 3: 632–641. doi: 10.1643/0045-8511(2002)002[0632:nemcfv]2.0.co;2. JSTOR 1448145. • ^ "Alligator Habitat - Where Do Alligators Live?". tracker.cci.fsu.edu. Diarkibkan daripada yang asal pada 2017-07-25. Dicapai pada 2015-09-25. • ^ Alcala and Dy-Liacco, pp. 136–139. • ^ Ross, p. 68. • ^ Alcala and Dy-Liacco, p. 141. • ^ Mayell, H. (18 June 2002).

pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan

"Desert-Adapted Crocs Found in Africa". National Geographic.com. Dicapai pada 24 December 2013. • ^ Alcala and Dy-Liacco, pp. 144–146. • ^ Dinets, Vladimir; Britton, Adam; Shirley, Matthew (2013). "Climbing behaviour in extant crocodilians" (PDF). Herpetology Notes. 7: 3–7. • ^ Alcala and Dy-Liacco, pp. 148–152. • ^ Platt, S. G.; Elsey, R. M.; Liu, H.; Rainwater, T.

R.; Nifong, J. C.; Rosenblatt, A. E.; Heithaus, M. R.; Mazzotti, F. J. (2013). "Frugivory and seed dispersal by crocodilians: an overlooked form of saurochory?". Journal of Zoology. 291 (2): 87–99. doi: 10.1111/jzo.12052. • ^ Grigg and Gans, pp. 229–330. • ^ Dinets, V; Brueggen, JC; Brueggen, J.D.

(2013). "Crocodilians use tools for hunting". Ethology, Ecology and Evolution. 27: 74–78. doi: 10.1080/03949370.2013.858276. • ^ Fish, F. E.; Bostic, S. A.; Nicastro, A. J.; Beneski, J. T. (2007). "Death roll of the alligator: mechanics of twist feeding in water" (PDF). Journal of Experimental Biology. 210 (16): 2811–2818. doi: 10.1242/jeb.004267. PMID 17690228. Diarkibkan daripada yang asal (PDF) pada 20 Julai 2011.

Unknown parameter -deadurl= ignored ( bantuan) • ^ Pooley, pp. 88–91. • ^ Lance, S. L.; Tuberville, T. D.; Dueck, L.; Holz-schietinger, C.; Trosclair III, P. L.; Elsey, R. M.; Glenn, T. C. (2009). "Multi-year multiple paternity and mate fidelity in the American alligator, Alligator mississippiensis". Molecular Ecology. 18 (21): 4508–4520. doi: 10.1111/j.1365-294X.2009.04373.x. PMID 19804377. • ^ Kelly, pp. 86–88. • ^ Kelly, pp. 89–90. • ^ Thorbjarnarson, J. B. (1994). "Reproductive ecology of pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan spectacled caiman ( Caiman crocodilus) in the Venezuelan Llanos".

Copeia. 1994 (4): 907–919. doi: 10.2307/1446713. JSTOR 1446713. • ^ Lang, pp. 104–109. • ^ Vliet, K. A. (1989). "Social displays of the American alligator ( Alligator mississippiensis)". American Journal of Zoology. 29 (3): 1019–1031. doi: 10.1093/icb/29.3.1019. • ^ Martin, B. G. H.; Bellairs, A. D'A. (1977). "The narial excresence and pterygoid bulla of the gharial, Gavialis gangeticus (Crocodilia)".

Journal of Zoology. 182 (4): 541–558. doi: 10.1111/j.1469-7998.1977.tb04169.x. • ^ Pooley and Ross, pp. 94–97. • ^ Hunt, R. Howard; Ogden, Jacqueline J.

(1991). "Selected aspects of the nesting ecology of American alligators in the Okefenokee Swamp".

pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan

Journal of Herpetology. 25 (4): 448–453. doi: 10.2307/1564768. JSTOR 1564768. • ^ Kelly, p. 91. • ^ Silveira, R. D.; Ramalho, E. E.; Thorbjarnarson, J. B.; Magnusson, W. E. (2010). "Depredation by jaguars on caimans and importance of reptiles in the diet of jaguar". Journal of Herpetology. 44 (3): 418–424. doi: 10.1670/08-340.1. • ^ Wylie, p. 22. • ^ Huchzermeyer, p.

pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan

31. • ^ Pooley, pp. 76–80. • ^ Alcala and Dy-Liacco, p. 145. • ^ Campell, Mark R.; Mazzotti, Frank J. (2004). "Characterization of natural and artificial alligator holes". Southeastern Naturalist. 3 (4): 583–94. doi: 10.1656/1528-7092(2004)003[0583:CONAAA]2.0.CO;2. • ^ Fittkau, E.-J. (1970). "Role of caimans in the nutrient regime of mouth-lakes of Amazon affluents (an hypothesis)".

Biotropica. 2 (2): 138–142. doi: 10.2307/2989771. JSTOR 2989771. • ^ Alcala and Dy-Liacco, pp. 146–148. • ^ Polly, P. David; Guralnick, Rob P.; Collins, Alan G.; Hutchinson, John R.; Speer, Brian R. (1997). "Those diverse diapsids". University of California Museum of Paleontology. Dicapai pada 24 October 2013. • ^ Hutchinson, John R.; Speer, Brian R.; Wedel, Matt (2007). "Archosauria". University of California Museum of Paleontology. Dicapai pada 24 October 2013. • ^ China fossil shows bird, crocodile family trees split earlier than thought • ^ Witmer, L.

M. (1997). "The evolution of the antorbital cavity of archosaurs: a study in soft-tissue reconstruction in the fossil record with an analysis of the function of pneumaticity" (PDF). Journal of Vertebrate Paleontology. 17 (1 supp): 1–76. doi: 10.1080/02724634.1997.10011027. Diarkibkan daripada yang asal (PDF) pada 11 Ogos 2017. Unknown parameter -deadurl= ignored ( bantuan). • ^ Buffetaut, pp. 26–37. • ^ Stubbs, Thomas L.; Pierce, Stephanie E.; Rayfield, Emily J.; Anderson, Philip S.

L. (2013). "Morphological and biomechanical disparity of crocodile-line archosaurs following the end-Triassic extinction". Proceedings of the Royal Society B.

280 (20131940): 20131940. doi: 10.1098/rspb.2013.1940. • ^ Martin, Jeremy E.; Benton, Michael J. (2008). "Crown Clades in Vertebrate Nomenclature: Correcting the Definition of Crocodylia". Systematic Biology. 57 (1): 173–181. doi: 10.1080/10635150801910469. PMID 18300130. • ^ Brochu, C.A. (2007). "Systematics and phylogenetic relationships of hoofed crocodiles (Pristichampsinae)".

Journal of Vertebrate Paleontology. 27 (3, Suppl.): 53A. doi: 10.1080/02724634.2007.10010458. • ^ Brochu, C.A.; Parris, D.C.; Grandstaff, B.S.; Denton, R.K. Jr.; Gallagher, W.B. (2012). "A new species of Borealosuchus (Crocodyliformes, Eusuchia) from the Late Cretaceous–early Paleogene of New Jersey".

Journal of Vertebrate Paleontology. 32 (1): 105–116. doi: 10.1080/02724634.2012.633585. • ^ Brochu, C.A. (2003). "Phylogenetic approaches toward crocodylian history". Annual Review of Earth and Planetary Sciences.

31: 357–397. Bibcode: 2003AREPS.31.357B. doi: 10.1146/annurev.earth.31.100901.141308. • ^ Holliday, Casey M.; Gardner, Nicholas M. (2012). Farke, Andrew A (penyunting). "A new eusuchian crocodyliform with novel cranial integument and its significance for the origin and evolution of Crocodylia". PLoS ONE. 7 (1): e30471. Bibcode: 2012PLoSO.730471H. doi: 10.1371/journal.pone.0030471.

PMC 3269432. PMID 22303441. • ^ "Crocodiles and Alligator Farms". Americana Alligator. Dicapai pada 7 November 2013.

pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan

• ^ Lyman, Rick (30 November 1998). "Anahuac Journal; Alligator Farmer Feeds Demand for All the Parts". The New York Times. Dicapai pada 13 November 2013. • ^ Stromberg, Joseph; Zielinski, Sarah (19 October 2011). "Ten Threatened and Endangered Species Used in Traditional Medicine: Chinese Alligator". Smithsonian. Dicapai pada 7 November 2013. • ^ "Crocodilian Attacks". IUCN Crocodile Specialist Group. Dicapai pada 3 February 2013. • ^ Pooley, Hines and Shield, pp. 174–177. • ^ Caldicott, David G.

E.; Croser, David; Manolis, Charlie; Webb, Grahame; Britton, Adam (2005). "Crocodile attack in Australia: an analysis of its incidence and review of the pathology and management of crocodilian attacks in general". Wilderness and Environmental Medicine. 16 (3): 143–159. doi: 10.1580/1080-6032(2005)16[143:CAIAAA]2.0.CO;2. PMID 16209470. • ^ Kelly, pp. 61–62. • ^ Kelly, pp. 108–111. • ^ Avasthi, Amitabh (7 April 2008). "Alligator Blood May Lead to Powerful New Antibiotics". National Geographic. Dicapai pada 20 November 2014.

• ^ Adams, William M. (2004). Against Extinction: The Story of Conservation. Earthscan. m/s. 197–201. ISBN 1-84407-056-5. • ^ Choudhury, B. C.; Singh, L. A. K.; Rao, R. J.; Basu, D.; Sharma, R. K.; Hussain, S. A.; Andrews, H. V.; Whitaker, N.; Whitaker, R.; Lenin, J.; dll. (2007). " Gavialis gangeticus". The IUCN Red List of Threatened Species. IUCN. 2007: e.T8966A12939997. doi: 10.2305/IUCN.UK.2007.RLTS.T8966A12939997.en. Dicapai pada 16 January 2018. • ^ Whitaker, R.; Basu, D.; Huchzermeyer, F.

(2008). "Update on gharial mass mortality in National Chambal Sanctuary" (PDF). Crocodile Specialist Group Newsletter. 27 (1): 4–8. • ^ Shukla, Neha (10 June 2013). "Ghariyal population rising in Chambal". Times of India. Diarkibkan daripada yang asal pada 2014-02-07. Dicapai pada 7 February 2014. • ^ Hong Xing, Jiang. "Chinese Alligator Alligator sinensis" (PDF).

International Union for Conservation of Nature. Dicapai pada 29 November 2013. • ^ Sautner, Stephen; Delaney, John (18 July 2009). "Critically Endangered Alligators, Born and Raised at WCS's Bronx Zoo, Now Multiplying in China's Wild". Wildlife Conservation Society.

Dicapai pada 29 November 2013. • ^ van Weerd, Merlijn (22 Disember 2009). "Local pride offers a boost to endangered crocodile".

IUCN news. Diarkibkan daripada yang asal pada 3 Disember 2013. Dicapai pada 29 November 2013. Unknown parameter -deadurl= ignored ( bantuan) • ^ "American Alligator Alligator mississippiensis" (PDF). United States Fish and Wildlife Service. 1 February 2008. Dicapai pada 3 September 2012. • ^ "Rockefeller Wildlife Refuge". Louisiana Department of Wildlife and Fisheries.

Dicapai pada 7 November 2013. • ^ Moyle, Brendan (2013). "Conservation that's more than skin-deep: alligator farming". Biodiversity and Conservation. 22 (8): 1663–1677. doi: 10.1007/s10531-013-0501-9. • ^ Kelly, p. 41. • ^ Kelly, pp. 49–50. • ^ Wylie, p. 51. • ^ "Benin: an African kingdom" (PDF). British Museum. Dicapai pada 2016-03-29. • ^ Wylie, p. 28. • ^ "Tlaltecuhtli Plaque vs. The Stone of Tizoc". Fordham University. Dicapai pada 19 October 2016.

Many scholars refer to Tlaltecuhtli in two major depictions, one in her anthropomorphic representation as seen in the Tlaltecuhtli Plaque and the other "a spiny monster with an extended snout (cipactli), based essentially on the crocodile". citing Nicholson, H. B.; Quiñones Keber, Eloise (1983). Art of Aztec Mexico: Treasures of Tenochtitlan. Washington: National Gallery of Art. • ^ Kelly, pp. 58–59. • ^ Kelly, pp. 45–46. • ^ Kelly, p. 62. • ^ Chok, Yoon Foo; Traditional (2008).

"Outwitting a Crocodile: A Traditional Malaysian Folktale". Topics Magazine. Diarkibkan daripada yang asal pada 2017-06-30. Dicapai pada 17 October 2013. • ^ Torchia, Christopher (2007). Indonesian Idioms and Expressions: Colloquial Indonesian at Work. Tuttle Publishing. m/s. 17. • ^ Wylie, pp. 120–121. • ^ Herodotus. Histories (ed. Book II, chapter 68). • ^ Pliny the Elder. "8". Natural History. m/s. 37–38. • ^ Isidore of Seville.

"12.6". Etymologies. m/s. 19–20. • ^ McCulloch, Florence (1960). Mediaeval Latin and French Bestiaries. Chapel Hill: University of North Carolina Press. m/s. 22, 28–29. • ^ Barney, Stephen A.; Lewis, W. J.; Beach, J. A.; Berghof, Oliver (2006). The Etymologies of Isidore of Seville. Cambridge University Press. m/s. 260 (XII.vi.19 in original Latin). ISBN 978-0-521-83749-1. • ^ Photius (1977). Bibliothèque. Tome VIII : Codices 257–280 (dalam bahasa French dan Ancient Greek).

Texte établi et traduit par R. Henry. Paris: Les Belles Lettres. m/s. 93. ISBN 978-2-251-32227-8. CS1 maint: unrecognized language ( link) • ^ Anglicus, Bartholomaeus. "Book 18". De proprietatibus rerum.

• ^ Mandeville, John (1400). "31. Of the Devil's Head in the Valley Perilous. And of the Customs of Folk in diverse Isles that be about in the Lordship of Prester John". The Travels of Sir John Mandeville. • ^ Carroll, Lewis (1865). "2". Alice's Adventures in Wonderland.

Macmillan. • ^ Dentith, Simon (2002). Parody. Routledge. m/s. 7. ISBN 978-0-203-45133-5. • ^ Barrie, J. M. (1911). Peter and Wendy. Hodder and Stoughton (UK); Charles Scribner's Sons (USA). m/s. 87–91. • ^ Kipling, Rudyard (1962) [1902]. Just So Stories. Macmillan. m/s. 45–56. • ^ Dahl, Roald (1978). The Enormous Crocodile. Jonathan Cape.

• ^ Darnton, Nina (26 September 1986). "Film: 'Crocodile Dundee '". The New York Times. Dicapai pada 11 November 2013. • ^ Wylie p. 183. • ^ Kelly. p. 228. Bibliografi [ sunting - sunting sumber ] • Grigg, Gordon; Gans, Carl (1993).

"Morphology and physiology of the Crocodylia". Dalam Glasby, Christopher J.; Ross, Graham J. B.; Beesley, Pamela L. (penyunting). Fauna of Australia. Volume 2A, Amphibia and Reptilia (PDF). Australian Government Publishing Service. m/s. 326–343. ISBN 978-0-644-32429-8. • Huchzermeyer, F. W. (2003). Crocodiles: Biology, Husbandry and Diseases. CABI. ISBN 978-0-85199-656-1. • Kelly, Lynne (2007). Crocodile: Evolution's greatest survivor. Orion. ISBN 978-1-74114-498-7.

• Ross, Charles A., penyunting (1992). Crocodiles and Alligators. Blitz. ISBN 978-1-85391-092-0. --- Sues, Hans-Dieter. "The Place of Crocodilians in the Living World". pp. 14–25. --- Buffetaut, Eric. "Evolution". pp. 26–41. --- Mazzotti, Frank J. "Structure and Function". pp. 42–57. --- Ross, Charles A.; Magnusson, William Ernest. "Living Crocodilians".

pp. 58–73. --- Pooley, A. C. "Food and Feeding Habits". pp. 76–91. --- Pooley, A. C.; Ross, Charles A. "Mortality and Predators". pp. 92–101. --- Lang, Jeffrey W. "Social Behaviour". pp. 102–117. --- Magnusson, William Ernest; Vliet, Kent A.; Pooley, A.

C.; Whitaker, Romulus. "Reproduction". pp. 118–135. --- Alcala, Angel C.; Dy-Liacco, Maria Teresa S. "Habitats". pp. 136–153. --- Pooley, A. C.; Hines, Tommy C.; Shield, John. "Attacks on Humans. pp. 172–187. pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan Wylie, Dan (2013). Crocodile. Reaktion Books. ISBN 978-1-78023-087-0. Pautan luar [ sunting - sunting sumber ] Wikimedia Commons mempunyai media berkaitan Buaya • Florida's Museum of Natural History: Crocodilians • Crocodylians (foto dengan maklumat), Flickr • Alemannisch • العربية • Aragonés • Արեւմտահայերէն • Asturianu • Azərbaycanca • Bahasa Indonesia • Bân-lâm-gú • Беларуская • Беларуская (тарашкевіца) • Bosanski • Brezhoneg • Български • Català • Cebuano • Чӑвашла • Čeština • Dansk • Deutsch • Diné bizaad • Eesti • English • Español • Esperanto • Euskara • فارسی • Føroyskt • Français • Gagana Samoa • Galego • ГӀалгӀай • 贛語 • 한국어 • Hausa • Հայերեն • हिन्दी • Hrvatski • Interlingua • ᐃᓄᒃᑎᑐᑦ/inuktitut • Ирон • Íslenska • Italiano • עברית • Kabɩyɛ • ქართული • Қазақша • Кыргызча • Кырык мары • Kiswahili • Latina • Latviešu • Лезги • Lietuvių • Limburgs • Lingála • Lingua Franca Nova • Magyar • Македонски • മലയാളം • مصرى • Mìng-dĕ̤ng-ngṳ̄ • Nederlands • 日本語 • Нохчийн • Nordfriisk • Norsk bokmål • Norsk nynorsk • Occitan • Oʻzbekcha/ўзбекча • پنجابی • Polski • Português • Română • Runa Simi • Русский • Scots • Simple English • Slovenčina • Slovenščina • Српски / srpski • Srpskohrvatski / српскохрватски • Sunda • Suomi • Svenska • Tagalog • Taqbaylit • ไทย • Tiếng Việt • Tok Pisin • Türkçe • Українська • West-Vlams • Winaray • 吴语 • 粵語 • 中文 Sunting pautan • Laman ini kali terakhir disunting pada 07:38, 24 Disember 2021.

• Teks disediakan dengan Lesen Creative Commons Pengiktirafan/Perkongsian Serupa; terma tambahan mungkin digunakan. Lihat Terma Penggunaan untuk butiran lanjut.

• Dasar privasi • Perihal Wikipedia • Penafian • Paparan mudah alih • Pembangun • Statistik • Kenyataan kuki • • SlideShare uses cookies to improve functionality and performance, and to provide you with relevant advertising. If you continue browsing the site, you agree to the use of cookies on this website. See our User Agreement and Privacy Policy.

SlideShare uses cookies to improve functionality and performance, and to provide you with relevant advertising. If you continue browsing the site, you agree to the use of cookies on this website. See our Privacy Policy and User Agreement for details. Top clipped slide • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • • IPA SMP Kelas 7 Semester 2 • 1.

IlmuPengetahuanAlam•KelasVIISMP/MTs•Semester2 SMP/MTs KELAS VIISEMESTER 2 ISBN: 978-602-427-000-1 (jilid lengkap) 978-602-427-002-5 (jilid 1b) IlmuPengetahuanAlam HET ZONA 1 ZONA 2 ZONA 3 ZONA 4 ZONA 5 Rp13.500 Rp14.100 Rp14.700 Rp15.800 Rp20.300 Buku Mata Pelajaran IPA ini disusun untuk membantu siswa dalam mempelajari dan memahami konsep IPA sesuai kompetensi dasar yang diharapkan dalam kurikulum 2013.

Buku ini terdiri dari 9 Bab yang disusun secara runtut mengikuti struktur kompetensi dasar dan dibagi dalam 4 tema besar yaitu: Materi (Bab 1, 2, dan 3), Sistem (Bab 4) Perubahan (Bab 5, 6, 7, pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan 8) dan Interaksi (Bab 9).

Pembagian tema ini dimaksudkan agar siswa dapat dengan mudah memahami dan mengaitkan konsep-konsep yang terdapat pada masing-masing bab. Pembahasan pada setiap babnya dalam buku ini, selalu diawali dengan proses dan aktivitas yang harus dikerjakan siswa (IPA sebagai inkuiri) baik dalam bentuk pertanyaan kasus, kegiatan pengamatan, atau percobaan sederhana.

Hal ini diharapkan dapat memupuk keingintahuan siswa tentang topik yang akan dibahas. Kemudian, pembahasan dilanjutkan dengan penjelasan singkat topik tersebut yang disertai ilustrasi dan penerapannya dalam kehidupan serta review dan berpikir kritis.

Dengan model pengorganisasian seperti ini, diharapkan siswa mendapatkan kemudahan untuk melatih kompetensinya terkait dengan mata pelajaran IPA. Menjelang akhir bab diberikan renungan untuk penguatan kecerdasan emosional dan afektif serta menyadari hakikat diri sebagai makhluk Tuhan.

Akhir bab berupa pertanyaan dan tugas, mulai dari sekedar mengingat konsep, kemudian penerapan konsep, berpikir tingkat tinggi, dan tugas proyek. Dengan cara ini, diharapkan pada diri peserta didik tumbuh kompetensi pada ranah kognitif, pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan, dan psikomotorik sesuai dengan yang diharapkan dalam pembelajaran IPA.

IlmuPengetahuanAlam KEMENTERIAN PENDIDIKAN DAN KEBUDAYAAN REPUBLIK INDONESIA 2017 • 2. Hak Cipta © 2017 pada Kementerian Pendidikan dan Kebudayaan Dilindungi Undang-Undang Disklaimer: Buku ini merupakan buku siswa yang dipersiapkan Pemerintah dalam rangka implementasi Kurikulum 2013. Buku siswa ini disusun dan ditelaah oleh berbagai pihak di bawah koordinasi Kementerian Pendidikan dan Kebudayaan, dan dipergunakan dalam tahap awal penerapan Kurikulum 2013.

Buku ini merupakan “dokumen hidup” yang senantiasa diperbaiki, diperbaharui, dan dimutakhirkan sesuai dengan dinamika kebutuhan dan perubahan zaman. Masukan pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan berbagai kalangan yang dialamatkan kepada penulis dan laman http://buku.kemdikbud.go.id atau melalui email buku@kemdikbud.go.id diharapkan dapat meningkatkan kualitas buku ini.

Katalog Dalam Terbitan (KDT) Indonesia. Kementerian Pendidikan dan Kebudayaan. Ilmu Pengetahuan Alam/ Kementerian Pendidikan dan Kebudayaan.--. Edisi Revisi Jakarta: Kementerian Pendidikan dan Kebudayaan, 2017. vi, 186 hlm. : ilus. ; 25 cm. Untuk SMP/MTs Kelas VII Semester 2 ISBN 978-602-427-000-1 (jilid Lengkap) ISBN 978-602-427-002-5 (jilid 1b) 1. Sains — Studi dan Pengajaran I.

Judul II. Kementerian Pendidikan dan Kebudayaan 507 Penulis : Wahono Widodo, Fida Rachmadiarti, dan Siti Nurul Hidayati. Penelaah : Herawati Susilo, Maria Paristiowati, I Made Padri, Dadan Rosana, Ahmad Mudzakir, dan Ana Ratna Wulan. Penyelia Penerbitan : Pusat Kurikulum dan Perbukuan, Balitbang, Kemendikbud. Cetakan Ke-1, 2013 ISBN 978-602-1530-63-4 (jilid 1/1a) Cetakan Ke-2, 2014 (Edisi Revisi) ISBN 978-602-282-316-2 (jilid 1b) Cetakan Ke-3, 2016 (Edisi Revisi) Cetakan Ke-4, 2017 (Edisi Revisi) Disusun dengan huruf Myriad Pro, 11 pt.

ISBN 978-602-427-002-5 (jilid 1b) • 3. iiiIlmu Pengetahuan Alam Kurikulum 2013 dirancang untuk memperkuat kompetensi siswa dari sisi pengetahuan, keterampilan dan sikap secara utuh. Proses pencapaiannya melalui pembelajaran sejumlah mata pelajaran yang dirangkai sebagai suatu kesatuan yang saling mendukung pencapaian kompetensi tersebut. Bila pada jenjang SD/ MI, semua mata pelajaran digabung menjadi satu dan disajikan dalam bentuk tema-tema, maka pada jenjang SMP/MTs pembelajaran sudah mulai dipisah- pisah menjadi mata pelajaran.

Sebagai transisi menuju ke pendidikan menengah, pemisahan ini masih belum dilakukan sepenuhnya bagi siswa SMP/MTs. Materi- materi dari bidang-bidang ilmu Fisika, Kimia, Biologi, dan Ilmu Bumi dan Antariksa masih perlu disajikan sebagai suatu kesatuan dalam mata pelajaran IPA (Ilmu Pengetahuan Alam). Hal ini dimaksudkan untuk memberikan wawasan yang utuh bagi siswa SMP/MTs tentang prinsip-prinsip dasar yang pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan alam semesta beserta segenap isinya.

Buku IPA Kelas VII SMP/MTs ini disusun dengan pemikiran di atas. Bidang ilmu Biologi dipakai sebagai landasan pembahasan bidang ilmu yang lain. Makhluk hidup digunakan sebagai objek untuk menjelaskan prinsip-prinsip dasar yang mengatur alam seperti objek alam dan interaksinya, energi dan keseimbangannya, dan lain-lain.

Melalui pembahasan menggunakan bermacam bidang ilmu dalam rumpun ilmu pengetahuan alam, pemahaman utuh tentang alam yang dihuninya beserta benda-benda alam yang dijumpai di sekitarnya dapat dikuasai oleh peserta didik SMP/MTs. Sesuai dengan konsep Kurikulum 2013, buku ini disusun mengacu pada pembelajaran IPA secara terpadu dan utuh, sehingga setiap pengetahuan yang diajarkan, pembelajarannya harus dilanjutkan sampai membuat siswa terampil dalam menyajikan pengetahuan yang dikuasainya, dan bersikap sebagai makhluk yang mensyukuri anugerah alam semesta yang dikaruniakan kepadanya melalui pemanfaatan yang bertanggung jawab.

Buku ini menjabarkan usaha minimal yang harus dilakukan siswa untuk mencapai kompetensi yang diharapkan. Sesuai dengan pendekatan yang dipergunakan dalam Kurikulum 2013, siswa diberanikan untuk mencari dari sumber belajar lain yang tersedia dan terbentang luas di sekitarnya. Peran guru sangat penting untuk membimbing dan memfasilitasi siswa untuk belajar IPA, KATA PENGANTAR • 4. iv Kelas VII SMP/MTs Semester 2 termasukmeningkatkandanmenyesuaikandayaserapsiswadenganketersediaan kegiatan pada buku ini.

Guru dapat memperkayanya dengan kreasi dalam bentuk kegiatan-kegiatan lain yang sesuai dan relevan yang bersumber dari lingkungan sosial dan alam. Bukuinimerupakanedisirevisi.Revisiterutamadilakukanuntukmenyesuaikan isibukudenganKompetensiDasarkelasVIImatapelajaranIPASMP/MTssertadalam semangat penyempurnaan Kurikulum 2013.

Tim penulis dibantu tim telah berupaya sebaik-baiknya dalam menyusun buku ini. Namun demikian, buku ini sangat terbuka dan terus dilakukan perbaikan dan penyempurnaan di masa mendatang. Untuk itu, kami mengundang para pembaca memberikan kritik, saran dan masukan untuk perbaikan dan penyempurnaan pada edisi berikutnya.

Atas kontribusi tersebut, kami ucapkan terima kasih. Mudah-mudahan kita dapat memberikan yang terbaik bagi kemajuan dunia pendidikan dalam rangka mempersiapkan generasi seratus tahun Indonesia Merdeka (2045). Jakarta, Januari 2016 Penulis • 5.

vIlmu Pengetahuan Alam Kata Pengantar. iii Daftar Isi.v Bab 1 Sistem Organisasi Kehidupan.1 A. Sel sebagai Unit Struktural dan Fungsional Kehidupan.4 B.

Jaringan-Jaringan pada .12 C. Organ-Organ pada Hewan dan Tumbuhan.14 D. Sistem Organ dan Organisme.18 Bab 2 Interaksi Makhluk Hidup dengan Lingkungan.28 A.

Pengertian Lingkungan.29 B. Hal-hal yang Ditemukan dalam Suatu Lingkungan.31 C. Interaksi dalam Ekosistem Membentuk Suatu Pola.33 D. Pola Interaksi Manusia Memengaruhi Ekosistem .41 Bab 3 Pencemaran Lingkungan.47 A. Definisi Pencemaran.49 B. Pencemaran Air.51 C. Pencemaran Udara.59 D. Pencemaran Tanah.62 Bab 4 Pemanasan Global.68 A. Efek Rumah Kaca.72 B. Pengertian Pemanasan Global.74 C.

Penyebab Pemanasan Global.75 D. Dampak Pemanasan Global.76 E. Usaha-usaha Menanggulangi Pemanasan Global.78 Daftar Isi • 6. vi Kelas VII SMP/MTs Semester 2 Bab 5 Lapisan Bumi.83 A. Atmosfer.86 B. Litosfer.98 C. Hidrosfer.131 Bab 6 Tata Surya.146 A.

Sistem Tata Surya.150 B. Kondisi Bumi.155 C. Kondisi Bulan.159 D. Gerhana.162 Glosarium. 169 Indeks. 173 Daftar Pustaka. 174 Profil Penulis . 178 Profil Penelaah . 181 Profil Editor . 185 • 7. Sistem Organisasi Kehidupan Makhluk Hidup Istilah-istilah Penting Hierarki Biologi, Sel, Jaringan, Organ, Sistem Organ, Organisme Sumber: Bab 1 Tumbuhan tingkat tinggi Organisme Molekul Organ Sel Jaringan Sistem organ • 8.

2 Kelas VII SMP/MTs Semester 2 Apakah di kelasmu ada struktur organisasi kelas? Apakah kamu terlibat dalam organisasi tersebut? Ternyata jika diperhatikan, kamu merupakan bagian dari kelas. Kelas kamu juga merupakan bagian dari kelas VII. Kelas VII merupakan bagian dari SMP/MTs. Jika ditelusuri lebih jauh, ternyata sekolah kamu adalah bagian dari sekolah-sekolah yang ada di kecamatan dan seterusnya.

Artinya, kamu sebagai peserta didik merupakan unit terkecil dari organisasi sekolah di kecamatan. Setelah memahami bacaan di atas, coba perhatikan tubuhmu. Apakah tubuhmu memiliki unit-unit penyusun? Untuk memahami hal tersebut, pada bab ini kamu akan mempelajari unit-unit penyusun tubuhmu.

Kamu akan mempelajari mulai dari unit terkecil sampai membentuk tubuhmu dan alam di sekitarmu. Langkah awal untuk mempelajari hal ini, coba lakukan kegiatan berikut. Kegiatan 1.1 Mengamati Bagian Tubuh Katak Apa yang diperlukan dalam pengamatan ini?

1. Katak ( sp), kloroform, dan alkohol 70% atau formalin 4%. 2. Baki bedah untuk tempat membedah katak. 3. Pisau bedah dan gunting untuk membedah katak. 4. Jarum pentul untuk menusuk tangan dan kaki katak. 5. Pinset atau penjepit untuk membantu pem- bedahan, yakni menjepit organ-organ bagian dalam katak. Bagaimana cara melakukan pengamatan ini?

Perhatikan bagaimana gurumu melakukan pembedahan katak Sumber: Dok. Kemdikbud Gambar: 1.1 Pola pembedahan katak Ayo Kita Lakukan • 9. 3Ilmu Pengetahuan Alam 1. Mula-mula katak dimasukkan ke dalam stoples, kemudian kapas yang dibasahi dengan klorofom dimasukkan juga ke dalam stoples.

Tutuplah stoples tersebut, tunggu hingga katak pingsan. Peringatan: 2. Letakkan katak pada baki bedah, kemudian rentangkan tangan dan kakinya. Setelah itu, tusuklah dengan jarum pentul agar posisi katak tidak berubah dan lebih mudah untuk dibedah (lihat Gambar 1.1). 3. Sayatlah bagian perut katak dengan gunting dan pisau bedah (lihat Gambar 1.1). Peringatan: 4. Lakukan pengamatan pada bagian dalam katak tersebut. Organ apa saja yang terdapat di dalam tubuh katak tersebut?

5. Tuliskan hasil pengamatanmu. Perlu diingat bahwa hanya hasil pengamatan bukan perkiraan terhadap hasil pengamatan. Berdasarkan kegiatan yang telah dilakukan, kamu dapat mengamati struktur bagian dalam katak, seperti paru-paru, jantung, usus, dan lain-lain.

Ternyata, jika ditelusuri bagian-bagian tersebut tersusun atas unit-unit terkecil lagi. Dengan demikian, urutan-urutan unit-unit ini akan membentuk suatu tingkatan atau hierarki struktur.

Hierarki struktur ini dinamakan hierarki biologi yang membentuk suatu organisasi kehidupan. Gambar 1.2 menunjukkan struktur hierarki organisasi kehidupan yang dimulai dari atom-atom penyusun molekul yang berukuran mikro hingga ekosistem yang berukuran makro dan sangat kompleks. Hierarki seperti ini dinamakan • 10. 4 Kelas VII SMP/MTs Semester 2 Sumber: http://op.wikispaces.com Gambar 1.2.

Organisasi kehidupan A. Sel sebagai Unit Struktural dan Fungsional Kehidupan Pada hierarki organisasi kehidupan, sel berada di tingkatan struktural terendah yang masih mampu menjalankan semua fungsi kehidupan. Sel mampu melakukan regulasi terhadap dirinya sendiri, memproses energi, tumbuh dan berkembang, tanggap terhadap lingkungan, serta melakukan reproduksi untuk melestarikan jenisnya.

Setiap organisme tersusun atas salah satu dari dua jenis sel yang secara struktural berbeda. Kedua jenis sel tersebut adalah sel prokariotik dan sel eukariotik. Pada sistem lima kingdom, hanya monera (bakteri dan ganggang biru) yang memiliki sel prokariotik.

Protista, jamur, tumbuhan, dan hewan semuanya terdiri atas sel eukariotik. Sel prokariotik berasal dari bahasa Yunani, yaituberarti “sebelum” dan berarti nukleus. Sel prokariotik memiliki nukleus/inti sel, tetapi inti sel tersebut tidak diselubungi membran inti.

Sel eukariotik (bahasa Yunani, berarti “sejati/ sebenarnya”) merupakan sel yang memiliki inti sel dan inti sel tersebut dibungkus oleh membran inti. Ayo Kita Pelajari • Struktur dan fungsi sel Mengapa Penting? • Untuk mendeskripsikan struktur dan fungsi sel Ekosistem • 11.

pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan

5Ilmu Pengetahuan Alam Sel prokariotik terdapat pada bakteri, termasuk sianobakteri. Sel Prokariota strukturnya lebih sederhana daripada struktur sel eukariota, karena tidak mempunyai organel yang terbungkus membran.

Batas sel ialah membran plasma. Di luar membran plasma terdapat dinding sel yang cukup kaku dan seringkali berupa kapsul luar yang biasanya mirip jeli. Sebagian bakteri memiliki flagela (organel pergerakan), pili (struktur pelekatan), atau keduanya yang menonjol dari permukaan selnya.

Nukleoid (DNA) tidak dibungkus membran Pili (b) Ribosom Membran Plasma Dinding Sel Kapsu l Flagela (a) Sumber: Campbell. 2002 Biologi Gambar 1.3 Struktur sel prokariotik(a), (b) (dilihat dengan menggunakan mikroskop elektron) Sel-sel tersebut akan menyusun tubuh makhluk hidup melalui peng- organisasian yang sistematis. Dalam organisasi tubuh, sel memiliki peranan yang sangat penting. Kamu tidak dapat mengamati sel secara jelas pada tanaman atau hewan hanya dengan mata telanjang.

Kamu membutuhkan alat bantu berupa mikroskop. Bagaimana mikroskop dapat digunakan untuk mengamati bagian-bagian sel sehingga tampak jelas? Coba lakukan pengamatan berikut ini. Kegiatan 1.2 Mengamati Sel Tumbuhan dengan Mikroskop Apa yang diperlukan dalam pengamatan ini? 1. Daun tanamanada yang menyebut Adam Hawa, daun sosongkokan, atau nanas kerang seperti Gambar 1.4.

Ayo Kita Lakukan Kapsul Pili Dinding Sel Nukleoid (DNA) tidak dibungkus membran Flagea Membran Plasma Ribosom 0,5 • 12. 6 Kelas VII SMP/MTs Semester 2 2. Mikroskoplengkapdengangelasobjek( )dankacapenutup 3.

Silet 4. Pinset/jarum 5. Cawan petri 6. Pipet tetes 7. Sedikit air Bagaimana cara pengamatan ini? 1. Mula-mula, buat sayatan melintang daun Adam Hawa dengan arah menuju ke sum- bu tubuh. 2. Letakkan sayatan tersebut pada gelas objek. Kemudian, tetesi dengan air. Tu- tuplah secara perlahan, jangan sampai terbentuk gelembung udara.

3. Amati preparat tersebut dengan perbesar- an lemah. Kemudian, amati dengan perbe- saran kuat. 4. Amati bagian-bagian yang tampak. Gambarlah di buku tugasmu.

5. Tuliskan hasil pengamatanmu. Perlu diingat bahwa, hanya hasil pengamatan, bukan tafsiran terhadap hasil pengamatan. Simpulkan Dari pengamatan yang kamu lakukan, buatlah kesimpulan tentang sel. Sumber: carlasbanggar. wordpress.com Gambar 1.4 • 13. 7Ilmu Pengetahuan Alam Kegiatan 1.3 Membandingkan Sel Hewan dengan Sel Tumbuhan Apa yang diperlukan? 1. Bawang merah 2. Epitel pipi manusia 3. Pipet tetes 4. Mikroskop 5.

Pisau atau silet 6. Gelas objek 7. Kaca penutup 8. Air 9. Sendok es krim/batang. Apa yang harus dilakukan? 1. Kupas bagian luar bawang merah dan potong umbi lapis bawang merah secara membujur menjadi dua belahan. 2. Angkat salah satu lapisan tipis dari kulit luar umbi tersebut. Minta bantuan guru jika kamu mengalami kesulitan 3.

Letakkan lapisan tipis tersebut di atas gelas objek! Kemudian, tetesi dengan setetes air. 4. Tutup dengan kaca penutup secara perlahan agar tidak muncul gelembung. 5. Amati di bawah mikroskop. 6. Gambarkan hasil pengamatanmu pada buku tugasmu dengan membuat tabel pengamatan (Tabel 1.1). Tentukan bagian-bagian membran sel, dinding sel, sitoplasma, inti sel, dan vakuola. 1. Bukalah mulutmu. Oleskan ujung batang korek api ke pipimu sebelah dalam.

Berhati-hatilah, jangan sampai tertusuk batang kayu tersebut. Letakkan pada gelas objek yang telah diberi setetes air, kemudian tutup dengan kaca penutup.

Amati di bawah mikroskop. 2. Gambar hasil pengamatanmu pada tempat yang telah disediakan. Tentukan bagian membran sel, sitoplasma, dan inti sel. Ayo Kita Lakukan • 14. 8 Kelas VII SMP/MTs Semester 2 Tabel 1.1 Pengamatan sel Pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan. Gambar Hasil Pengamatan Keterangan 1. Sel bawang merah 2. Epitel pipi Tuliskan perbedaan antara sel tumbuhan dan sel hewan berdasarkan hasil pengamatanmu. Tabel 1.2 Perbedaan antara sel tumbuhan dan sel hewan No.

Perbedaan Sel Tumbuhan Sel Hewan Presentasi Presentasikanlah hasil pengamatanmu di depan kelas. • 15. 9Ilmu Pengetahuan Alam Ingatlah • Sel merupakan unit terkecil kehidupan.

Di dalam sel terdapat penyusun sel atau organel sel. Namun, organel tidak disebut sebagai unit terkecil kehidupan sebab organel tidak mampu hidup mandiri. • Makhluk hidup bersel satu dapat hidup mandiri dan dapat mencukupi kebutuhan hidupnya sendiri seperti energi, mineral, dan sebagainya.

• Umumnya,selberukuranmikroskopis.Namun,adaselyangberukuran makroskopis (besar). Seperti telur burung unta dan sel saraf zarafah yang memiliki panjang lebih dari 1 meter.

Perhatikan Gambar 1.5. Sumber: Campbell, 2008. Biology dan David Sadava, 2011, Life: The Science of Biology Gambar 1.5 Kisaran ukuran sel Atom Lipid Protein Bakteri Manusia Paus BiruBurung Kolibri Kebanyakan sel Hewan dan Tumbuhan Skala dimulai dari bagian atas dengan 10 m dan menurun, setiap pengukuran di sisi kiri menunjukkan pengecilan ukuran 10x Kebanyakan sel berukuran 1-100 μm Cemara Kloroplas Telur Katak Virus T Molekul Sebagian besar sel berdiameter antara 1 sampai 100 µm, sehingga hanya dapat dilihat dengan menggunakan mikroskop.

Perhatikan skala yang dipakai. Skala dimulai dari bagian atas dengan 10 meter dan menurun. Setiap pengukuran di sisi kiri menunjukkan pengecilan ukuran sepuluh kali. Pengukuran 1 centimeter (cm) = 10-2 m = 0,4 inci 1 milimeter (mm) = 10-3 m 1 mikrometer (µm) = 10-3 mm = 10-6 m 1 nanometer (nm) = 10-3 µm = 10-9 m • 16. 10 Kelas VII SMP/MTs Semester 2 Kegiatan 1.4 Kamu telah mempelajari tentang sel sebagai unit fungsional terkecil yang menyusun makhluk hidup. Untuk mempelajarinya, kita membutuhkan alat bantu seperti mikroskop.

Mengapa sebagian besar sel berukuran kecil? Coba jelaskan. (Untuk dapat menjawabnya, perhatikan Gambar 1.6 berikut. Ayo Kita Lakukan Kegiatan 1.5 Tugas Projek Membuat Model Sel 1. Bentuklah satu kelompok yang beranggotakan 5 orang, pilihlah salah satu projek yang akan kamu kerjakan. Membuat model sel hewan atau membuat model sel tumbuhan.

Seperti contoh pada Gambar 1.7. 2. Buatlah model sel yang kamu pilih untuk dikumpulkan sebagai nilai hasil tugasmu. Luas permukaan meningkat sementara volume total tetap konstan Sumber: Gambar 1.6 Sel berukuran kecil • 17. 11Ilmu Pengetahuan Alam 3. Bekerjalah dengan kelompokmu dalam memilih bahan yang akan digunakan untuk membuat model yang sesuai dengan pilihanmu (tumbuhan/hewan)! Apa yang diperlukan? 1. Gabus, tanah liat, atau lilin plastisin. 2.

Lem, gunting atau pisau kecil, dan spidol warna (pisau kecil dan cat warna untuk membedakan bagian-bagian sel). Peringatan: Hati-hati dalam menggunakan gunting dan pisau. Apa yang akan dikerjakan? 1. Bentuk gabus/tanah liat/lilin plastisin menjadi bentuk model sel hewan atau tumbuhan sesuai pilihan kelompok.

Perlu diingat, jangan lupa membuat organelnya. 2. Buatlah model sel tersebut lengkap dengan organel yang ada. Beri warna yang berbeda untuk setiap organel yang berbeda dengan spidol warna/cat warna. 3. Berilah nomor atau nama tiap organel tersebut. 4. Langkah nomor 1 - 3 dapat digunakan dengan bahan yang berbeda, misalnya tanah liat. Sumber: catherinamuiyonto. blogspot.com Gambar 1.7 Model sel hewan 5. Laporkan hasilmu pada pertemuan berikutnya. • 18. 12 Kelas VII SMP/MTs Semester 2 Perlu direnungkan, bahwa sel yang ukurannya kecil ternyata terdiri atas organel-organel yang lebih kecil lagi dan saling membutuhkan satu sama lain.

Tidak ada yang dapat menghidupkan sel kecil tersebut, kecuali Tuhan Yang Maha Hidup dan Pemberi Kehidupan. Oleh karena itu, kita harussenantiasabersyukuratasanugerahTuhanSangPemberiKehidupan. Coba kembali renungkan. Mengapa pada sel hewan tidak dijumpai dinding sel, sedangkan pada sel tumbuhan terdapat dinding sel? Tuhan Yang Maha Kuasa juga pasti memiliki rahasia lain yang menakjubkan dibalik itu, bukan? Refleksi B. Jaringan-jaringan pada Hewan dan Tumbuhan Setiap sel suatu organisme memiliki ukuran yang bervariasi.

Ukuran sel mencerminkan fungsi yang dilakukan sel bersangkutan. Semua fungsi hidup organisme bersel satu dilakukan oleh sel tunggal itu sendiri. Pada organisme bersel banyak, seringkali sel tidak dapat bekerja sendiri. Setiap sel bergantung kepada sel yang lain. Kerja sama dan interaksi di antara sel ini menyebabkan organisme dapat mempertahankan hidupnya. Sel- sel yang mempunyai fungsi dan bentuk sama akan berkelompok.

Kelompok sel disebut jaringan. Kegiatan 1.6 Mengamati Jaringan Apakah jaringan tersusun atas sel-sel yang memiliki ciri yang sama? Apa yang diperlukan? Ayo Kita Lakukan Ayo Kita Pelajari • Jaringan Mengapa Penting? • Untuk menjelaskan bagian-bagian jaringan dan fungsinya. • 19. 13Ilmu Pengetahuan Alam 1. Daun 4. Silet 2. Mikroskop 5. Pewarna metilen biru 3. Gelas objek dan kaca penutup 6. Pipet tetes Apa yang harus dilakukan? 1. Jaringan tumbuhan a.

Sayatlah daun atau batang tumbuhan dengan membujur atau melintang setipis mungkin. b. Letakkan di atas gelas objek dan tetes dengan pewarna metilen biru. Kemudian, tutuplah dengan kaca penutup. c. Amati di bawah mikroskop. Gambarlah jaringan tumbuhannya pada buku tugasmu. d. Identifikasilah bagian-bagian jaringan tersebut. Tabel 1.3 Jaringan tumbuhan Gambar Keterangan 2.

Jaringan hewan a. Siapkan preparat awetan hewan (sel otot polos) yang ada di sekolahmu. b. Amatilah di bawah mikroskop. Gambarlah jaringan-jaringan hewan tersebut. Tabel 1.4 Jaringan hewan Gambar Keterangan • 20. 14 Kelas VII SMP/MTs Semester pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan Analisislah hasil pengamatanmu dan jawablah pertanyaan berikut.

1. Bagaimana struktur jaringan tumbuhan? Identifikasilah. 2. Bagaimana struktur jaringan hewan? Identifikasilah. 3. Bandingkan struktur jaringan hewan dan tumbuhan tersebut. Apakah persamaan dan perbedaannya? Lakukan hal-hal berikut untuk mengevaluasi hasil pengamatanmu. 1. Buat kesimpulan dari hasil pengamatanmu. 2.

Kumpulkan hasil pengamatanmu kepada gurumu. Mintalah penda- patnya. Tumbuhan mempunyai bermacam-macam jaringan. Jaringan pembuluh kayu ( ) berfungsi mengangkut air dan unsur hara dari akar ke daun, sedangkan jaringan pembuluh tapis ( ) mengangkut zat makanan dari daun ke seluruh tubuh tumbuhan. Hewan maupun manusia mempunyai bermacam-macam jaringan juga.

Ada jaringan epitel, jaringan otot, jaringan tulang rawan, jaringan saraf, dan sebagainya. C. Organ-organ pada Hewan dan Tumbuhan Pada waktu pengamatan jaringan tumbuhan, kamu perlu memotong salah satu bagian tumbuhan, misalnya daun. Di dalam daun, ternyata ada beberapa macam jaringan. Kumpulan dari beberapa macam jaringan yang berbeda akan membentuk satu kesatuan untuk melakukan fungsi tertentu disebut organ. Ayo Kita Pelajari • Organ Mengapa Penting?

• Untuk menjelaskan bagian-bagian organ dan fungsinya.

pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan

• 21. 15Ilmu Pengetahuan Alam Kegiatan 1.7 Organ yang terdapat pada tumbuhan Apa yang diperlukan? 1. Tanaman pacar air yang masih memiliki akar dan daun yang telah direndam batang dan akarnya dengan larutan pewarna merah selama 2 x 24 jam 2.

Pisau kecil dan gunting 3. Kertas label 4. Alat tulis Apa yang harus dilakukan? 1. Amati keseluruhan tanaman pacar air tersebut. 2. Identifikasilah bagian-bagian tanaman tersebut (akar, batang, dan daun).

Beri label pada setiap bagiannya untuk mempermudah pengamatanmu. Tuliskan fungsinya 3. Gunakan gunting atau silet untuk memotong organ-organ tumbuhan tersebut.

Berhati-hatilah saat memotong. Peringatan: Berhati-hatilah dalam menggunakan gunting atau silet. Cucilah gunting dan silet tersebut setelah selesai digunakan.

Tabel 1.5 Organ tumbuhan pacar air Gambar Keterangan Tumbuhan Pacar Air Utuh Bagian Daun Bagian Batang Bagian Akar Ayo Kita Lakukan • 22. 16 Kelas VII SMP/MTs Semester 2 Kegiatan Bereksplorasi Untuk melengkapi keterampilan mengenai sel, jaringan, dan organ, kamu diminta untuk melakukan eksplorasi terhadap ketiga hal tersebut.

Eksplorasi dilakukan dengan menelusuri gambar dan mengidentifikasi penjelasan pada gambar. 1. . 2. . 3. . 4. . 5. . 6. . 7. . Sumber: Dok. Kemdikbud Gambar 1.8 Struktur Tumbuhan Lakukan langkah-langkah berikut 1. Perhatikan Gambar 1.8 di atas. 2. Sebutkan organ pada bagian tumbuhan yang ditunjuk. 3. Identifikasilah letak organ tersebut beserta fungsinya. 4. Catatlah hasil pengamatanmu pada buku tugasmu. 5. Carilah informasi melalui buku, majalah, koran, internet, atau sumber yang lain.

Ayo Lakukan • 23. 17Ilmu Pengetahuan Alam 6. Tulislah kesimpulan dari hasil pengamatan kegiatan ini pada buku tugasmu. 7. Laporkan hasil kegiatanmu kepada gurumu dan mintalah pen- dapatnya. Kegiatan 1.8 Bagian-Bagian Tubuh Kamu telah mempelajari bahwa makhluk hidup tersusun atas unit terkecil yang disebut sel.

Sel berkumpul membentuk jaringan dan jaringan akan menyusun organ. Sekarang, tentukan bagian tubuh manusia yang termasuk sel, jaringan, atau organ dengan memberi tanda centang (√) pada kolom sel, jaringan, atau organ pada Tabel 1.6 berikut. Tabel 1.6 Bagian-bagian tubuh Gambar Bagian Tubuh Nama Sel Jaringan Organ Gambar 1.9 Gambar 1.10 Ayo Kita Latihan • 24.

18 Kelas VII SMP/MTs Semester 2 Gambar Bagian Tubuh Nama Sel Jaringan Organ Gambar 1.11 Gambar 1.12 Gambar 1.13 Sumber: D. Sistem Organ dan Organisme Kamu sudah menemukan bermacam- macam organ yang terdapat pada tum- buhan dan manusia. Beberapa organ yang bekerja sama untuk melakukan fungsi kerja tertentu disebut. Lanjutkan kegiatan ini untuk mem- pelajari sistem organ dan organisme. Ayo Kita Pelajari • Sistem organ dan organisme Mengapa Penting? • Menjelaskan sistem organ dan organisme • 25.

19Ilmu Pengetahuan Alam Kegiatan 1.9 Sistem Organ dan Organisme Sebutkan organ-organ yang dapat ditemukan pada tubuh manusia dan telusuri fungsi masing-masing organ tersebut. Jawablah pertanyaan tersebut melalui percobaan berikut.

Apa yang diperlukan? - Torso/model manusia Lakukan langkah-langkah berikut ini. 1. Perhatikan torso/model tubuh manusia yang ada di sekolahmu. 2. Identifikasilah organ-organ yang menyusun torso tersebut.

Kemudian tentukan cara menyusun sistem organ-organ tersebut. 3. Catatlah hasil pengamatanmu dalam Tabel 1.7 berikut ini. Tabel 1.7 Organ dan sistem organ No. Organ Fungsi Sistem Organ 1. 2. 3. 4. dst Simpulkan hasil pengamatanmu. Ayo Lakukan Kegiatan 1.10 Bagian-bagian Tubuh Sistem organ merupakan bentuk kerja sama antarorgan untuk me- lakukan fungsinya.

Dalam melaksanakan kerja sama ini, setiap organ tidak bekerja sendiri-sendiri, melainkan organ-organ saling bergantung dan saling memengaruhi satu sama lainnya.Tanpa ada kerja sama dengan organ lain, maka proses dalam tubuh tidak akan terjadi.

Sistem organ manusia lebih detil dapat dilihat pada Tabel 1.8. Sistem organ, organ, dan fungsi yang masih belum terisi silahkan kamu cari sendiri dari berbagai referensi. Ayo Kita Latihan • 26. 20 Kelas VII SMP/MTs Semester 2 Pelajari sistem organ manusia yang terdapat padaTabel 1.8. Kemudian tuliskan nama masing-masing organ tersebut pada gambar yang tersedia.

Tabel 1.8 Sistem Organ Manusia No. Sistem Organ Gambar Organ Fungsi 1. Sistem pencernaan Gambar 1.14 Sistem pencernaan Mulut (lidah, gigi), faring, esofagus, lambung, usus halus, usus besar, hati, rektum, pankreas, dan anus Mencerna makanan, mengabsorbsi molekul-molekul makanan yang sudah disederhanakan 2.

Sistem pernapasan Gambar 1.15 Sistem pernapasan 3. Sistem gerak (rangka) Gambar 1.16 Sistem gerak (rangka) Tulang Menyokong dan melindungi organ dalam • 27. 21Ilmu Pengetahuan Alam No Sistem Organ Gambar Organ Fungsi 4. Sistem transportasi/ sirkulasi/ peredaran darah Gambar 1.17 Sistem Sirkulasi Jantung, arteri, vena, kapiler, dan sel-sel darah. Mengangkut oksigen dan sari makanan ke seluruh sel tubuh, dan mengangkut zat hasil metabolisme yang tidak berguna keluar dari sel tubuh, serta melindungi tubuh dari mikroorganisme penyebab penyakit.

5. Gambar 1.18 Sistem Saraf 6. Sistem ekskresi Gambar 1.19 Sistem Ekskresi Paru-paru, ginjal, kulit, dan hati Mengeluarkan sisa metabolisme yang tidak terpakai dari dalam tubuh dan menjaga keseimbangan sel dengan lingkungannya 7.

Sistem reproduksi Gambar 1.20 Sistem Reproduksi Ovarium, rahim, dan vagina. Perkembangbiakan Sumber: • 28. 22 Kelas VII SMP/MTs Semester 2 Sekarang kamu sudah mengetahui bahwa di dalam tubuh terdapat beberapa sistem organ. Pada kelompok makhluk hidup multiseluler seperti manusia, antarsistem organ saling berhubungan dan bekerja sama untuk menjalankan fungsinya.

Sistem organ ini kemudian membentuk organisme, yaitu satu jenis makhluk hidup/individu, misalnya manusia. Penerapan Konsep Kamu telah mempelajari bahwa organisme tersusun atas sistem organ yang tersusun atas organ. Apakah makhluk hidup tingkat rendah memiliki organ dan sistem organ? Coba pikirkan dan temukan jawabannya. Lakukanlah eksplorasi. Kegiatan 1.11 Mengamati Organisme Apa yang perlu disiapkan dalam eksplorasi ini? 1. Sampel air yang menggenang beserta serasahnya dan tumbuhan air yang dibiarkan beberapa hari (dapat diambil dari air selokan yang terdapat di sekitar sekolah, rumah, atau persawahan).

Cucilah kedua tanganmu dengan sabun setelah melakukan kegiatan ini. 2. Mikroskop. pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan. Gelas objek dan kaca penutup. 4. Pipet tetes. Ayo Lakukan • 29. 23Ilmu Pengetahuan Alam Apa yang harus dilakukan? 1. Ambil sedikit air genangan dengan menggunakan pipet tetes.

2. Teteskan satu tetes pada gelas objek dan tutup dengan kaca penutup. Tutuplah gelas objek secara perlahan dan hati-hati. 3. Amati preparat tersebut dengan mikroskop. 4. Gambarlah organisme atau bagian organisme yang tampak pada mikroskop di buku tugasmu. Analisislah hasil pengamatanmu dengan menjawab pertanyaan berikut. 1. Termasuk organisme atau bagian tubuh organisme apa yang kamu lihat?

2. Tuliskan kesimpulan yang didapat dari kegiatan ini di buku tugasmu. Kemudian laporkan hasil pengamatan pada gurumu. Kita sebagai manusia patut bersyukur atas nikmat yangTuhan berikan.

Tak ada satu pun yang Tuhan ciptakan secara sia-sia. Semua ciptaan Tuhan memiliki manfaat dan fungsi tertentu bagi kehidupan. Mari kita renungkan apa yang sudah Tuhan berikan kepada manusia. Organ-organ yang Tuhan ciptakan sangat sempurna. Tuhan meletakkan organ-organ tubuh manusia sesuai tempatnya, sehingga tampak indah dan sempurna.

Semua organ tubuh manusia terjalin dalam satu kesatuan tubuh. Semua organ berfungsi, bergerak, dan bekerja sama sesuai dengan peranannya masing-masing.Mataberfungsisebagaialatpenglihatan,telingaberfungsi sebagai alat pendengaran, dan lain sebagainya. Bayangkan jika semua organ tidak mau bergerak sesuai dengan fungsinya maka akan terjadi mata jadi telinga, telinga jadi mulut, kaki jadi kepala. Tidak akan pernah dapat menjadi satu kesatuan, Maha Besar Tuhan Yang Maha Pencipta. Refleksi • 30.

24 Kelas VII SMP/MTs Semester 2 Kita telah mempelajari tentang Sistem Organisasi Kehidupan, tahukah kamu ilmuwan yang sudah berjasa untuk pengembangan ilmu yang telah kita pelajari ini? • Robert Hooke (1635-1703) merupakan seorang kimiawan dan fisikawan yang melakukan riset di bidang optik dan geometri. Salah satu temuan pentingnya adalah mikroskop tetes, lensanya dibuat dari tetesan kaca pijar yang berbentuk cakram bikonkaf.

Mikroskop buatan Hooke adalah penyempurnaan dari mikroskop Leuwenhook. Penemuan ini dipublikasikan dalam bentuk buku berisi cara pembuatan dan teknik penggunaan mikroskop yang diberi judul Micrographia. Melalui mikroskop buatannya ini Hooke dapat mengamati sel hewan dan sel tumbuhan.

Sel pertama yang diamati adalah sel jaringan gabus pada tumbuhan. Hooke juga yang pertama kali menyebutkan kata sel dalam jurnal penelitiannya. • Theodore Schwann (1810-1882) seorang ahli pengetahuan berkebangsaan Jerman, melaporkan bahwa tubuh hewan tersusun atas sel. Kemudian Schwann mengusulkan dua azas yang dikenal dengan teori sel, yaitu semua organisme terdiri atas sel, dan sel merupakan unit dasar organisasi kehidupan.

Jauh sebelum masa para ahli tersebut, seorang ilmuwan yang bernama Ibnu Sina (980- 1037) telah mempelajari banyak hal tentang ilmu pengetahuan alam, di antaranya tentang fungsi organ tubuh. Selain itu juga Alexander Oparin (1894-1980) merupakan ilmuwan sains dari bangsa barat yang terjun dalam bidang biologi. Oparin adalah orang pertama yang membuktikan bahwa sel muncul sebelum adanya gen atau protein. INFO ILMUWAN • 31. 25Ilmu Pengetahuan Alam Organisme merupakan bagian hierarki pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan makhluk hidup yang membentuk organisasi kehidupan.

Hierarki struktur ini disebut hierarki Biologi. Organisasi kehidupan terdiri atas atom molekul organel sel sel jaringan organ sistem organ organisme. Sel berada di tingkatan struktural terendah yang masih mampu menjalankan semua fungsi kehidupan. Sel mampu melakukan regulasi terhadap dirinya sendiri, memroses energi, tumbuh dan berkembang, tanggap terhadap lingkungan, serta melakukan reproduksi. Kerja sama dan interaksi di antara sel-sel ini menyebabkan organisme dapat mempertahankan hidupnya.

Sel-sel yang mempunyai fungsi dan bentuk yang sama akan berkelompok. Kelompok sel itu dinamakan jaringan. Kumpulan dari beberapa macam jaringan yang berbeda dan membentuk satu kesatuan untuk melakukan fungsi tertentu disebut organ. Sistem organ merupakan bentuk kerja sama antarorgan untuk melakukan fungsi tertentu. RANGKUMAN • 32. 26 Kelas VII SMP/MTs Semester 2 Uji kompetensi Jawablah pertanyaan-pertanyaan berikut dengan benar. 1. Perhatikan gambar sel di bawah ini.

Identifikasilah bagian-bagiannya. Bagian-bagian yang menyusun sel tumbuhan A. . B. . C. . D. . E. . F. . G. . H. . I. . J. . K. . L. . M. . N. . Gambar 1.21 Sel Sumber: 2. Apayangterjadidengansistemorgantertentu,jikasalahsatuorganpenyusun- nyamengalamikerusakan?Dapatkahsistemorgantersebutberfungsidengan baik? a. Bagian sel manakah yang menjadi penentu sel tersebut menjadi sel hidup atau sel mati? b. Apa yang terjadi apabila organ yang ditunjuk dengan huruf (I) pada Gambar 1.21 tidak berfungsi dengan baik?

c. Bagian manakah yang disebut dinding sel? Mengapa sel ini memiliki dinding sel? Jelaskan. • 33. 27Ilmu Pengetahuan Alam 3. Perhatikan gambar sistem pencernaan di bawah ini. Sebutkan bagian-bagian yang diberi tanda dengan huruf a sampai dengan r. Organ-organ penyusun sistem pencernaan a. . b. . c. . d. . e. . f.

. .

pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan

. g. . h. . i. . j. . k. . l. . m. .

pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan

. . o. . p. . q. . Gambar 1.22 Sistem Pencernaan Sumber: 4. Mengapa mikroskop merupakan sesuatu yang sangat berguna untuk mempelajari sel? Jelaskan. Pemecahan Masalah Kulit merupakan bagian tubuh manusia yang paling luas, rapat, dan kuat. Apakah kulit termasuk organ? Mengapa kulit yang kuat dapat berdarah? Kemukakan alasanmu! • 34. Interaksi Makhluk Hidup dengan Lingkungan Istilah-istilah Penting Lingkungan, Ekosistem, Saling Ketergantungan, Pola Interaksi Bab 2 Sumber: • 35.

29Ilmu Pengetahuan Alam Perhatikan Gambar 2.1 di bawah ini. Pada gambar (a) terlihat burung bangau bertengger di puncak pohon sedang berjemur setelah mencari makan di daerah sekitar Suaka Margasatwa, Pulau Rambut, Kabupaten Kepulauan Seribu, DKI Jakarta. Pada Gambar (b) terlihat seekor biawak sedang mengendap- endap mencari mangsa di tempat yang sama dengan burung bangau. Oleh karena itu, jika burung bangau tersebut berada di bawah, maka bangau akan menjadi santapan bagi biawak.

Peristiwa seperti ini sering terjadi di semua tempat bahwa sesama makhluk hidup saling berinteraksi. Sumber: Dokumen pribadi Drs. Paskal Sukandar, M.Si Gambar 2.1 (a) Burung bangau yang bertengger pada pohon, (b) Seekor biawak sedang mengendap mencari makan di Suaka Margasatwa Pulau Rambut DKI Jakarta (a) (b) Pada Bab 2 ini, kamu akan mempelajari interaksi makhluk hidup dengan lingkungannya. Untuk memahami bab ini dengan baik, coba pahami lebih dahulu mengenai lingkungan dan melakukan pengamatan terhadap lingkungan.

A. Pengertian Lingkungan Istilah berasal dari kata " ", yang memiliki makna " " Berdasarkan istilah tersebut, lingkungan secara umum dapat diartikan sebagai segala sesuatu di luar individu.

Segala sesuatu di luar individu merupakan sistem yang kompleks, sehingga dapat memengaruhi satu sama lain. Kondisi yang saling memengaruhi Ayo Kita Pelajari • Pengertian Lingkungan Mengapa Penting?

• Untuk menjelaskan konsep lingkungan dan komponennya • 36. 30 Kelas VII SMP/MTs Semester 2 ini membuat lingkungan selalu dinamis dan dapat berubah-ubah sesuai dengan kondisi. Selain itu, komponen lingkungan itu dapat saling memengaruhi dengan kuat.

Ada saatnya kualitas lingkungan berubah menjadi baik dan tidak menutup kemungkinan untuk berubah menjadi buruk. Perubahan itu dapat disebabkan oleh makhluk hidup dalam satu lingkungan tersebut.

Lingkungan terdiri atas dua komponen utama, yaitu komponen biotik dan abiotik. 1. Komponen biotik, terdiri atas makhluk hidup, seperti manusia, hewan, tumbuhan, dan jasad renik. 2. Komponen abiotik, terdiri atas benda-benda tidak hidup di antaranya air, tanah, udara, dan cahaya.

Kegiatan 2.1 Mempelajari Lingkungan Apa yang kamu amati pada Gambar 2.2? Pada gambar tersebut terdapat air, ikan, dan tumbuhan air. 1. Bagian yang hidup adalah . 2. Bagian yang tidak hidup adalah . 3. Bagaimana bagian yang hidup dan tidak hidup dapat berinteraksi? Alat dan Bahan 1. Botol plastik bekas air mineral ukuran 2 liter 2. Gunting 3. Pasir 4.

Kerikil 5. Penggaris 6. Pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan 7. Tumbuhan dan, 8. Ikan kepala timah/ 9. Makanan ikan Sumber: akuarium.forum.o-fish.com Gambar 2.2. Ekosistem buatan Ayo Kita Lakukan • 37. 31Ilmu Pengetahuan Alam Lakukan percobaan dengan langkah-langkah berikut. a. Potonglah bagian atas dari botol plastik yang telah dicuci.

b. Tuangkan lapisan pasir setebal 5-10 cm di bagian dasar botol. c. Isilah botol tersebut dengan air sampai 5 cm di bawah permukaan botol dan biarkan terbuka selama 2 hari.

Jaga volume air agar tetap stabil dengan menambahkan air untuk mengganti air yang menguap dari botol. d. Tanamlah dan tambahlah 2 cm lapisan kerikil. e. Bila air telah jernih, tambahkanlah seekor ikan kepala timah atau ikan koki atau ikan lain yang berukuran kecil.

f. Berilah makan ikan dengan memasukkan makanan ikan secukupnya setiap hari. g. Sekarang kamu telah membuat suatu lingkungan yang disebut ekosistem. h. Amatilah ekosistemmu setiap hari dan catatlah apa yang kamu amati dalam buku catatanmu. Pastikan kamu mengamati tentang bagian yang hidup dan bagian yang tidak hidup dalam ekosistemmu.

Analisislah hasil kegiatanmu dengan menjawab pertanyaan berikut! a. Bagaimana bagian-bagian dalam botol berinteraksi untuk menyusun ekosistem? Jelaskan! b. Apa yang diperlukan untuk menjaga agar ekosistem tersebut sehat?

Presentasikan hasil percobaanmu di depan kelas. B. Hal-hal yang Ditemukan dalam Suatu Lingkungan Di sekolah, kamu menghabiskan waktu dalam ruangan kelas untuk berinter- aksi dengan teman dan guru. Setelah kegiatan sekolah selesai, mungkin kamu pergi ke lapangan olahraga, ke toko buku, atau berjalan menuju tempat bermain. Setiap hari, kamu menuju ke tempat yang berbeda di sekitarmu.

Pernahkah kamu mencatat tempat yang kamu kunjungi? Apakah kamu juga mempelajari interaksimu dengan lingkungan yang kamu kunjungi? • 38. 32 Kelas VII SMP/MTs Semester 2 Setiapmakhlukhidupmemerlukan ling- kungan tertentu sebagai tempat hidupnya. Tahukah kamu, tempat hidup dinamakan. Dalam suatu habitat, terdapat ber- bagai jenis makhluk hidup ( ) dan makhluk tak hidup ( ). Tempatyangkamukunjungimerupakan suatu habitat bagi suatu makhluk hidup. Pada tempat tersebut akan terjadi interaksi antara makhluk hidup dan makhluk tak hidup.

Kegiatan 2.2 Mengamati Ekosistem Amati Gambar 2.3, dan catat pengamatanmu. • Ada tanaman padi • Ada tanah tempat tumbuh tanaman padi • Ada . • Ada . Buatlah pertanyaan berdasarkan hasil pengamatan tersebut. 1. Buatlah kelompok yang terdiri atas 4-5 orang.

2. Catatlah jenis-jenis ekosistem apa saja yang diamati di lingkungan sekolahmu. 3. Catatlah semua makhluk hidup dan makhluk tak hidup yang terdapat pada lingkungan tersebut dalam suatu tabel seperti berikut. Kerjakan di buku tugasmu. Sumber: Dok. Kemdikbud Gambar 2.3 Siswa mengamati lingkungan di sekitar sekolah Ayo Kita Lakukan Ayo Kita Pelajari • Komponen lingkungan Mengapa Penting? • Untuk mengetahui dan mengidentifikasikan komponen biotik dan abiotik dalam lingkungan • 39. 33Ilmu Pengetahuan Alam Tabel 2.1 Hasil pengamatan lingkungan No.

Makhluk Hidup (Biotik) Jumlah Makhluk tak hidup (Abiotik) Keterangan 1. … … … … 2. … … … … 3. … … … … 4. … … … … 5. … … … … … … … … … 4. Buatlah kesimpulan dari kegiatanmu dengan mengaitkan peran setiap komponen tersebut. C. Interaksi dalam Ekosistem Membentuk Suatu Pola Jika kamu mengamati bagian ke- cil ekosistem seperti pada kegiatan sebelumnya, atau seluruh ekosistem yang luas seperti lautan, kamu dapat mengetahui hubungan keterkaitan di antara organisme yang terdapat dalam ekosistem tersebut.

Setiap organisme tersebut tidak dapat hidup sendiri dan selalu bergantung pada organisme yang lain dan lingkungannya. Saling ketergantungan ini akan membentuk suatu pola interaksi. Terjadi interaksi antara komponen biotik dengan kom- ponen abiotik, dan terjadi interaksi antarsesama komponen biotik.

Ayo Kita Pelajari • Interaksi dalam ekosistem Mengapa Penting? • Untuk mengetahui dan menjelaskan pola interaksi dalam ekosistem Ayo Pikirkan • Pernahkah kamu melihat suatu daun yang berlubang? • Apa yang menyebabkan daun tersebut berlubang? • 40. 34 Kelas VII SMP/MTs Semester 2 1. Interaksi Antara Makhluk Hidup dengan Makhluk Hidup yang Lain. Interaksi antara makhluk hidup dengan makhluk hidup yang lain dapat terjadi melalui rangkaian peristiwa makan dan dimakan.

Seperti rantai makanan, jaring- jaring makanan, dan piramida makanan. Selain itu, melalui bentuk hidup bersama, yaitu simbiosis. Perhatikan Gambar 2.4 dan 2.5. Sumber: Piramida makanan.idfk.bogor.net Sumber: Anneahira.com Gambar 2.4 Piramida makanan Gambar 2.5 Jaring-jaring makanan. 2. Macam-macam Simbiosis Simbiosis merupakan bentuk hidup bersama antara dua individu yang berbeda jenis. Ada tiga (3) macam simbiosis, yaitu simbiosis mutualisme, simbiosis komensalisme, dan simbiosis parasitisme.

merupakan suatu hubungan dua jenis individu yang saling memberikan keuntungan satu sama lain. adalah hubungan interaksi dua jenis individu yang memberikan keuntungan kepada salah satu pihak, tetapi pihak lain tidak mendapatkan kerugian. merupakan hubungan dua jenis individu yang memberikan keuntungan kepada salah satu pihak dan kerugian pada pihak yang lain. Perhatikan Gambar 2.6.

Contoh simbiosis mutualisme adalah antara pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan dan akar pohon pinus.

Jamur mendapatkan makanan dari pohon pinus, sedangkan pohon pinus mendapatkan garam mineral dan air lebih banyak jika bersimbiosis dengan jamur. Unit Energi 0,01 1 10 1000 Unit Energi Unit Energi Unit Energi • 41. 35Ilmu Pengetahuan Alam Contoh simbiosis komensalisme adalah antara tanaman anggrek dengan pohon mangga.

Tanaman pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan mendapatkan keuntungan berupa tempat hidup, sedangkan pohon mangga tidak mendapatkan keuntungan maupun kerugian dari keberadaan tanaman anggrek tersebut. Contoh simbiosis parasitisme adalah antara kutu rambut dan manusia. Kutu rambut memperoleh keuntungan dari manusia berupa darah yang diisap sebagai makanannya sedangkan manusia akan merasakan gatal pada kulit dikepalanya.

(a) (b) (c) Sumber: f4-preview.awardspace.com m.kidnesia.com sukasains.com Gambar 2.6 Macam-macam simbiosis pada makhluk hidup (a) Komensalisme (ikan badut dengan anemon) (b) Parasitisme (tumbuhan tali putri dengan inangnya) (c) Mutualisme (lebah dengan bunga) 3.

Peran Organisme Berdasarkan Kemampuan Menyusun Makanan Berdasarkan kemampuan menyusun makanan, peran organisme dibagi dan. Organisme heterotrof, berdasarkan jenis makanannya dibagi lagi menjadi 3 (tiga), yaitu, dan. (a) (b) (c) Sumber: id.inter-pix.com httpgrant.d11.org news.detik.com Gambar 2.7 Macam-macam hewan berdasarkan makanannya (a) herbivora (b) karnivora (c) omnivora menjadi 2 (dua), yaitu • 42.

36 Kelas VII SMP/MTs Semester 2 Untuk memahami ekosistem, kamu harus melakukan kegiatan berikut. Kegiatan 2.3 Memahami Saling Ketergantungan antara Makhluk Hidup Kamu akan melakukan si- mulasi tentang saling ketergan- tungan makhluk hidup dalam suatu ekosistem. Dengan kegi- atan ini, kamu diharapkan me- mahami pentingnya setiap or- ganisme bagi kehidupan. Benda yang diperlukan.

1. Benang kasur atau tali rafia. 2. Kartu-kartu yang berisi komponen ekosistem. Kegiatan ini dapat dilakukan di dalam atau di luar kelas.

Lakukan langkah-langkah sebagai berikut. 1. Pilih salah satu ekosistem. 2. Berkumpullah bersama temanmu membentuk lingkaran. 3. Bagilah peran temanmu masing-masing. Misalnya, temanmu yang pertama sebagai pohon dan memegang ujung tali. 4. Temanmu yang kedua yang berada di seberang teman pertama menyebutkan salah satu komponen ekosistem hutan tropis, selan- jutnya menjelaskan keterkaitan dengan komponen sebelumnya.

Misalnya burung, hubungannya sebagai tempat hidup. 5. Kemudian pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan dihubungkan lagi ke teman ketiga yang berada di seberang teman kedua. Pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan ini terus dilakukan sampai semua teman sudah memegang tali rafia yang mewakili komponen hutan tropis.

Sumber: Dok. Kemdikbud Gambar 2.8 Benang kasur Sumber: Dok. Kemdikbud Gambar 2.9 Tali rafia Ayo Kita Lakukan • 43. 37Ilmu Pengetahuan Alam Sumber: Dok. Kemdikbud Gambar 2.10 Peserta didik bermain simulasi saling ketergantungan pada hutan tropis 6. Setiap peserta didik harus memegang tali. 7. Guru menyebutkan salah satu komponen hutan tropis.

Peserta didik yang memerankan komponen tersebut menggoyang-goyangkan tali yang dipegangnya, dan semua peserta didik diminta komentarnya apa yang dirasakan?

Ternyata, semua peserta didik akan merasakan getaran dari tali rafia tersebut. 8. Selanjutnya, guru menyebutkan salah satu komponen hutan lain, dan meminta melepaskan tali yang dipegangnya. Akibatnya, ada (komponen lain) yang talinya tidak kencang lagi dan komponen tersebut harus melepaskan talinya. 9. Buatlah kesimpulan berdasarkan kegiatan ini yang berkaitan dengan interaksi antarkomponen ekosistem hutan tropis. 1. Perhatikan Gambar 2.11.

Berapa rantai makanankah yang terlihat pada gambar jaring-jaring makanan tersebut? 2. Apakah rantai makanan yang satu dengan yang lain saling ber- hubungan? Jelaskan. Ayo Kita Latihan • 44. 38 Kelas VII SMP/MTs Semester 2 Sumber: dc228.4shared.com Gambar 2.11 Jaring-jaring makanan 3.

Tuliskan rantai makanan yang ditunjukkan pada Gambar 2.11 di atas. Isikan jawabannya pada tabel berikut. No. Rantai Makanan Bentuk interaksi Keterangan 1. Contoh: Tumbuhan tikus elang pengurai Produsen- konsumen - pengurai Produsen = tumbuhan Konsumen = tikus dan elang Pengurai = jamur 2. 3. 4. Burung Musang Elang Pengurai • 45. 39Ilmu Pengetahuan Alam 1. Apakah yang akan terjadi apabila salah satu organisme tidak tersedia di alam?

2. Apakah yang akan terjadi jika produsen dalam suatu ekosistem punah? Coba prediksikan. Jelaskan alasanmu.

Berpikir Kritis Eksplorasi Kamu telah melakukan simulasi tentang saling ketergantungan antara makhluk hidup (Kegiatan 2.3). Sekarang, lanjutkan dengan eksplorasi. Adapun yang akan dieksplorasi adalah ekosistem di sekitar sekolah. Kegiatan 2.4 Mengetahui bentuk saling ketergantungan Setiapmakhlukhidupmemilikikebutuhanyangberbedadarimakhluk hidup atau komponen ekosistem yang satu dengan yang lain.

Oleh karena itu, ada berbagai macam bentuk saling ketergantungan antarmakhluk hidup. Buatlah pertanyaan berdasarkan deskripsi tersebut. Bahan atau alat yang dibutuhkan 1. Alat tulis 2. Kaca pembesar (bila perlu) Lakukan langkah-langkah berikut ini. 1. Perhatikan dan amatilah ekosistem sawah, kolam ikan, lapangan rumput, atau ekosistem lain di sekitar sekolahmu. 2. Dapatkah kamu menentukan bentuk saling ketergantungan antara komponen-komponen dalam ekosistem?

Ayo Kita Lakukan • 46. 40 Kelas VII SMP/MTs Semester 2 Petunjuk Keselamatan Kerja Hati-hatilah dalam melakukan pengamatan, jangan memetik tumbuhan dan jangan melakukan kontak langsung dengan hewan yang kamu temui, cucilah tangan kamu setelah melakukan kegiatan ini. 3. Catat hasil pengamatanmu pada tabel berikut.

No. Makhluk hidup I Makhluk hidup II Bentuk saling ketergantungan 1. … … … 2. … … … 3. … … … 4. … … … 5. … … … … … … … Apa yang dapat kamu simpulkan? 1. Bentuk saling ketergantungan organisme-organisme yang kamu temukan adalah.

2. Contoh bentuk saling ketergantungan adalah. Presentasi Presentasikan hasil pengamatanmu di depan kelas. • 47. 41Ilmu Pengetahuan Alam D. Pola Interaksi Manusia Memengaruhi Ekosistem Alam yang awalnya sebagai sa- habat bagi manusia, dapat menjadi ancaman bagi kehidupan manusia.

Mengapa? Untuk menjawab perta- nyaan tersebut, lakukan pengamatan di bawah ini. Ayo Pikirkan • Pernahkah kamu melihat gerakan ikan dan menghitung gerakan membuka menu- tupnya (tutup insang) selama 1 menit ( ) pada habitat air yang bersih? Bagaimana apabila habitatnya diganti dengan air yang tercemar? Adakah perbedaan gerakan dan frekuensi membuka dan menutupnya operkulum? Untuk men- jawab semua pertanyaan tersebut, lakukan kegiatan berikut. Sumber: Dok.

Kemdikbud Gambar 2.12 Ikan dalam air habitat yang bersih Kegiatan 2.5 Mengetahui keadaan Ikan pada air bersih dan tercemar Siapkan dua stoples. Satu stoples diisi air bersih sedangkan stoples lainnya diisi air tercemar. Masukkan seekor ikan pada masing-masing stoples. Amati ikan dalam stoples yang telah disiapkan, tulis hasil peng- amatanmu. Misalnya, gerakan ikan, berapa kali membuka menutupnya insang selama 1 menit. Dari hasil pengamatanmu, buatlah pertanyaan.

Bagaimanakah pengaruh . terhadap . Ayo Lakukan Ayo Kita Pelajari • Interaksi manusia memengaruhi ekosistem Mengapa Penting? • Untuk mengetahui dan memahami interaksi manusia dalam memengaruhi ekosistem • 48.

42 Kelas VII SMP/MTs Semester 2 Lakukan percobaan dengan langkah-langkah berikut. 1. Siapkan 4 buah stoples kosong, 4 ekor ikan kecil, dan 2. Isi setiap stoples dengan: a. air bersih, b. air sabun mandi (2 tetes/250 mL), c. air sabun detergen (2 tetes/250 mL), d. obat nyamuk cair (2 tetes/250 mL). 3. Masukkan ikan-ikan tersebut ke dalam stoples. Lakukan analisis dengan langkah-langkah berikut. 1. Amati ikan dalam waktu 5 menit, 10 menit, dan 15 menit.

2. Diskusikan hasil pengamatanmu dengan teman di kelas dan gurumu. Presentasikan hasil pengamatanmu di depan kelas • Al-Tamimi adalah ilmuwan pada abad ke-10 M yang menulis buku mengenai hubungan antara ekologi dengan lingkungan yang cukup lengkap. Buku itu berisi tentang berbagai tipe polusi udara di berbagai negara dan hubungannya dengan kondisi geografi, berbagai macam penyakit akibat polusi udara dan berbagai macam infeksi alami, prosedur higienisasi lingkungan ketika epidemi penyakit terjadi, cara mengatasi polusi air, cara merawat air di kolam dan berbagai macam polusinya.

Selain Al- Tamimi, Qusta Ibnu Luqa, salah seorang penerjemah dan penulis buku terkemuka di abad ke-10 M menghasilkan karyanya yang terkait dengan isu lingkungan dengan risalah tentang penyakit menular. Dalam risalahnya, dijelaskan hubungan antara penyakit menular dengan polusi lingkungan.

Polusi yang berasal dari bumi, antara lain uap dari hutan dan rawa-rawa, serta asap dari gunung berapi. Lingkungan yang banyak polusinya membuat penyakit menular dapat menular dengan lebih cepat.

Selain itu, dijelaskan pula bahwa cuaca yang sangat ekstrem dapat menurunkan kekebalan tubuh manusia. INFO ILMUWAN. • 49. 43Ilmu Pengetahuan Alam • Howard Thomas Odum (1924-2002) adalah seorang ahli ekologi Amerika. Jurnal pertama yang dipublikasikan berjudul pada tahun 1950. Thomas Odum sangat terkenal di berbagai negara melalui bukunya.

Buku ini menjadi panduan dan pegangan utama bagi para pelajar yang ingin menekuni bidang ekologi di lebih dari 13 negara. Lingkungan secara umum diartikan sebagai segala sesuatu di luar individu. Segala sesuatu di luar individu merupakan sistem yang kompleks sehingga dapat memengaruhi satu sama lain. Lingkungan terdiri atas dua komponen utama, yaitu komponen biotik dan komponen abiotik. Komponen biotik terdiri atas makhluk hidup, seperti manusia, hewan, tumbuhan, dan jasad renik.

Komponen abiotik terdiri atas benda-benda mati seperti air, tanah, udara, cahaya, dan sebagainya. Setiap organisme tidak dapat hidup sendiri dan selalu bergantung pada organisme lain dan lingkungannya. Saling ketergantungan ini akan membentuk suatu pola interaksi. Pola interaksi ini terjadi antara komponen biotik dan komponen abiotik serta antara komponen biotik dan biotik. Interaksiantaramakhlukhidupdenganmakhlukhidupyanglaindapat terjadi melalui rangkaian peristiwa makan dan dimakan (rantai makanan, jaring-jaring makanan, dan piramida makanan), maupun melalui bentuk hidup bersama, yaitu simbiosis.

Berdasarkan cara menyusun makanannya, makhluk hidup dapat berperan sebagai organisme dan. Manusia juga memiliki interaksi dengan lingkungan. Berubahnya tatanan lingkungan oleh kegiatan manusia atau oleh proses alam me- nyebabkankualitaslingkunganturunsampaiketingkattertentu,akibatnya lingkungan menjadi kurang atau tidak dapat berfungsi lagi sesuai dengan peruntukannya. RANGKUMAN • 50. 44 Kelas VII SMP/MTs Semester 2 Uji kompetensi Perhatikan Gambar 2.13 berikut ini.

Ekosistem Sawah dan Berbagai Permasalahannya Sumber: belajar.kemdikbud.go.id Gambar 2.13 Rantai makanan pada ekosistem sawah Ekosistem sawah merupakan salah satu ekosistem buatan manusia yang bertujuan untuk memenuhi kebutuhan pangan masyarakat. Tumbuh-tumbuhan yang dikembangkan pada ekosistem sawah umumnya merupakan produk-produk pertanian, seperti padi.

Namun, pada kenyataannya padi bukan hanya sumber makanan pokok bagi manusia, tetapi juga bagi makhluk hidup lainnya. Akibatnya, terjadi aliran energi dan materi dari padi ke beberapa makhluk hidup lainnya yang mengakibatkan menurunnya jumlah sumber makanan pokok manusia. Salah satu contoh makhluk hidup pemakan padi pada ekosistem sawah adalah serangga. Banyaknya serangga yang mencari makanan pada ekosistem sawah mengun- dang kehadiran katak pemangsa serangga.

Akibatnya, para petani juga harus berhadapan dengan katak yang banyak berada di sawah. Hal ini tentu akan mengganggu aktivitas pertanian masyarakat. Oleh karena itu, petani melakukan banyak upaya untuk mengatasi permasalahan tersebut.

Berdasarkan uraian di atas, jawablah pertanyaan berikut dengan benar. 1. Jika para petani melakukan pemberantasan serangga, apa yang akan terjadi pada populasi padi dan katak? Jelaskan. • 51. 45Ilmu Pengetahuan Alam 2. Apa saja yang mungkin memengaruhi keseimbangan ekosistem sawah tersebut? Coba identifikasikanlah 5 komponen abiotik yang ada. 3. Apa yang akan terjadi jika produsen pada ekosistem sawah tersebut habis karena suatu bencana alam, misalnya terjadi banjir?

4. Mengapa (padi, serangga, katak, ular, dan elang) dapat hidup di satu tempat yang sama, yaitu ekosistem sawah? Jelaskan jawabanmu berdasarkan Gambar 2.13. 5. Apabila pada ekosistem sawah tersebut tidak ada ular, coba jawab hal-hal yang akan terjadi berikut ini. a. Apa yang akan terjadi dengan populasi katak pada ekosistem sawah tersebut?

b. Apa yang akan terjadi pada populasi elang pada ekosistem sawah tersebut? c. Apa dampak yang ditimbulkan pada aktivitas pertanian yang dilakukan oleh para petani pada eksosistem sawah tersebut? 6. Perhatikan gambar berikut! Sumber: • 52. 46 Kelas VII SMP/MTs Semester 2 Sebuah pabrik terletak berdekatan dengan sungai yang mengalir melalui perumahan.

Pabrik ini beroperasi setiap hari. Penduduk perumahan yang terletak di sebelah timur sungai sering mengalami permasalahan iritasi pada mata mereka, sedangkan penduduk sebelah barat tidak mengalaminya. Mengapa hal tersebut dapat terjadi? Jelaskan. 7. Gambar di bawah ini memperlihatkan contoh saling ketergantungan yang terjadi pada organisme perairan. Sepanjang hari, organisme-organisme tersebut memberi atau memanfaatkan (a) atau (b) seperti dalam gambar. Apakah gambar (a) dan (b) diatas dapat mewakili saling ketergantungan organisme?

Jelaskan. • 53. Pencemaran Lingkungan Istilah-istilah Penting Pencemaran, Air, Udara, Tanah, Lingkungan, Polutan, Tercemar, Ekosistem, Limbah, Limbah Rumah Tangga, Limbah Industri, dan Limbah Pertanian. Bab 3 Sumber: Biologi, 2010 • 54. 48 Kelas VII SMP/MTs Semester 2 Manusia mempunyai keinginan untuk meningkatkan kesejahte- raan hidup.

Bagaimana caranya? Di antaranya dengan mendirikan pabrik- pabrik yang dapat mengolah hasil alam menjadi bahan pangan dan sandang. Pesatnya kemajuan teknologi dan in- dustrialisasi berpengaruh terhadap kualitas lingkungan. Munculnya pabrik-pabrik yang menghasilkan asap dan limbah buangan dapat mengakibatkan pencemaran ling- kungan. Gambardibawahinimenunjukkanbeberapahalyangterjadidilingkungan kita.

Gambaran tentang apakah itu? Coba pikirkan. Sumber: Biologi, 2010 Ayo Amati Terjadinya perubahan lingkungan akan memengaruhi keberadaan atau kelangsungan makhluk hidup yang ada di dalamnya. Makhluk hidup pada suatu lingkungan selalu tergantung antara satu dengan yang lain. Oleh karena itu, apabila ada salah satu komponen yang berubah, maka akan menyebabkan perubahan pada makhluk hidup lain yang tidak mampu beradaptasi dengan perubahan yang terjadi.

Coba perhatikan kedua gambar berikut. Ayo Kita Pelajari • Pencemaran air • Pencemaran udara • Pencemaran tanah Mengapa Penting? • Untuk mengetahui dan menjelaskan jenis-jenis pencemaran, sumber pencemar, dampaknya dan juga bagaimana cara mengatasi atau mengurangi pencemaran.

• 55. 49Ilmu Pengetahuan Alam Sumber: Depdiknas, 2009 Gambar 3.1 Daun yang jatuh ke sungai Sumber: Depdiknas, 2009 Gambar 3.2 Seseorang yang membuang sampah ke sungai Apa perbedaan dari kedua gambar tersebut? Coba carilah perbedaan mengenai akibat yang ditimbulkan dari dua kejadian tersebut. Pada Gambar 3.1, beberapa daun jatuh dari pohon ke sungai.

Daun-daun tersebut akan terbawa air sungai dan tidak menyebabkan bau dan air tetap jernih. Akan tetapi, pada Gambar 3.2 sampah-sampah yang dibuang ke sungai akan menghambat arus sungai dan dapat menyebabkan bau yang tidak sedap dan menyebabkan air menjadi keruh. Hal ini akan memengaruhi kehidupan makhluk hidup yang berada di sungai. A. Definisi Pencemaran Berikan contoh lain mengenai tergang- gunya keseimbangan lingkungan karena aktivitas manusia.

Keinginan manusia untuk meningkat- kan kesejahteraan hidup, akan memaksa- nya mendirikan pabrik-pabrik yang dapat mengolah hasil alam menjadi bahan pangan dan sandang. Dengan pesatnya kemajuan teknologi dan industrialisasi, akan berpengaruh terhadap kualitas ling- kungan. Munculnya pabrik-pabrik yang menghasilkanasapdanlimbahbuangannya mengakibatkan pencemaran lingkungan di sekitarnya.

Sumber: www.wikipedia.org Gambar 3.3 Limbah Pabrik • 56. 50 Kelas VII SMP/MTs Semester 2 Pencemaran lingkungan merupakan satu dari beberapa faktor yang dapat memengaruhi kualitas lingkungan. Pen- cemaran lingkungan ( ) merupakan segala sesuatu baik berupa bahan-bahan fisika maupun kimia yang dapat mengganggu keseimbangan ekosistem.

Menurut UU RI Nomor 23 Tahun 1997, pencemaran lingkungan adalah masuknya atau dimasukkannya makhluk hidup, zat, energi, dan/atau komponen lain ke dalam lingkungan hidup oleh kegiatan manusia sehingga kualitasnya turun sampai ke tingkat tertentu yang menyebabkan lingkungan hidup tidak dapat berfungsi sesuai dengan peruntukannya.

Jadi, pencemaran lingkungan terjadi akibat dari kumpulan kegiatan manusia ( ) dan bukan dari kegiatan perorangan ( ). Selain itu, pencemaran dapat diakibatkan oleh faktor alam, contoh gunung meletus yang menimbulkan abu vulkanik.

Seperti meletusnya Gunung Merapi. Zatyangdapatmencemarilingkungandandapatmengganggukelangsungan hidup makhluk hidup disebut polutan. Polutan ini dapat berupa zat kimia, debu, suara, radiasi, atau panas yang masuk ke dalam lingkungan.

Kapan suatu zat dapat dikatakan sebagai polutan? 1) kadarnya melebihi batas kadar normal atau diambang batas; 2) berada pada waktu yang tidak tepat; 3) berada pada tempat yang tidak semestinya. Manusia tidak dapat mencegah pencemaran lingkungan yang diakibatkan oleh faktor alam. Tetapi manusia, hanya dapat mengendalikan pencemaran yang diakibatkanolehfaktorkegiatannyasendiri.Sepertilimbahrumahtangga,industri, zat-zat kimia berbahaya, tumpahan minyak, asap hasil pembakaran hutan dan minyak bumi serta limbah nuklir.

Untuk memahami tentang pencemaran, pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan kegiatan berikut. Di lingkungan terdapat faktor abiotik dan biotik yang menyusunnya. Keseimbangan lingkungan hanya dapat terwujud apabila ada keselarasan antara faktor abiotik dan faktor biotik Sumber: Encarta Encylpoedia, 2005 Gambar 3.4 Gunung meletus • 57. 51Ilmu Pengetahuan Alam Kegiatan 3.1 Mengetahui tentang pencemaran lingkungan 1.

Siapkanlah air dari selokan depan sekolahmu sebanyak 100 mL, air dari sumur sekolah 100 mL, dan air mineral 100 mL. 2. Siapkan kertas lakmus merah dan kertas lakmus biru sebanyak masing-masing 3 lembar. 3. Siapkan tiga buah gelas kimia berukuran 250 mL, dan berikanlah label pada gelas masing–masing dengan tabel A, B, dan C. 4. Masukkan air selokan ke dalam gelas kimia berlabel A, air sumur ke dalam gelas kimia berlabel B, dan air mineral pada gelas berlabel C.

5. Periksalah keasaman dari masing-masing air dengan menggunakan kertas lakmus merah dan kertas lakmus biru. Amati warna kertas lakmus sebelum dimasukkan dan sesudah dimasukkan pada gelas kimia. Diskusikan hasilnya dengan temanmu dalam kelompok. Ayo Kita Lakukan B.

Pencemaran Air Dalam kehidupan sehari-hari, makhluk hidup selalu membutuhkan air, termasuk manusia. Kita sangat membutuhkan air bersih untuk berbagai kegiatan, antara lain minum, mandi, mencuci, memasak, dan sebagainya. Salah satu ciri air bersih adalah tidak tercemar. Bagaimana air dikatakan tercemar? Air dikatakan tercemar apabila air itusudahberubah,baikwarna,bau,maupun rasanya.

Sesuai dengan hasil kegiatanmu, air yang tercemar memiliki keasaman yang berbeda dengan air yang tidak tercemar. Pencemaran air, yaitu masuknya makhluk hidup, zat, energi atau komponen lain ke dalam air. Akibatnya, kualitas air turun sampai ke tingkat tertentu yang menyebabkan air tidak berfungsi lagi sesuai dengan peruntukannya. Sumber: Geografi SMP, 2005 Gambar 3.5 Mencari air bersih • 58. 52 Kelas VII SMP/MTs Semester 2 Pencemaran air merupakan kondisi air yang menyimpang dari sifat-sifat air dari keadaan normal.

Kualitas air menentukan kehidupan di perairan laut ataupun sungai. Apabila perairan tercemar, maka keseimbangan ekosistem di dalamnya juga akan terganggu. Air dapat tercemar oleh komponen-komponen anorganik, di antaranya berbagai logam berat yang berbahaya.

Komponen-komponen logam berat ini berasal dari kegiatan industri. Kegiatan industri yang melibatkan penggunaan logam berat, antara lain industri tekstil, pelapisaan logam, cat/tinta warna, percetakan, bahan agrokimia, dan lain-lain.

Beberapa logam berat ternyata telah mencemari air di negara kita, melebihi batas yang berbahaya bagi kehidup- an (Wisnu,1995). 1. Faktor Penyebab Pencemaran Air Pencemaran air dapat terjadi pada sumber mata air, sumur, sungai, rawa- rawa, danau, dan laut. Bahan pencemaran air dapat berasal dari limbah industri, limbah rumah tangga, dan limbah pertanian. a. Limbah Industri Air limbah industri cenderung mengandung zat berbahaya. Oleh karena itu, kita harus mencegahnya agar tidak membuang air limbah industri ke saluran umum.

Kegiatan industri selain menghasilkan produk utama (bahan jadi), juga menghasilkan produk sampingan yang tidak terpakai, yaitu limbah. Jenis limbah yang berasal dari industri dapat berupa limbah organik yang bau seperti limbah pabrik tekstil atau limbah pabrik kertas. Selain itu, limbah anorganik berupa cairan panas, berbuih dan berwarna, serta mengandung asam belerang, berbau menyengat. Seperti limbah pabrik baja, limbah pabrik emas, limbah pabrik cat, limbah pabrik pupuk organik, limbah pabrik farmasi, dan lain-lain.

Jika limbah industri tersebut dibuang ke saluran air atau sungai, akan menimbulkan pencemaran air dan merusak atau memusnahkan pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan di dalam ekosistem tersebut.

Limbah industri yang berupa logam berat sering dialirkan ke sungai, sehingga sungai menjadi tercemar. Jenis-jenis logam berat adalah raksa, timbal, dan kadmium di mana ketiganya sangat berbahaya bagi manusia apabila mengonsumsinya. Misalnya, pencemaran raksa yang terjadi di Minamata, Jepang. Para nelayan di sekitar teluk Minamata memakan ikan yang tercemar raksa.

Akibatnya, mereka mengalami kerusakan saraf yang disebut penyakit Minamata. Lebih dari delapan puluh orang yang meninggal akibat penyakit ini. • 59. 53Ilmu Pengetahuan Alam b. Limbah Rumah Tangga Coba perhatikan kegiatan yang terjadi di dalam rumah tangga, pasar, perkantoran,rumahmakan,penginapan, dan sebagainya.

Kegiatan-kegiatan di tempat tersebut akan menghasilkan sampah/limbah yang dinamakan limbah rumah tangga. Limbah rumah tangga merupakan limbah yang berasal dari hasil samping kegiatan perumahan. Seperti limbah rumah tangga, pasar, perkantoran, rumah penginapan (hotel), rumah makan, dan puing-puing bahan bangunan serta besi-besi tua bekas mesin-mesin atau kendaraan.

Limbah rumah tangga dapat berasal dari bahan organik, anorganik, maupun bahan berbahaya dan beracun. Limbah organik adalah limbah seperti kulit buah sayuran, sisa makanan, kertas, kayu, daun dan berbagai bahan yang dapat diuraikan oleh mikroorganisme. Limbah yang berasal dari bahan anorganik, antara lain besi, aluminium, plastik, kaca, kaleng bekas cat, dan minyak wangi. Di perairan, sampah mengalami proses penguraian oleh mikroorganisme.

Akibat penguraian tersebut, kandungan oksigen dalam perairan juga menurun. Menurunnya kandungan oksigen dalam perairan akan merugikan kehidupan biota di dalamnya. c. Limbah Pertanian Air limbah pertanian sebenarnya ti- dak menimbulkan dampak negatif pada lingkungan. Namun dengan digunakannya fertilizer sebagai pestisida yang kadang- kadang dilakukan secara berlebihan, sering menimbulkan dampak negatif pada keseimbangan ekosistem air.

Pada sektor pertanian juga dapat terjadi pencemaran air. Terutama akibat dari penggunaan pupuk dan bahan kimia pertanian tertentu, seperti insektisida dan herbisida. Sumber: Biologi, 2010 Gambar 3.6 Sampah rumah tangga Sumber: www.wikipedia.org Gambar 3.7 • 60. 54 Kelas VII SMP/MTs Semester 2 Limbah bahan berbahaya dan beracun, antara lain timbul akibat adanya kegiatan pertanian.

Kegiatan pertanian biasanya menggunakan obat-obatan pembasmi hama penyakit seperti pestisida, misalnya insektisida. Selain itu, kegiatan pertanian menggunakan pupuk, misalnya urea.

Penggunaan pupuk yang berlebihan juga dapat menyebabkan suburnya ekosistem di perairan kolam, sungai,waduk,ataudanau.Pupukyangtidakterserapketumbuhanakanterbuang menuju perairan.

Akibatnya, terjadi atau tumbuh suburnya ganggang di atas permukaan air. Tanaman ganggang ini dapat menutupi seluruh permukaan air, sehingga mengurangi kadar sinar matahari yang masuk ke dalam perairan tersebut. Akibatnya, proses fotosintesis terganggu dan kadar oksigen yang terlarut dalam air menurun sehingga merugikan makhluk hidup lain yang berada di dalamnya. 2. Dampak Pencemaran Air Air limbah yang tidak dikelola dengan baik akan menimbulkan dampak yang tidak menguntungkan bagi lingkungan, seperti hal-hal berikut.

a. Penurunan Kualitas Lingkungan Pembuangan bahan tercemar secara langsung ke dalam perairan dapat menyebabkan terjadinya pencemaran pada perairan tersebut. Misalnya, pembuangan limbah organik dapat menyebabkan peningkatan mikroorganisme atau kesuburan tanaman air, sehingga menghambat masuknya cahaya matahari ke dalam air.

Hal ini pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan berkurangnya kandungan oksigen terlarut dalam air, sehingga mengganggu keseimbangan ekosistem di dalamnya. b. Gangguan Kesehatan Air limbah yang tidak dikelola dengan baik akan menimbulkan berbagai penyakit.Tidak menutup kemungkinan di dalam air limbah tersebut mengandung virus dan bakteri yang menyebabkan penyakit. Air limbah juga bisa digunakan sebagai sarang nyamuk dan lalat yang dapat membawa (vektor) penyakit tertentu.

Berikut dijabarkan beberapa penyakit yang disebabkan oleh pencemaran air. Tabel 3.1 Hasil pengamatan lingkungan. No. Penyebab Penyakit 1. Virus - Rota virus - Virus hepatitis A - Virus poliomyelitis Diare pada anak Hepatitis A Poliomyelitis • 61. 55Ilmu Pengetahuan Alam No. Penyebab Penyakit 2. Bakteri Kolera Diare atau disentri Tifus abdominale Paratifus Disentri 3. Protozoa Disentri amoeba Balantidiasis Giardiasis 4. Metazoa Ascariasis Clonorchiasis Dyphylobothriasis Taeniasis Schistosomiasis Sumber : Kesehatan Lingkungan, 2005 c.

Pemekatan Hayati Coba kamu pikirkan apabila suatu perairan tercemar oleh bahan beracun. Bahan beracun itu dapat meresap ke dalam tubuh alga, atau mikroorganisme lainnya. Selanjutnya, hewan-hewan kecil (zooplankton) akan memakan alga tersebut, kemudian zooplankton akan dimakan oleh ikan ikan kecil dan ikan besar akan memakan ikan yang kecil. Apabila ikan-ikan besar tersebut ditangkap oleh manusia dan dimakan, maka bahan beracun tersebut akan masuk ke dalam tubuh manusia.

Zooplankton yang makan alga tidak hanya satu, tetapi banyak sel alga. Dengandemikian,zooplanktontersebutsudahmengandungbahanberacunyang banyak. Demikian juga halnya dengan ikan kecil yang memakan zooplankton, dan ikan besar akan memakan ikan kecil tidak hanya satu. Makin banyak memakan ikan-ikan kecil, maka makin banyak bahan pencemar yang masuk ke tubuh ikan besar.

Bagaimana dengan tubuh manusia jika sering makan ikan yang beracun tersebut? d. Mengganggu Pemandangan Kadang-kadang air limbah mengandung polutan yang tidak mengganggu kesehatan dan ekosistem, tetapi mengganggu pemandangan kota. Meskipun air yang tercemar tidak menimbulkan bau, perubahan warna air mengganggu pandangan mata kita. Hal ini tentu mengganggu kenyamanan dan keasrian kota. • 62. 56 Kelas VII SMP/MTs Semester 2 e. Mempercepat Proses Kerusakan Benda Adasebagianairlimbahyangmengandungzatyangdapatdiubaholehbakteri menjadi gas yang dapat merusak seperti H2 S.

Gas ini dapat mempercepat proses perkaratan pada besi. Agar terhindar dari hal-hal di atas, sebaiknya sebelum dibuang, air limbah harus diolah terlebih dahulu dan memenuhi ketentuan Baku Mutu Air Limbah. Kegiatan 3.2 Mengetahui dampak pencemaran air 1. Siapkanlah tiga buah gelas bekas air mineral yang ukurannya sama (200 mL). 2. Berilah label pada masing-masing gelas dengan menuliskan A, B, dan C.

3. Isilah masing-masing gelas dengan air mineral sebanyak 150 mL (mengukur air dengan menggunakan gelas ukur). Kalau tidak ada gelas ukur, isilah dengan jumlah yang sama banyak. 4. Siapkanlah tiga ekor ikan kecil sejenis yang ukuran besarnya sama (kamu dapat menggunakan ikan kecil apapun yang ukurannya sama yang ada di daerahmu).

5. Siapkanlah detergen dan sendok kecil atau untuk lebih detail kamu dapat menggunakan timbangan digital untuk mengukur jumlah detergennya. 6. Ambillah satu sendok kecil detergen, lalu masukkan ke dalam gelas B. 7. Lakukanlah hal yang sama dengan ukuran dua kalinya (dua sendok kecil) detergen dan masukkan ke dalam gelas C.

8. Gelas A tidak ditambahkan detergen. 9. Setelah semuanya siap, ambillah ikan kecil yang kamu siapkan, dan masukkan ke dalam gelas masing-masing satu ekor. 10. Amatilah apa yang terjadi pada ikan (kondisi) pada periode waktu tertentu.

Catatlah semua hasil pengamatanmu. Laporkan hasil kegiatanmu. Presentasikan di depan kelas. Ayo Kita Lakukan • 63. 57Ilmu Pengetahuan Alam 3.

Cara Penanggulangan Pencemaran Air Pengolahan limbah bertujuan untuk menetralkan air dari bahan-bahan tersuspensi dan terapung, menguraikan bahan (yakni bahan organik yang dapat terurai oleh aktivitas makhluk hidup), meminimalkan bakteri patogen, serta memerhatikan estetika dan lingkungan.

Pengolahan air limbah dapat dilakukan sebagai berikut (Sulistyorini, 2009). a. Pembuatan Kolam Stabilisasi Dalam kolam stabilisasi, air limbah diolah secara alamiah untuk menetralisasi zat-zat pencemar sebelum air limbah dialirkan ke sungai. Kolam stabilisasi yang umum digunakan adalah kolamkolam (pengolahan air limbah yang tercemar bahan organik pekat), dan kolam (pemusnahan mikroorganisme patogen). Kolam ini dapat digunakan oleh semua kalangan karena mudah memilikinya dan murah harganya.

b. IPAL (Instalasi Pengolahan Air Limbah) Pengolahan air limbah ini menggunakan alat-alat khusus. Pengolahan ini dilakukan melalui tiga tahapan, yaitu (pengolahan pertama), (pengolahan kedua), dan (pengolahan lanjutan).

merupakan pengolahan pertama yang bertujuan untuk memisahkan zat padat dan zat cair dengan menggunakan filter (saringan) dan bak sedimentasi. merupakan pengolahan kedua yang bertujuan untuk mengoagulasikan, menghilangkan koloid, dan menstabilisasikan zat organik dalam limbah.

merupakan lanjutan dari pengolahan kedua, yaitu penghilangan nutrisi atau unsur hara, khususnya nitrat dan fosfat, serta penambahan klor untuk memusnahkan mikroorganisme patogen.

Sumber: Kesehatan Lingkungan, 2005 Gambar 3.8. Instalasi pengolahan air limbah • 64. 58 Kelas VII SMP/MTs Semester 2 c.

Pengelolaan Excreta banyak terkandung dalam air limbah rumah tangga. banyak mengandung bakteri patogen penyebab penyakit. Jika tidak dikelola dengan baik, dapat menimbulkan berbagai penyakit.

Pengelolaan dapat dilakukan dengan menampung dan mengolahnya pada jamban atau yangadadisekitartempattinggal,dialirkanketempatpengelolaan,ataudilakukan secara kolektif. Untuk mencegah meresapnya air limbah ke sumur atau resapan air, jamban yang dibuat harus sehat.

Syaratnya, tidak mengotori permukaan tanah, permukaan air dan air tanah di sekitarnya, tidak menimbulkan bau, sederhana, jauh dari jangkauan serangga (lalat, nyamuk, atau kecoa), murah, dan diterima oleh pemakainya. Pengelolaan dalam dapat diolah secara anaerobik menjadi biogas yang dapat dimanfaatkan sebagai sumber gas untuk rumah tangga.

Selain itu, pengelolaan dengan tepat akan menjauhkan kita dari penyakit bawaan air. Dalam meminimalisasi sampah hasil limbah rumah tangga khususnya, dapat dilakukan upaya pengurangan sampah. Hal ini sebagaimana disebutkan oleh Kistinnah (2009) bahwa cara menangani limbah cair dan padat diharapkan tidak menyebabkan polusi dengan prinsip ekologi yang dikenal dengan istilah 4R, yaitu,dan.

1) Recycle (Pendaurulangan) Proses misalnya untuk sampah yang dapat terurai dijadikan kompos. Kompos ini dipadukan dengan pemeliharaan cacing tanah, sehingga dapat diperoleh hasil yang baik. Cacing tanah dapat menyuburkan tanah dan kompos digunakan untuk pupuk.

2) Reuse (Penggunaan Ulang) Proses dilakukan untuk sampah yang tidak dapat terurai dan dapat dimanfaatkan ulang. Misalnya botol bekas sirop dapat digunakan lagi untuk menyimpan air minum. 3) Reduce adalah melakukan pengurangan bahan/penghematan. Contoh- nya jika akan berbelanja ke pasar atau supermarket, sebaiknya dari rumah membawa tas.

Janganlah meminta tas plastik dari toko atau supermarket kalau akhirnya hanya dibuang saja. • 65. 59Ilmu Pengetahuan Alam 4) Repair artinya melakukan pemeliharaan.

Contohnya membuang sampah tidak sembarangan, terutama tidak membuang sampah di perairan. Pencemaran air sudah sangat memprihatinkan, sehingga membu- tuhkan peran serta semua pihak untuk mengatasi dan mengurangi pencemaran tersebut. Coba pikirkanlah.

Bagaimana kamu membantu mengatasi dan mengurangi pencemaran air? Ayo Pikirkan C. Pencemaran Udara Udara adalah salah satu faktor abiotik yang memengaruhi kehidupan komponen (makhluk hidup).

Udara mengandung senyawa-senyawa dalam bentuk gas, di antaranya mengandung gas yang amat penting bagi kehidupan, yaitu oksigen.

Dalam atmosfer bumi terkandung sekitar 20% oksigen yang dibutuhkan oleh seluruh makhluk hidup yang ada di dalamnya. Oksigen berperan dalam pembakaran senyawa karbohidrat di dalam tubuh organisme melalui pernapasan.

pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan

Reaksi pembakaran tidak hanya terjadi di dalam tubuh, namun kita pun sering melakukannya, seperti pembakaran sampah atau lainnya. Hasil samping dari pembakaran adalah senyawa karbon (CO2 dan CO) yang akan dibuang ke udara. Meningkatnya populasi makhluk hidup, maka proses pembakaran pun semakin meningkat. Dengan demikian, konsentrasi senyawa karbondiudarameningkat.Karbondioksidaamatpentingbagiprosespembuatan makanan (fotosintesis) bagi tumbuhan.

Dengan demikian, peningkatan senyawa karbon di udara dapat teratasi. Namun, dengan meningkatnya populasi manusia menyebabkan kebutuhan akan tempat tinggal meningkat.

Hal ini membuat pembukaan ladang atau hutan untuk pemenuhan permintaan tempat tinggal Sumber: www.pestaola.gr Gambar 3.9. Polusi udara dari asap pabrik • 66.

60 Kelas VII SMP/MTs Semester 2 ini. Belum lagi kasus (penebangan liar) yang membuat populasi tumbuhan berkurang. Padahal hasil dari pembentukan makanan melalui fotosintesis menghasilkan oksigen yang sangat dibutuhkan oleh makhluk hidup.

Dengan demikian mulai terjadi kasus tentang pencemaran udara. Pencemaran udara didefinisikan sebagai suatu kondisi dimana udara mengandung senyawa- senyawa kimia atau substansi fisik maupun biologi dalam jumlah yang memberikan dampak buruk bagi kesehatan manusia, hewan, ataupun tumbuhan, serta merusak keindahan alam serta kenyamanan, atau merusak barang-barang perkakas ( ).

1. Macam-macam Pencemaran Udara a. Pencemaran Udara Primer Pencemaranudarainidisebabkanlangsungdarisumberpencemar.Contohnya peningkatan kadar karbon dioksida yang disebabkan oleh aktivitas pembakaran oleh manusia.

b. Pencemaran Udara Sekunder Berbeda dengan pencemaran udara primer, pencemaran udara sekunder terjadi disebabkan oleh reaksi antara substansi-substansi pencemar udara primer yang terjadi di atmosfer. Misalnya, pembentukan ozon yang terjadi dari reaksi kimia partikel-partikel yang mengandung oksigen di udara. 2. Faktor Penyebab Pencemaran Udara Beberapa kegiatan baik dari alam ataupun manusia menghasilkan senyawa- senyawa gas yang membuat udara tercemar.

Berikut ini adalah penyebab pencemaran udara. a. Aktivitas Alam Aktivitas alam dapat menimbulkan pencemaran udara di atmosfer. Kotoran- kotoran yang dihasilkan oleh hewan ternak mengandung senyawa metana yang dapat meningkatkan suhu bumi dan akibatnya terjadi pemanasan global. Proses yang serupa terjadi pada siklus nitrogen di atmosfer. • 67. 61Ilmu Pengetahuan Alam Selain itu, bencana alam seperti meletusnya gunung berapi dapat menghasil- kan abu vulkanik yang mencemari udara sekitar yang berbahaya bagi kesehatan manusia dan tanaman.

Kebakaran hutan yang terjadi akan menghasilkan karbon dioksida dalam jumlah banyak yang dapat mencemari udara dan berbahaya bagi kesehatan hewan dan manusia.

b. Aktivitas manusia Kegiatan-kegiatan manusia kini kian tak terkendali, kemajuan industri dan tek- nologi membawa sisi negatif bagi lingkungan. Mengapa? Karena tidak ditangani dengan baik. Berikut ini merupakan pencemaran yang diakibatkan oleh aktivitas manusia. 1) Pembakaran sampah. 2) Asap-asap industri. 3) Asap kendaraan. 4) Asap rokok. 5) Senyawa-kimia buangan seperti CFC, dan lain-lain. 3. Dampak Pencemaran Udara Pencemaran udara mengakibatkan kerugian bagi banyak organisme peng- huni bumi.

Dampak yang ditimbulkan dari pencemaran udara antara lain bagi kesehatan, tumbuhan, efek rumah kaca, dan rusaknya lapisan ozon. a. Kesehatan Terbuktibahwakualitasudarayangmenurunakibatpencemaranmenimbulkan berbagai penyakit. ISPA (infeksi saluran pernapasan) adalah salah satunya. Saluran pernapasan merupakan gerbang masuknya udara ke dalam tubuh. Udara yang kotor membawa senyawa-senyawa yang tidak baik bagi kesehatan. Tentu saja, pengendapan-pengendapan logam yang terlarut pada udara dapat mengendap di paru-paru dan dapat menimbulkan iritasi.

Akibat yang lebih serius dari polusi udara adalah emfisema, yaitu gejala kesulitan pengangkutan oksigen. Kadar karbon monoksida yang terlalu banyak di udara (lebih banyak dari oksigen) dapat menghambat pengikatan oksigen di dalam tubuh. Oleh karena itu tubuh akan kekurangan oksigen, sehingga sesak napas, terjadi pusing, dan berlanjut pada kematian apabila tidak ditangani dengan baik.

• 68. 62 Kelas VII SMP/MTs Semester 2 b. Bagi Tumbuhan Abu vulkanik dari meletusnya gunung berapi membuat udara tercemar dan memicu terpicunya hujan asam.

Hujan asam mengandung senyawa sulfur yang bersifat asam. Kondisi asam ini dapat mematikan tanaman setempat. Oleh karena itu kita sering menemui begitu banyak tanaman dan pohon yang rusak akibat hujan asam atau abu vulkanik. c. Efek Rumah Kaca Konsentrasi karbon dioksida dan karbon monoksida yang tinggi di atmosfer akan memicu terjadinya efek rumah kaca, yakni peningkatan suhu bumi. CO dan CO2 akan membentuk semacam lapisan yang akan menahan panas bumi keluar, sehingga panas yang ditimbulkan bumi akan terkungkung di dalam pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan pada rumah kaca.

d. Rusaknya Lapisan Ozon CFC merupakan senyawa yang sering digunakan dalam produk-produk pendingin (AC) dan aerosol. Ketika CFC terurai di atmosfer, maka akan memicu reaksi dengan oksigen penyusun ozon. Dengan demikian, ozon akan terurai yang menyebabkan lapisan ozon berlubang. Padahal lapisan ozon berfung- si sebagai pelindung Bumi dari panas yang dipancarkan oleh Matahari. Sinar UV yang dihasilkan oleh Matahari dapat memicu kanker, dengan adanya ozon, masuknya sinar UV ini akan diredam sehingga dampak yang ditimbulkan lebih sedikit.

Sayangnya, pemanasan global yang kini terjadi salah satunya diakibatkan oleh rusaknya lapisan ozon. Pada saat ini CFC untuk pendingin dan aerosol telah diganti dengan bahan lain yang ramah lingkungan. D. Pencemaran Tanah Ketika suatu zat berbahaya atau ber- acun telah mencemari permukaan tanah, maka pasti dapat menguap, tersapu air hujan, dan atau masuk ke dalam tanah. Pencemaran yang masuk ke dalam tanah kemudian mengendap sebagai zat kimia Sumber: http//pencemarantanah.com Gambar 7.

Contoh pencemaran tanah • 69. 63Ilmu Pengetahuan Alam beracun di tanah. Zat beracun di tanah tersebut dapat berdampak langsung pada kehidupan manusia, ketika bersentuhan atau dapat mencemari air tanah dan udara di atasnya. Jadi, dapat disimpulkan bahwa pencemaran tanah adalah suatu keadaan dimana bahan kimia buatan manusia masuk dan mengubah lingkungantanahalami.Pencemaraninibiasanyaterjadikarenakebocoran limbah cair atau bahan kimia industri atau fasilitas komersial; penggunaan pestisida; masuknya air permukaan tanah tercemar ke dalam lapisan subpermukaan; kecelakaan kendaraan pengangkut minyak, zat kimia, atau limbah; air limbah dari tempat penimbunan sampah serta limbah industri yang langsung dibuang ke tanah secara tidak memenuhi syarat ( ).

1. Faktor Penyebab Pencemaran Tanah Tidak jauh berbeda dengaa pencemaran air dan udara, pencemaran tanah juga banyak sekali penyebabnya.

Penyebab tersebut di antaranya limbah do- mestik, limbah industri, dan limbah pertanian. a. Limbah Domestik Limbah domestik dapat berasal dari daerah seperti pemukiman penduduk (pedagang, tempat usaha, hotel dan lain-lain); kelembagaan (kantor-kantor pemerintahan dan swasta); serta tempat-tempat wisata. Limbah domestik tersebut dapat berupa limbah padat dan cair. Adapun perbedaan limbah padat dan cair, yaitu sebagai berikut.

Limbah padat dapat berupa senyawa anorganik yang tidak dapat dimusnahkan atau diurai- kan oleh mikroorganisme. Seperti plastik, serat, keramik, kaleng-ka- leng dan bekas bahan bangunan yang menyebabkan tanah menjadi kurang subur.

Limbah cair dapat berupa tinja (feses), detergen, oli, cat. Jika meresap kedalam tanah akan merusak kandungan air tanah bahkan dapat membunuh mikro- organisme di dalam tanah. • 70. 64 Kelas VII SMP/MTs Semester 2 Kedua limbah tersebut (padat dan cair) mempunyai dampak buruk bagi tanah, hingga akhirnya dapat mengganggu kelangsungan hidup makhluk hidup tanpa kecuali kehidupan manusia itu sendiri.

Apalagi untuk limbah padat yang merupakan bahan pencemar yang akan tetap utuh hingga 300 tahun yang akan datang. Bungkus plastik yang dibuang ke lingkungan akan tetap ada dan mungkin akan ditemukan oleh anak cucu kita setelah ratusan tahun kemudian. Sampah anorganik tidak .Haliniyangmenyebabkanlapisantanah tidak dapat ditembus oleh akar tanaman dan tidak tembus air, sehingga peresapan air dan mineral yang dapat menyuburkan tanah hilang dan jumlah mikroorganisme di dalam tanahpun akan berkurang.

Akibatnya, tanaman sulit tumbuh bahkan akan mati karena tidak memperoleh makanan untuk tumbuh dan berkembang. b. Limbah Industri Limbah Industri berasal dari sisa-sisa produksi industri. Limbah industri juga dapat dibedakan menjadi dua macam, yaitu limbah padat dan limbah cair. Limbah industri berupa limbah padat yang merupakan hasil bu- angan industri berupa padatan, lumpur, dan bubur yang berasal dari proses pengolahan.

Misalnya sisa pengolahan pabrik gula,kertas, rayon,serta pengawetan buah, ikan, daging, dan lain-lain. Limbah industri berupa limbah cair yang merupakan hasil peng- olahan dalam suatu proses produksi.

Misalnya sisa-sisa pengolahan indus- tri pelapisan logam dan industri ki- mia lainnya. Tembaga, timbal, perak, khrom, arsen, dan boron adalah zat-zat yang dihasilkan dari proses industri pelapisan logam seperti Hg, Zn, Pb, dan Cd dapat mencemari tanah. Sumber: Buku Mari Belajar IPA Gambar 3.11. Sampah menumpuk merupakan pencemaran daratan • 71. 65Ilmu Pengetahuan Alam Hg, Zn, Pb, dan Cd merupakan zat yang sangat beracun terhadap mikro- organisme.

Jika meresap ke dalam tanah akan mengakibatkan kematian bagi mikroorganisme yang memiliki fungsi sangat penting terhadap kesuburan tanah. c. Limbah Pertanian Indonesia dikenal sebagai negara agraris yang sebagian besar penduduknya bermatapencarian sebagai petani. Akan tetapi, karena ketidaktahuan, tidak sedikit petani yang menggunakan pupuk sintetik melebihi ketentuan, atau caranya tidak tepat.

Akibatnya, limbah pertanian yang berupa sisa-sisa pupuk sintetik untuk menyuburkan tanah atau tanaman tanah tercemar. Misalnya, pupuk urea dan pestisida untuk pemberantas hama tanaman. Penggunaan pupuk yang terus menerus dalam pertanian akan merusak struktur tanah. Akibatnya, kesuburan tanah berkurang dan tidak dapat ditanami jenis tanaman tertentu karena hara tanah semakin berkurang.

Penggunaan pestisida bukan saja mematikan hama tanaman, tetapi juga mikroorganisme yang berguna di dalam tanah. Padahal kesuburan tanah tergantung pada jumlah organisme di dalamnya.

Selain itu, penggunaan pestisida yang terus menerus akan mengakibatkan hama tanaman kebal terhadap pestisida tersebut 2. Dampak Pencemaran Tanah Semua pencemaran pasti akan merugikan makhluk hidup terutama manusia. Dampak pencemaran tanah terhadap kesehatan tergantung pada tipe polutan, jalur masuk ke dalam tubuh, dan kerentanan populasi yang terkena.

Contohnya saja kromium berbagai macam pestisida dan herbisida merupakan bahan karsinogenik untuk semua populasi. Timbal sangat berbahaya pada anak-anak, karena dapat menyebabkan kerusakan otak, serta kerusakan ginjal pada seluruh populasi. Raksa dan siklodiena dapat menyebabkan kerusakan ginjal, beberapa bahkan tidak dapat diobati. PCB dan siklodiena akan mengakibatkan kerusakan pada hati ditandai seperti keracunan. Organofosfat dan karmabat dapat menyebabkan gangguan pada saraf otot.

Berbagai pelarut yang mengandung klorin merangsang perubahan pada hati dan ginjal serta penurunan sistem saraf pusat. Ada beberapa macam dampak kesehatan yang tampak seperti sakit kepala, pusing, letih, iritasi mata, dan ruam kulit untuk paparan kimia yang telah disebutkan di atas. Pada dosis yang besar, pencemaran tanah dapat menyebabkan kematian.

• 72. 66 Kelas VII SMP/MTs Semester 2 Selain kesehatan manusia yang terganggu, pencemaran tanah juga dapat memberikan dampak terhadap ekosistem. Perubahan kimiawi tanah yang radikal dapat timbul dari adanya bahan kimia beracun dan berbahaya bahkan pada dosis yang rendah sekalipun.

Perubahan ini dapat menyebabkan perubahan metabolisme dari mikroorganisme endemik dan Arthropoda yang hidup di lingkungan tanah tersebut. Akibatnya, perubahan ini dapat memusnahkan beberapa spesies primer dari rantai makanan, dapat memberi akibat yang besar terhadap predator atau tingkatan lain dari rantai makanan tersebut. Bahkan jika efek kimia pada bentuk kehidupan tersebut rendah, maka bagian bawah piramida makanan dapat menelan bahan kimia asing yang lama-kelamaan akan terkonsentrasi pada makhluk-makhluk penghuni piramida atas.

Banyak dari efek-efek ini terlihat pada saat ini, seperti konsentrasi DDT pada burung menyebabkan rapuhnya cangkang telur, meningkatnya tingkat kematian anakan, dan kemungkinan hilangnya spesies tersebut. Dampak pada pertanian terutama perubahan metabolisme tanaman yang pada akhirnya dapat menyebabkan penurunan hasil pertanian. Hal ini dapat menyebabkan dampak lanjutan pada konservasi tanaman di mana tanaman tidak mampu menahan lapisan tanah dari erosi. Beberapa bahan pencemar ini memiliki waktu paruh yang panjang dan pada kasus lain bahan-bahan kimia derivatif akan terbentuk dari bahan pencemar tanah utama.

3. Cara Penanggulangan Pencemaran Tanah Berikut ini ada dua cara utama yang dapat dilakukan apabila tanah sudah tercemar, yaitu dan. Remediasi Remediasi adalah kegiatan untuk membersihkan permukaan tanah yang tercemar. Ada dua jenis remediasi tanah, yaitu in-situ (atau ) dan ex- situ (atau ). • 73. 67Ilmu Pengetahuan Alam Pembersihan adalah pembersihan di lokasi.

Pembersihan ini lebih murah dan lebih mudah. Pembersihan ini terdiri atas (injeksi), dan. Pembersihan meliputi penggalian tanah yang tercemar dan kemudian dibawa ke daerah yang aman. Setelah itu di daerah aman, tanah tersebut dibersihkan dari zat pencemar. Caranya adalah, tanah tersebut disimpan di bak atau tanki yang kedap, kemudian zat pembersih dipompakan ke bak/tangki tersebut.

Selanjutnya, zat pencemar dipompakan keluar dari bak yang kemudian diolah dengan instalasi pengolah air limbah. Pembersihan ini jauh lebih mahal dan rumit.

adalah proses pembersihan pencemaran tanah dengan menggunakan mikroorganisme (jamur, bakteri). Bioremediasi bertujuan untuk memecah atau mendegradasi zat pencemar menjadi bahan yang kurang beracun atau tidak beracun (karbon dioksida dan air). Salahsatumikroorganismeyangberfungsisebagaibioremediasiadalahjamur. Jamur vam dapat berperan langsung maupun tidak langsung dalam remediasi tanah. Jamur tersebut dapat berperan langsung karena kemampuannya menyerap unsur logam dari dalam tanah.

Jamur tersebut tidakdapatberperanlangsungkarenamenstimulirpertumbuhanmikroorganisme bioremediasi lain, seperti bakteri tertentu, jamur, dan sebagainya.

• 74. Pemanasan Global Bab 4 Istilah-istilah Penting Efek Rumah Kaca, Perubahan Iklim, Pemanasan Global, Atmosfer Sumber: • 75. 69Ilmu Pengetahuan Alam Pernahkah kamu mengamati perubahan musim yang terjadi akhir-akhir ini? Dalam pelajaran IPS, kamu ketahui bahwa bulan Mei hingga September di Indonesia berlangsung musim kemarau dan bulan Oktober hingga April berlangsung musim penghujan. Akan tetapi, beberapa tahun terakhir ini, perubahan musim di negara kita tidak dapat diprediksi lagi, terkadang bulan Mei di Indonesia masih turun hujan dan di bulan November di Indonesia masih berlangsung musim kemarau.

Adapun yang lebih menakjubkan lagi peristiwa tersebut tidak dapat diprediksikannya musim ini tidak hanya terjadi di Indonesia saja, akan tetapi terjadi juga di negara-negara lain di dunia. Pernahkah kalian mendengar berita turunnya salju di Arab? Berita munculnya Matahari, ketika musim salju diTiongkok?

Mengapa hal ini dapat terjadi? Apakah yang akan terjadi pada Bumi kita? Ternyata, peristiwa tersebut berkaitan erat dengan perubahan iklim di dunia. Perubahan iklim tersebut terjadi karena adanya perubahan lingkungan. Tidak dapat dipungkiri lagi bahwa perubahan lingkungan terjadi sebagai akibat dari aktivitas manusia.

Maha Besar Tuhan yang telah menciptakan alam dengan keseimbangannya. Oleh karena itu, marilah belajar dengan sungguh-sungguh serta berusaha untuk melestarikan alam sebagai wujud ketakwaan kepada Tuhan Yang Maha Esa agar kelak menjadi manusia yang pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan dan peduli terhadap semua ciptaan Tuhan.

Mengamati Perhatikan Gambar 4.1 yang terdapat di halaman 70. Menanya AdakahperbedaansuhudarikeduaGambar4.1padahalaman70tersebut? Menalar Apa yang dapat kamu simpulkan dari gambar tersebut?

Untuk lebih jelas, mari lakukan kegiatan berikut. Untuk memahami hal tersebut di atas, buatlah pemodelan tentang efek rumah kaca. Ayo Amati • 76. 70 Kelas VII SMP/MTs Semester 2 Pemodelan Efek Rumah Kaca 1. Buatlah kelompok kerja bersama temanmu sebanyak 4 orang siswa.

2. Siapkanlah alat dan bahan sebagai berikut. Alat dan Bahan Jumlah Stoples kaca 2 buah Termometer 2 buah Handuk yang direndam dengan air hangat selama 3 menit 2 buah Stopwatch 1 buah Plastik secukupnya Karet gelang secukupnya Peringatan Hati-hati ketika memegang termometer. Apabila termometer patah atau pecah, jangan menyentuhnya.

Mintalah gurumu untuk menanganinya. 3. Lakukan langkah-langkah berikut. a. Siapkan alat dan bahan yang diperlukan. b. Berikan label pada ma- sing-masing stoples, ya- itu A dan B. c. Masukkan handuk yang telah direndam dengan air hangat selama 3 menit ke stoples A dan stoples B.

d. Masukkan termometer ke dalam kedua stoples tersebut. (Pastikan temperatur awal pada termometer adalah sama). e. Tutuplah stoples A dengan plastik, kemudian ikat dengan karet gelang hingga rapat. f. Letakkan stoples A dan stoples B di bawah sinar Matahari atau lampu. Sumber: Buku Mari Belajar IPA Gambar 4.1. Pemodelan efek rumah kaca • 77.

71Ilmu Pengetahuan Alam g. Pastikan bahwa kedua stoples tersebut menerima energi panas yang sama. h. Catatlah suhu pada kedua stoples setiap 3 menit sekali, selama 15 menit. i. Buatlah tabel seperti Tabel 4.1. Masukkan hasil pengamatanmu. Kerjakan di buku tugasmu. j. Setelah 15 menit, jauhkan kedua stoples tersebut dari energi panas dan amati apa yang terjadi.

Tabel 4.1 Hasil pengamatan pemodelan efek rumah kaca No. Waktu (menit) Temperatur (o C) Stoples A Stoples B 1. 3 2. 6 3. 9 4. 12 5. 15 4. Dari data yang diperoleh buatlah grafik hubungan waktu dan suhu pada stoples A dan stoples B. Suhu (o C) Waktu (menit) 5. Gunakanlah pensil warna yang berbeda untuk menggambar diagram garis pada kedua hasil pengamatan (stoples A dan stoples B).
Filsafat ilmu merupakan ‘induk’ dari ilmu pengetahuan yang mendasari logika, bahasa, dan matematika.

Filsafat ilmu merupakan mata kuliah yang wajib bagi program Magister dan Doktor. Bagi mahasiswa program sarjana, filsafat ilmu diperlukan agar memiliki wawasan mendasar mengenai ilmu pengetahuan.

Buku ini disusun dengan pertimbangan menjadi bahan bacaan untuk mahasiswa program sarjana. Dengan demikian, kedalaman materi lebih sederhana dan disesuaikan dengan perkembangan wawasan mahasiswa. Struktur penyajian disesuaiakan dengan pertemuan perkuliahan mahasiswa sehingga diperoleh bagian isi dari buku ini diantaranya (1) Sejarah Filsafat; (2) Sumber Ilmu Pengetahuan; (3) Filsafat, Ilmu, dan Pengetahuan; (4) Perkembangan Ilmu; (5) Kebenaran dan Sikap Ilmiah; (6) Sarana Ilmiah; (7) Kajian Bidang-Bidang Filsafat; (8) Ilmu, Teknologi, dan Seni; (9) Ilmu dan Strategi Insani.

Menulis adalah melukiskan suatu yang ada dalam pikiran atau membuat memori menjadi kenyataan dan sebagian mengatakan mengaksarakan pikiran dan logika dalam media. Makna sederhana tentang menulis adalah menyampaikan ide dalam suatu platform baik melalui kertas atau media digital.

Tulisan adalah ibarat symbol masa lampau tentang peradaban manusia, mengejawantahkan persembahan manusia tentang pemahaman suatu zaman atau sebuah katalis dari peradaban manusia. Berangkat pada makna di atas, maka setiap menulis adalah karya yang harus disusun atas landasan perencanaan dan penyusunan yang matang, agar memberi pencerahan yang baik pada suatu topik ulasan. Penyusunan tersebut tentunya memiliki filosofi tersendiri yang berbeda dengan yang lain.

Tulisan berjudul “Filsafat Ilmu di Era Milenial” sudah sangat banyak dan tersebar luas di banyak kalangan, meskipun demikian, buku ini tetap mempunyai nilai filosofis dengan makna berbeda dengan karya sejenis sebagai torehan pemikiran yang berbeda minimal pada aspek ruang dan waktu.

Buku ini terdiri atas 9 Bab, yakni: Bab I Filsafat dalam Ontologi, Epistemologi dan Aksiologi; Bab II Filsafat Konvensional dan Filsafat Modern di Abad Kemajuan IPTek; Bab III Filsafat Zaman Yunani; Bab IV Konsep Filsafat Pendidikan Kebangsaan Cokroaminoto; Bab V Manusia dan Perkembangan Ilmu Pengetahuan; Bab VI Filsafat dan Holisme; Bab VII Idealisme Filsafat terhadap Metode Kualitatif dan Kuantitatif; Bab VIII Irisan Filsafat terhadap Logika dan Silogisme; Bab IX Filsafat di Era Generasi Milenial.

Pilihan materi dalam setiap Bab yang disajikan merupakan topik-topik yang dipandang sebagai bagian yang berperan dalam merunut kembali perkembangan ilmu pengetahuan dulu dan kini. Buku ini berusaha untuk menyambungkan kembali alur pengetahuan yang dianggap renggang akibat munculnya era globalisasi yang dibarengi dengan model kehidupan yang rumit dimasa lampau dan kehidupan era milenial kini .

kajian aksiologi terdiri dari dua bidang, yaitu terobjek pada kajian etika dan estetika. Etika membahas mengenai persoalan nilai moral perilaku manusia, sedangkan estetika membahas mengenai nilai keindahan yang terkandung dalam sesuatu (Suaedi, 2016). Dalam diskursus aksiologis memandang adopsi artificial intelligence di Indonesia, aksiologi memberikan penalaran bahwa artificial inteligence pada prinsipnya tidak memiliki nilai kegunaan in se (dalam dirinya).

. This research was conducted on the basis of research references from Microsoft Indonesia regarding the adoption of artificial intelligence in Indonesia which obtained research results that there were 14% of employees and leaders of technology-based companies in Indonesia who were still skeptical of the adoption of artificial intelligence.

This study aims to provide a theoretical overview from the pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan of view of the philosophy of communication science in responding to considerations about the good and bad 'doubt' or skepticism of 14% of employees and company leaders towards the adoption of the Artificial Intelligence platform by Microsoft companies in Indonesia.

This study uses a qualitative method using a literature study approach. The reference books in the form of books that are the primary sources in this research are books entitled Aristotle Physic Book VIII and the book Philosophy of Communication Studies: Introduction to Ontology, Epistemology, Axiology. The results show that from the point of view of the philosophy of science, the essence of AI is a tool or means as well as a machine that is created with components that resemble and play a role as if the mind is capable of creating or creating like humans.

AI is made human as a co-creator which in principle remains limited and will never be perfect 'in se' so it is appropriate that a tone of skepticism accompanies it. . The discovery of the concept of knowledge independently was enhanced through inquiry activities. Investigation activities can be found in science learning including using discovery learning models [8]. Discovery learning is a learning model recommended by the 2013 curriculum to be applied in developing students' critical thinking skills [9], because students themselves try to find their own concepts through scientific methods, not through being given information or understanding concepts directly by the teacher.

. Critical thinking skills have become the competencies of educational goals. This article aims to examine the potential of discovery learning models that are applied in science learning to empower students’ critical thinking skills. The method used is qualitative with the main source of literature review about discovery learning models and critical thinking skills.

Pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan results of the analysis of the discovery learning model literature with orientation, hypothesis generation, hypothesis testing, conclusion, and regulation stages.

Discovery learning model has the potential to empower critical thinking skills starting from the hypothesis generation stage which aims to provide a rational argument from a real phenomenon orientation phase which is continued by the process of interpretation, analyzing, evaluating, concluding the experimental results of the hypothesis testing stage until the right conclusion is obtained from the experimental results.

ABSTRAK Perkembangan dunia industri sudah di ambang pintu masuk ke era Industri 4.0. Kondisi tersebut tidak terlepas dari perkembangan keilmuan teknik industri yang pesat. Melalui studi literatur, tulisan ini bertujuan melihat dari sudut pandang filsafat ilmu mengenai bagaimana kemunculan Industri 4.0 dikaitkan dengan perkembangan keilmuan teknik industri, apa tantangan yang dihadapi serta bagaimana seharusnya arah perkembangan ilmu teknik industri.

Hasil studi ini menunjukkan bahwa dalam perkembangannya, ilmu teknik industri bersinergi dengan sains dan ilmu kerekayasaan yang lain sehingga membawa pengaruh bagi dunia industri hingga berevolusi sampai pada munculnya gagasan Industri 4.0. Gagasan tersebut membawa konsep penggabungan teknologi digital dan internet dengan industri konvensional yang pada akhirnya bertujuan meningkatkan produktivitas, efisiensi dan layanan konsumen secara signifikan.

Namun di samping itu, ada pula konsekuensi yang harus dihadapi terkait dampak negatif Industri 4.0 termasuk di dalamnya dampak terhadap keilmuan teknik industri.

Di sinilah muncul berbagai tantangan bagi keilmuan teknik industri. Ada banyak peran yang dapat dilakukan keilmuan teknik industri menghadapi tantangan kemunculan Industri 4.0. Peran yang utama adalah fokus mengkaji interaksi manusia dengan berbagai komponen lainnya dalam sistem terintegrasi di industri.

Selain itu, juga disarankan ada penyesuaian dan upgrade kurikulum ilmu teknik industri agar keilmuan teknik industri siap menghadapi perubahan yang terjadi dan lulusannya tetap dapat dibutuhkan di dunia industri. Kata kunci: filsafat ilmu, industri 4.0, teknik industri 1.

Pendahuluan Industri 4.0 merupakan istilah yang relatif baru dan mungkin masih belum banyak diketahui dan dipahami oleh khalayak di bidang industri. Menurut pendapat Menteri Perindustrian dan Perdagangan (Kabinet Kerja) Airlangga Hartarto dikutip dari Glienmourinsie (2016), Industri 4.0 menjadikan proses produksi berjalan dengan internet sebagai penopang utama.

Semua obyek dilengkapi perangkat teknologi yang dibantu sensor dan mampu berkomunikasi sendiri dengan sistem teknologi informasi.

Roser (2015) menyampaikan pendapatnya bahwa tanda kemunculan Industri 4.0 dimulai di Hannover, Jerman, saat diadakan Hannover Messe/Fair (merupakan sebuah pertemuan skala internasional dalam bidang industri dan otomasi) di tahun 2011. Pada pertemuan tersebut, pemerintah Jerman mengumumkan kepada publik akan menggelontorkan dana sebesar 400 juta euro untuk penelitian dan pengembangan Industri 4.0. Ada yang berpendapat (yang nanti akan dijelaskan lebih detail) bahwa kemunculan Industri 4.0 ini akan membawa dampak yang besar pada bidang industri, ekonomi bahkan kondisi sosial masyarakat secara global.

Jika melihat pada penjelasan mengenai Industri 4.0 yang erat kaitannya dengan proses produksi, maka kehadirannya tidak terlepas dari pengaruh keilmuan teknik industri. Keilmuan teknik industri sejak era revolusi industri berkembang pesat sampai ke zaman modern. Lingkup kajiannya yang semula sempit menjadi semakin luas. Kondisi itu memunculkan pertanyaan apakah perkembangan ilmu teknik industri memiliki keterkaitan dengan munculnya fenomena Industri 4.0? Dan apa pengaruh fenomena Industri 4.0 terhadap keilmuan teknik industri?

Dalam metode active learning setiap materi pelajaran yang baru harus dikaitkan dengan berbagai pengetahuan dan pengalaman yang ada sebelumnya. Materi pelajaran yang baru disediakan secara aktif dengan pengetahuan yang sudah ada. Agar murid dapat belajar secara aktif guru perlu menciptakan strategi yang tepat guna sedemikian rupa, sehingga peserta didik mempunyai motivasi yang tinggi untuk . [Show full abstract] belajar. Bahan ajar yang dipergunakan dalam model pembelajaran aktif berbasis bahan ajar pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan disesuaikan sesuai dengan kebutuhan sedemikian hingga anak didik yang mempergunakan bahan ajar tersebut terpacu untuk belajar aktif.

penerapan desain pembelajaran aktif berbasis bahan ajar supaya memperhatikan struktur bahan ajar yang mendukung dan menciptakan cara untuk membuat mahasiswa aktif melalui bahan ajar yang sudah dipersiapkan tersebut. View full-text Latar Belakang: Pendidikan merupakan kegiatan universal dalam kehidupan manusia. Pendidikan di dunia ini sangatlah penting dimanapun dan kapan pun, karena adanya pendidikan dapat mengembangkan potensi yang ada pada setiap manusia, oleh karena itu di Indonesia ada program wajib belajar 9 tahun, agar setiap warga negara Indonesia mendapatkan pendidikan yang layak agar potensi yang dimilikinya dapat .

[Show full abstract] dikembangkan. Salah satu budaya di antara beragam suku dan budaya Indonesia adalah suku Tanimbar yang terletak di Kabupaten Kepulauan Tanimbar yang terdiri dari gugusan kepulauan dan memiliki ragam budaya yang bervariasi. Budaya yang dimaksud berupa budaya duan lolat, monumen perahu, cerita rakyat, ritual adat, rumah adat, benda-benda adat, kesenian, peralatan seni, pakaian adat, kehidupan sosial.

Salah satu yang dapat menjembatani antar budaya, matematika dan pembelajaran matematika adalah merupakan etnomatematika. Tujuan: Untuk mengetahui aspek-aspek matematika pada rumah adat desa lorulun. Metode pengumpulan data yaitu wawancara dan dokumentasi. Metode: Penelitian ini merupakan penelitian kualitatif deskriptif karena berorientasi pada fakta atau fenomena.

Hasil: Pada rumah adat Desa Lorulun terdapat 4 (empat)fungsi yaitu sebagai tempat tinggal seorang mangafwayak (pemerintah/orang kaya), tempat musyawarah tua-tua adat, tempat menyimpan segala dokumen atau harta, sebagai tempat berdoa secara adat. Selain fungsi yang ada, ternyata terdapat juga aspek-aspek matematika berupa bangun datar dan bangun ruang diantaranya adalah segitiga, persegi, persegi panjang, balok, lingkaran, tabung (silinder), geometri elip tunggal, kerucut, elips, parabola, dan hiperbola.

Hal ini menunjukan bahwa adat istiadat Desa tetap dilestarikan dan dipegang teguh oleh seluruh warga Desa. Terdapat 4 (empat) fungsi rumah adat yaitu Kesimpulan: terdapat aspek-aspek matematika pada rumah adat desa lorulun yaitu pada bagian-bagian pada rumah adat dan benda-benda yang ada pada rumah adat yaitu Tutuk (Batu tumbuk siri dan pinang), mel-mel (batu adat), lololi (alat tumbuk siri dan pinang), kosoro (piring), sedangkan materinya adalah sebagai berikut segitiga, persegi, balok, lingkaran, tabung, geometri eliptik tunggal.

Read more Tujuan penelitian ini adalah untuk menghasilkan suatu desain pembelajaran yang efektif untuk memfasilitasi proses pembelajaran matematika akselerasi di tingkat Sekolah Dasar. Desain pembelajaran ini dibuat berdasarkan hasil analisis kebutuhan terhadap kompetensi matematika yang seharusnya dimiliki oleh lulusan SD program akselerasi sebagai kompetensi awal untuk melanjutkan pelajaran matematika di .

[Show full abstract] jenjang berikutnya dan karakteristik awal peserta didik agar sesuai dengan desain pembelajaran yang diberikan. Prosedur penelitian diadaptasi dari model pengembangan instruksional M. Atwi Suparman yang terdiri dari beberapa langkah, yaitu: (1) mengidentifikasi kebutuhan dan menulis tujuan instruksional umum, (2) melakukan analisis instruksional, (3) mengidentifikasi perilaku dan karakteristik awal peserta didik, (4) menulis tujuan instruksional khusus, (5) menyusun alat penilaian hasil belajar, (6) menyusun strategi instruksional, (7) mengembangkan bahan instruksional, (8) melaksanakan evaluasi formatif.

Temuan penelitian yaitu dihasilkan suatu desain pembelajaran yang komprehensif sesuai dengan tujuan pembelajaran matematika peserta didik SD program akselerasi. View full-text Latar belakang dan tujuan: Program keluarga berencana (KB) saat ini telah mulai mengedepankan pentingnya peran suami sebagai akseptor vasektomi. Kecamatan Wanasaba Kabupaten Lombok Timur adalah salah satu daerah dengan jumlah akseptor laki-laki yang tinggi.

Fenomena ini perlu dipahami secara lebih mendalam sebagai dasar penyusunan strategi peningkatan penerimaan kontrasepsi vasektomi secara lebih . [Show full abstract] luas di daerah lainnya. Penelitian ini bertujuan untuk memahami secara mendalam faktor yang berperan pada penerimaan kontrasepsi vasektomi di Kecamatan Wanasaba Kabupaten Lombok Timur.Metode: Penelitian ini menggunakan rancangan kualitatif.

Pengumpulan data dilakukan melalui wawancara mendalam pada 20 orang partisipan yaitu lima pasang suami-istri akseptor vasektomi dan lima pasang suami-istri non-akseptor vasektomi. Data dianalisa dengan menggunakan analisis tematik.Hasil: Penelitian menunjukkan bahwa keputusan untuk menerima vasektomi dilakukan secara cepat dan diambil secara sukarela tanpa ada tekanan atau paksaan dari petugas atau orang lain.

Faktor utama yang berkaitan dengan penerimaan vasektomi adalah tersedianya layanan cepat dan gratis yang difasilitasi oleh petugas PLKB dan kader, selain karena alasan ekonomi seperti penggunaan KB hormonal membutuhkan biaya yang mahal serta memiliki anak yang banyak.

Faktor pendorong lainnya dalam penerimaan vasektomi adalah adanya peran dari istri yang mendukung suami dan penerimaan masyarakat yang cukup baik.Simpulan: Peran ketersediaan layanan, tenaga kesehatan dan kader sangat besar dalam memberikan informasi, memberikan motivasi dan memfasilitasi penggunaan vasektomi.

Diperlukan peningkatan kapasitas kader, PLKB dan motivator KB agar jumlah akseptor vasektomi semakin meningkat Read more Telah dilakukan analisis kekritisan Lead-Cooled Fast Reactor (LFR) menggunakan program SRAC.

Reaktor ini menggunakan Pb-Bi sebagai pendingin. Analisis kekritisan LFR dilakukan dengan menvariasikan jenis bahan bakar yaitu uranium-plutonium nitrida (UN-PuN) dan uranium-zirkonium (U-Zr). Parameter neutronik yang dianalisis adalah faktor multiplikasi neutron (keff). Pada penelitian ini digunakan . [Show full abstract] metode shuffling.

Metode shuffling digunakan agar reaktor dapat beroperasi tanpa pengayaan dan menggunakan uranium alam sebagai bahan bakar. Teras reaktor dibagi menjadi 11 region arah radial. Sepuluh region pertama digunakan untuk menempatkan bahan bakar dan region ke-11 sebagai reflektor. Pada awal operasi reaktor, masing-masing region diisi dengan bahan bakar uranium alam yang telah di burn up terlebih dahulu.

Setelah 10 tahun pembakaran, hasil burn up pada region 1 di shuffling ke region 2, hasil burn up region ke-2 di shuffling pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan region 3, begitu seterusnya sampai hasil burn up region ke-9 di shuffling ke region 10 dan hasil burn up region ke-10 dikeluarkan dari teras reaktor sehingga region 1 dapat diisi dengan bahan bakar baru dan begitu seterusnya sampai 100 tahun operasi reaktor.

Hasil yang diperoleh menunjukkan bahwa bahan bakar UN-PuN lebih optimal dibandingkan bahan bakar U-Zr. Hal ini ditunjukkan oleh nilai keff yang diperoleh pada bahan bakar UN-PuN lebih tinggi dibandingkan U-Zr untuk fraksi bahan bakar yang sama.Kata kunci : keff, LFR, SRAC, UN-PuN, U-Zr, strategi shuffing.

View full-text Semester 2 USTPMTePkras Geografi Hj. Rusly Musa Hjh. Nurashikin Abdullah KERTAS SOALAN PEPERIKSAAN TAHUN-TAHUN LEPAS STPM EKSKLUSIF SISIPAN SAMPEL SOALAN SEBENAR STPM 2015 – 2020 CIRI-CIRI UNIK DALAM BUKU INI Susunan teks dalam bentuk poin Nota dalam bentuk poin menjadikan bahan teks mudah difahami dan memudahkan ulang kaji.

Info Ilmu tmLmdmSMypFdaeueaaamoaeenadnrlmmnkkahgkbugdlmuaalabuatauhtsnhnomtipmSaeaalStaearWknnToaTtuhtnptPosmbkPyoeipMlekaabdlMeaeron.nihkkn.aggleptmipuinenembalglai2aaal2jnj2taa32rr418192021 15 dMssoeabkalaakomglnuagmtiaebnakatskh.t2aaa12nmn0d1b9u1a8n2hg42aa3n2n2SINTSPPeohMneUaaHkamTllmoaam2uyknneSnr0aseeamngfToen1y6napikgramaPage9ejka(eakennhnbkMktnnpmodiklo:eoegk)akjstenaat:Sarnkenaspeee(eBkmdmowfl2kuykpudrnponouiaiaaaaen0r.aaakejmaaalraanlninrCkckkb1aandtsgbjndtigiSeaaaaainne9jkaaaeegasicnsr6llrgnum)oaLejhrinyakadbaa(gankaah.nrabneamaalniusekaieonmnrhlm,a)mpLrhananpjmnaykugamatamennajteafeelsaehlfaayaoEarrtagnaankkadaehkuiu,aknCndnGdkaunmtgimoCnitsrtirjOaatgniaroontirulanaWaodoaaalbopnakalT,lrgnlstoarhmaonasnued:pEsea/bmmpahgsgrtp/-CnxmbelieTaawiaakisa3H,rebdrtnh/iuankwktc.iSa4nltta4ahnOwwedStui6nntaetaMe.na5eseaiu6-mncObnutbopr.-6mauSiAankeadllkAktK-kec-lea7ebeCPeEali.KhlPeunokuroctyraEjrbmrgoaEoekneiakAgnsCdaenpila(ayCa8na/s(tagnaroakedmn(tuaabgk9.-m)cmrrtan(n,ha)aiieS)daAyvmtaiaamSsMcie)nA1Mstaekionsa-MPmitmeera0hin(a1nydieaPMd(hnEgaeis.ann(ea1.nbaeuyniE(yy)nictlCmPbkndg)eaaaiap)aemeCduenuge)hnlSnMerbrbaaiTsClragdnuaeagi1Bgrbeb(aujkerelTm(adinekareaudmo2liaae(ba1nnmsbtendma(la)indjcagiaknronu(sak3gtudr)adviipS(la)teyaunea1stpnlyaoNaalkfes)jaPibusala)kaagpkekge)4MigtenahniaketKMnukl(eai1nnslaieloi-eMrkdktictuieaMTgdammskusnk5akrdaemprleouMtseWaaimemsreaansgueganaaanagiektaernnunrbusmicennhlyaieninnu,ndddnnntgaeeraeMpaodegahaanamuaanaPgaknianangsirgmpkmmaglnpatepanrenbkkmknndAnaapaenen(gaggaapaetunrknabregefaeoacjggaincutukie(asgjlgligrruPaokapugsorenrumsrnotaEadankakaknpnonrcukjmeanasngrair-nEpawnnkmnl-salesaugCutmiduuaiurldbonarnauikbdroueikta-naaCgntsgkikhtmnaakmspnpaalahOukkmnoammunnnoeaksEaec(esuinuablpath-dreanhNgdirl,agskenhyusTprraaCehiAp.sipiaptarnjiig(ampcaa)ana,nsaprjtuhakGupM•F•sdktEpnenaaAFOAa-annpPnaineyaattkrmeeegriaesingbgopcoCaearmOlArgekosaEaPKsPhknnTtalPddnraaapics.elenuekntkeiirebentaejcHeinyrEsosdC)kPiiivaoEdmErsutreeinmndymmuma(iablpbeugieudkkrdailairrnuEakCrp)snuvtdCh-oaCnrasaoestkreumiuaaeiaafanbaktfnd-eeiaonrhimtkenadCylhrenelarmnHilnngsrpSniahmodaa.urnaktitabunnttablgaaaaritdiaeteyauraTgedartgpukeatjrsashana-nnepguksoauooakarspanbnannikaadPeeaisenakbntr(gnjguotadhraenjdpjecgrinsknglruibrrkinMuieukukktilsbldaaiaummudtmsh(aad)rbaakugmgiuiekpaenraascnalnhcaapaktltusenaenearacamatasiyaennteutcrgiroetnuetdgarypakunkildutbl-)lanaimiupsdbaprlaplleunngoi.epaaemdokagnskeidetyaprpraikearepdbdangaplnnooabanrnohamnisaseaiinlnnmeksrnaaiagnugysnmlhenaoefreydnlchphogiktyaenunlouaatecnmsaabmsuaaauaaaessjdimuAonebsagnarrebariktsetunsknemksinluratuenknai)mi-ncpn.eakpaaPeaAetlgoyutknsmbktapooaergr-daamepsuEanesdenPembankPamepmdrgnarpeneekk)ptuedmCsernpabsreEhopr.iekrpebaoriapaoapnan:ghseejs.atrerdCnietanadjnaij)atarberdolatjetneirgunndicdainug.yaatnliatjukbpkAguhktuadrgaiea.arbagaunaaeuaikjlakkanyknamaP.taauardatdnyndsnoyaanaandntEmnacasitaaaaignla((((nynauE(genAenpaannCpdecfpn.gckgagkrkadn)kyacga))ai)Pogt.pkeaanksanaoaakndtmanwEidnmeprojinkMdpuSBTam.hidnpgadica.dpC.npanobienaeaeaiisneaeaanniaalnteenmpnrekHs.ultlrnansrgketntdtautalgabdadareuehkakiy.aiapfiekklataddacgsgahannsdasalelinesnswaukaorisailahalidarg.aainaaainiantnaatdtninenasrrnakanujkr)ksnaaiaiknkgata2nket,eiedndskpiaodaandrairappanmeaiajnnsiaP1canBmnnnaaeHinknaninT-kautsde.sdmpangamteaaneayaptadnapnDtaanaelretclmegbauuaaeihciannggkmhdrannaakklhnaidsaeaianlmannkgdbska.yaplraka(ikpaiiaaawaacemc6unatbedenbedtrhBe)ab(drniaegakiaarpebmaraalla(eroenjtsjonasPtarni)Cnadaanaubmeralgnjdeennk)legesdapnahmgknombggiiIouAaibm(hyarisetipmuasankougcmkaaPtipapunarpusr5Pntupti)Ktitbnnaamsaooeakaeoua(ar-,piaEinigpdasnbienjlhrnhnas(rylePdpseeaPsalaaikng)aAaaCnenydnauakcmeasuahrtnn1d)neoukblgaauyadondeacns;nHain0aFrsaesdaiunudaicpajgmai(tnipKuSiasaendlrghaaadA,vsajanrnasa(jaetesatkaeagii,nlaal)runeebci4tPaguampkanc(rOars.enat.gdalNar)tehoabiatiiannrakaaumiiamsSepkennhnaiAgonrn(ultn)syrniePias(nrerPaauegnidgkasmaiatjgiPnAa1buew,unPsfiehr)nelgusPnaearganlg(nkbi9aesebebbplsmkEearuPaneclnkmncpbpoaemoigiriinso83aeZieuPmkmnba)t(snnEatC.tlsedeetyeetpbaplrrp2baiiakeearebeoameaIuslersMlbsnaahaCeupheuer(bdkea))pnHaraaatmnenPaenhamnirnlglugaan,arklmeanbrnuioatlrnpaeirsermaaedgutgu)anegaaaeaamNeabanoajbjunruekbesrtedskgluhdbalsranghrnbnhganaisneyjnuuauirrjmukemksidenoiailPfaknagauaseaaduntaaihall.laugsaaakkkmganeidurndelatildnaeaplntomnnr,nbpiilnhrenmseaaahkapromaaeteankiamakiragaiegntgabeaidhmmmau,hnnsueenrgnkorrapbdandurunabmpnlnakegAayakipaiplnuilstaouotdanruanalkbtpenasosahtr-eneiastaauAaeioaurthbtmnmuuParbhrneeemaheanpadimlalinnanslemmwnsijibulauegarsegkIamnPmEaedrnpjneaanebngniaagnbunhapdtnrrpsnbmgsa.muiaaknb1pEaaypCbkiyandaa,uodtimsehaaiemosrdarujd3neeaarnaimltadBnp,tapagaentuldPutoihanrhauaaosrParnyree.aunar.wies,endeaatdnadmntedsAsmneemasbcakkanmueat,illtngaljtai.lieZkyeamgnaaiaeunnnbptmraankhabmpnpcAtenpasetskreApiaplkbrgEardg.oabaaaeeeoteuimuutuyeskmbmaanaaauegahtPaldlitnnurlEPkmtlleindnsediamnfowaaitnrarerioogbaEbdarbbEakoim,bcagaaumonntgnupdyaagndtpkaageiaaoauCehrdndknnleaClgdcirmanenaanniaeoeaerjaspaolmtrk.aaoe,aougulaaknnriben.rasngttdlargabAntvsuaSltapaReliennlantehigenaaelkaoinejkiiyabn.nseasrkhdaiy,dgwaausrkrs,nkra&gssamtgnaratierksaniaiianaatligaguanasrsnisAaanaakaarRspianasporknnonDuiiansnaetne,imtihdgitetrueluePS,si&pikikldeiigel,gokdd,rkadnbaaimkgvbakppaiuagaaatkaaekaageniadDndarakgaeuaueiksee,atmnrarkotabnkptienngnigaaprinikstarnuarbPir,dsondfpawua,atdyebkinautuagrairkaeakn.noaluatrddrkajaaeaeprswaaasrnaaeotndgpoyimkmaignakrnpekiuainnnnnlr(sauramafnnnagrJataieAsgikoeiggopakMahnnnep.nkdkambtkniegaaveunnePepgiameginuanumt.uinlnarnaBrnteenurdyIeakkae,aajtAanlapoTglsasntneabaabaagmeamuakpinauuevgansnI.jnnsubnualspleuclbsNramaaauaimggg,uurririauaniaamsthnnuaaiaaasdmm)-imbbnsniecdtndhh.anbnpaPaakaeneugmabi-uyPeoaebnrhyldrrrakejrataeonnagalsaoreaauaasauneesnrmnejegdualhjbinhmntneehbusfgprgruaiaogikabtauaatsemeynkraulheramagsuuernmitailnRanpgitaeanaebndgniagnaanalnaeibigdaegapaghbinlunagialnnhanHdehaiangsigmlaltylkaamitakipaodbdiaaalhmmumlaataaai.rakaarpikmrgaauaaneieaattpphnnrApirerpikjeasdyelahePmdTleedarumkksbulnditknEaeJeabreuoasneaaugo,knmmCuuagjjgngkesumunuuslgnetgaaakeseannenkoiduanretemaibJuyeratutAelinmigrpuiynuuaknsoahompnbmAta,eeletkaaiudgniIuyngikPabmtgkdsnenejdmnaoauyieundEiaemaeaeratsglganppalaaaCieianrretanogmesklngainaanabenodrmnigmkdaapygbMgnltmtlo,eAgIakiglortiaagaaasnlSueaplnelkaondtaennannaareolybkeefokiygoalbktuyasmgonhtaaoairkmtnaanikaoaanhatslmgrkey.orakopmtn.ienlsIAsneaalkielnulTulbeleissiegounloeaPmabkemaoraaypsremmtgagsEdrakilsmanmseludanudCaiimaaanaeirnisaadrgiayghtrggiayaapiaanaa.wnaal-tkalnandearumethagghatjn-uiaanyasjenurdarkagaanridnaaganr.agBAB BAB BAB BAB BAB BAB BAB BAB BAB BAB BAB BAB BAB BAB BAB • Pembalakan yang tak lembap yang menyebabkan pembentukan hutan sekunder.

terkawal 4 Pembinaan infrastruktur Kerjasama Serantau • Aktiviti pertanian pindah (a) Penyahhutanan juga berpunca daripada aktiviti pembinaan • Pembukaan tanah infrastruktur dan Segi Tiga seperti lebuh raya, kabel elektrik, saluran paip, dan lain-lain.

Hasil Pembelajaran baharu untuk pertanian Pertumbuhan 465 Menyatakan perkara ladang oleh kerajaan 16 • Pembinaan infrastruktur (b) Walaupun skala kemusnahan tidak terlalu luas tetapi tetap memberikan kesan dan pembangunan bandar buruk terhadap kepelbagaian biologi hutan semula jadi. BAB Kesan-kesan Penyahhutanan terhadap Alam Sekitar Fizikal yang perlu dikuasai Hasil Pembelajaran 1 Kesan terhadap kepelbagaian biologi oleh pelajar.

(a) Ancaman kepupusan biodiversiti 17 Menjelaskan impak (i) Penyahhutanan menyebabkan spesies fauna dan flora diancam kepupusan. Penanda soalan pembangunan ekonomi (ii) Dianggarkan lebih daripada satu juta spesies haiwan dan serangga lenyap STPM tahun lepas BAB terhadap alam sekitar pada tahun 2000 di dunia.

Menunjukkan (i) Kemerosotan dan (iii) Di Malaysia, terdapat beberapa spesies hidupan liar dan tumbuh- bahawa kandungan tumbuhan yang diancam kepupusan. teks pernah disoal kepupusan sumber (iv) Contoh hidupan liar yang diancam kepupusan seperti harimau malaya, dalam peperiksaan (ii) Kemerosotan suhu badak sumatra, harimau dahan, dan orang utan. STPM. (v) Contoh tumbuhan yang terancam pula seperti cengal, kempas, dan setempat, hakisan, tualang.

Input STPM tanah runtuh dan (b) Kemusnahan habitat (tempat tinggal) Poin penting yang tanah tandus. (i) Hutan berfungsi sebagai habitat utama kepada haiwan untuk membentuk perlu ada dalam lingkungan dan meneruskan generasi. BAB STPM 2016 S5(b) (ii) Proses penyahhutanan memusnahkan sama sekali habitat hidupan liar. Kemusnahan habitat mengambil masa yang lama untuk dipulihkan. INPUT STPM (2016) (iii) Apabila habitat musnah, haiwan melakukan penghijrahan untuk mencari habitat baharu dan terpaksa bersaing dengan hidupan lain di habitat BAB5 Soalan 5(b): Huraikan baharu.

kesan pembalakan (iv) Persaingan intra dan interspesies akan berlaku di tempat baharu. Mana- terhadap alam sekitar mana spesies yang kalah akan musnah dan pupus. fizikal di Malaysia. (v) Sebagai contohnya, Unit Gajah di bawah Pusat Konservasi Gajah Kebangsaan telah memindahkan lebih daripada 450 ekor gajah liar ke BAB Huraian: Soalan ini habitat baharu seperti Taman Negara sejak 30 tahun lalu. SAMPEL menghendaki calon (c) Kemusnahan ekosistem hutan BAB (i) Pelbagai spesies fauna dan flora diancam kepupusan dan kemusnahan 6 menghuraikan kesan akibat kehilangan sumber makanan.

pembalakan terhadap (ii) Apabila hutan dimusnahkan, fungsi pokok sebagai pengeluar akan turut alam fizikal di Malaysia. mengalami kemusnahan Calon haruslah menjawab (iii) Hidupan herbivor yang bergantung kepada tumbuh-tumbuhan akan kesan pembalakan kehilangan sumber-sumber makanan. terhadap alam fizikal (iv) Keadaan ini seterusnya akan memusnahkan hidupan yang lain kerana di Malaysia ialah wujud hubungan antara satu organisma dengan satu organisma yang lain perubahan landskap dalam sistem ekologi.

fizikal dan hakisan tanah, gangguan ekologi seperti kemusnahan habitat flora dan fauna, merosakkan kawasan tadahan air, peningkatan suhu setempat ekoran pengurangan peratus kelembapan udara, pencemaran sungai dan banjir lumpur.

318 Sektor Perhutanan jawapan calon STPM. (ii) FORMAT PENTAKSIRAN Format Pentaksiran BAB 1 SSitsrtuekmtuAr,tmKaonsdfeurnagan dan Tenaga dalam Gambaran secara keseluruhan (vi3ii2)NA1sJpeoeiPtSSWekmaSstWdeoAAareusaunaasua.iagkrkjenillcjalaipaaaamaaPhBarsrAanriraaleaeKabnsioJnnrmnnMyn(aeaojTeansPkaltpaanmhaaeBrsmmaabuyneneAnetrialtGtshaskaKaaiamaeSgnigraetnakhdlsarannrhSoe,SrinumhakapultdkaarkogoodGaagkauamayhaskepigeaagatguhaitsndaihdepanerliaalrrirjafaantyoSbiuaeaapgani.neoknnngagefrennnieynmAgekiikrrkkdrafPodmrpNaeaiu3SresSoiaka8emiafmumtba42tanotrusfe•n0inasaaa0•am%iamgraemkaaSi2rnnsmag•alBM(neK•lMhaSlao•aPatSygadneipiMn(eakoiiihaatriBoa9asarnoMaruiBlrkKaWraalealikaatennra4arkhaidigaeenlaaktaie2fhnerlaiana2inraaberl,prknakhtdn5ranajthk/ithnoiuhea2etreaiomaga2fi%b2nalaBea2)gmsnrnadgsgn21a)d(s)sp.pjeeadiirgaPti5rana:aaiab:jlaaunea1hpaDireSuanhtdjnelm.fdeirnsg55aafeatwoiri,induaakiKraauwue0pS,gSamaA(caplegitanh2ynoh%eaSArloericaSasabsmoaeguaikaaaramaJdabaaerookddntliianaarnilnt1esaldleulhk:aaakaa5aaumnhsogkshmhaalAlknisas2nske,narrtnaSaaao9r-euhdeurm5boM:dnb3SnitdnsBuaema4pa.ahmAp%aenae:tuunumka3l2nunrau2araTSnatlmeatajueakae./htndlnobuesta6kiu2rndkapkmaesbaataasrakssets:ytaeiesspgptalgPunea(atsafGaaterntdSSaheieeumiaoehrganSnrauoenecraphr)GndakKnTt3eaSoaakegeaj2ipoausdahseemPsgiloiBrmneeymmattbea–eofiasMareakrpaabnnnainsaagatAlaiirsrenh(haoagamnfiradwiSBkssrFgannaaaanBaoimaeohiSakafmlggknlinzlaaamaaoii3eojaiasreaiankliahtaMlo)kSamabnhndnuMkaa.annamanaees)gajaaannerdS),eunlesmdnlau,seaaitopkiybnaa,tAaeyildSaaeneaajgsiysniluenrrtmrlituaeaualiiamke4gk2asnsjons;•ri0(bienb•gedgMSbskdB2•Spage•MsBroa•aSSePadPhduatnesaleSahoBeoamliMaMafuidttWhlrlaarTapeuiruaitamtnnehakkmaaer)alrelsankPpairg2augnsabahn,lPaljdhnaensMei,ha2iliusibnggebpilaBaai,ubrnjtaa2rpe1mradn2aaannrkmaedgaiaiBnnu:dernd5aaatha1lnigjafSiuutrdkAaejnataa,t5amuakiaoaa(dalnmwtkuhsrwAA:3agklaauumamnsagaanoaapm:kirlapaAlajrrasaSgaarSbacapaehaakablot(unnolniloarlimrhaneaeisa1iaakka5ksarlsa(ulhss,nBoeaalmleaMmalo9sltetaaiacSahk:nprkomjsasn4itnMuaanneoAeihuhiaaat2pSrrusklbmle3lidduludeitaas/uraetaaekbao2faastnaunhnneSd6nmka,resalh)nrascedeaCykduiistbdp,atnu(mtkhhaeaS(tgaieSAaakeaAdoStakhedrteognTcietrnao:mrnaarokiapuias2,–liaaaptjTShtangiFelaerS.ppatlselaeiShagrerinanaieMnrersdtsantSnzdokogngraanmesi2afieesaas.wmuuekMngisknpdkederltopallig)aaaahiaaassaraiestal,elannjlaitaainoalnrlairhdeAhaabhnnkgtatddu61raaainsan)asarilaa6)snennha2yaa,n,nirn):suAa.anatstaananStaBeahkgloa2sisaumna.ehb0nnlgieae1a.mgrn2kSiikaboaaduinuakattalaan:aBntnn: format pentaksiran seperti 1.1 Maksud Atmosfera Subtopik Jadual Populariti Soalan STPM bilangan kertas peperiksaan, 1.2 Struktur Atmosfera jenis soalan, dsb.

2015 2016 Analisis Soalan STPM 2017 2018 Jadual yang menunjukkan pengagihan soalan STPM 2019 2020 tahun-tahun lepas mengikut subtopik. 1.3 Kandungan Atmosfera 1.4 Tenaga di Dalam Sumber Tenaga Sistem Atmosfera: Matahari sebagai 1.1 M A Ketinggian (km) Ketinggian (batu) 6Ras(Ktued6msNb5jkae2apumamoanmerte4kkgambbmstd3eSreimpnfadaealRnsnaemameu2aanuiartAaurgd1jnrudhaanIdhglinuhaapmgasttpd,j)gea,a.kkDmrmtauiu,dsimannaaraAnaemaahdepnaasditg-h-ollnsmaaeptvaekaleylida1aaatasmabepslnAdrhkaii,daabfnnra.dphatimuugd1ueisipirolinemttaadaemtitsamrada.,atersbgbldiranaaepenrt.taaafreuaitaabomadteammtnd,amaymnmmusrism7asi1pokumaaafu.agmn5ikb0eoistitenkpp.uGgasmtmierfkea0sliagaaAeeejnaeni.knapfhnamanlaoorrasmreatargaa.tmrmrtana(dpssgrmksuaaheisuUprakffusaaopartkuunbareeoaatimabdn.sVntnaekkiiaurrbdensapdignraanaamslf)ura(taiaigaeiaadu11snmtadkikrnndui%1knarildaaistdaiegbn)ritpmadhse,iupieairkmsd2dabraao40iutiainrp60irpbb1s80iaa0dank0oddft-0naiaa1neaapr2nurViidkr0idsopoLio appi-Rzoaalg8maoaeakp0dabrn-rhjis8paassaaui0asohstdmstnanaa-a1lrp6ineatD,i.0u1eknu-pwa4dratLarl0mnjeaanaadinbppph-ut4adrgiai(ks0aonsaºuaDaaFaigynn,r0aa)ndearwAndjinau-mkgta2ahmd(etrn0rea7(aakonº4nng8vrCasaT0aTyafa%il)retrkhoeSsdyoirSp-)raM,a0tapabrMtgoanarodnTenhsaupa8etpesafogtims0seadrroonnsmoarupsrimflagipes2sfaaaoo.egatra0usdiekaerunfasaniesmysa.r0iga1assgp2en0eie34a0lk4g0ni0t5s0lin6i0itb(7n0nay2e0graa1rria%1aoadmLda0nmtluaa)Latmes0m,nanam.hw0odytkouaslaiiuskfkrnefiimepmrlarWaeaaemdt:nehliaHkaagMbtnan.aetoenpjstwrunadi:g/lethyu//Pbmauwnetigbaiemkakenin/arbginkeeaunltsamttajriauorksatfeunrrad.

an Praktis STPM 1 Latihan untuk menilai 3Praktis STPM keupayaan dan STPMJa1wa(ba)SoTaalaknrif1kdananmKsaaktEususdRoaatlTmanoAslafeiSBnraas.hamMaga iaaOdnaDASo:[4aAE0llaamLnma2rkSaateahku]itSaoralFainzi3k.al pengetahuan pelajar dalam 1 21BAB (a)(bA) pBaekzaahkaynanmgaKdkaismduaadrkkTsauudkdaakrraantnudkAeadnrigaaanbnaaktdiaikadSKbaoeararttiilunkakgknaerrSaitnnrguaddkeitanubgraatnikk?adar tKuakdaraarnTuakdaiarabnatAikdibaabsaathik.

Basah [3] setiap bab. (b) Bagaimanakah lapisan troposfera berperanan untuk mencorakkan cuaca di permukaan bumi? [3] (c) Bezakan maksud proPsreossesesjSaetajantadnengan pemeluwapan.

Proses Pemeluwapan [3] [4] [3] Soalan Sebenar STPM BAB mempengaruhi proses sejatan. [3] (iii) faktor yang Sisipan soalan sebenar tiga [3] STPM tahun-tahun lepas Kenal pasti pemeluwapan. 3 (d) 2015 – 2020 (i) berlaku dalam proses BAB (ii) yang (iii) (e) Kenal penyejukan pasti tiga cara 4 BAB 1 S((ioJi)igaa)adlruaiGasnlalSidrnieistbbalinaenwgnt.aaanhrgSmTePnMuDnjaurkak3taa6nnJ.0u(jmcummla)lhahsesjeaLjtaaatuSantn3oa79dan0.9i.l5(adcnmar)aEtsaenidGaanrijsu1ml2i03n0°l0°atS°ahSSnsgejatanDdairlaat8u4a95t2n5J.a10.u05n.(0.mc0mmlae)hngsiekjuaLttaakunet1da118un15902d27.(.319u.c.09.mk1a)n (c) Jelaskan bagaimana lapisan atmosfera mengawal suhu di permukaan bumi.

5 [4] BAB (d) Jaeklatisvkiatinmkaensaunsinae. gatif terhadap persekitaran fizikal apabila kandungan atmosfera berubah akibat daripada 6 60° U 33.0 86.0 40° S 20.1 22.4 [4] 50° U 38.1 115.1 50° S 15.5 yang berlaku[1d2i] BAB (a()b4)302B0d1°0B0°e0aU°°rUir°SUndaUTcataPasnManrgdk2ka0aan1nn9jjueamndaul5ama701hl51.00.d2Sfs08a3e0i.k5j.a9attotaarsny, daluni kglaismutgear1mn1a110fmp910e.y25e.n1a.n0gngagirkusuehtsikukeaadidubadarug6ski0eaj°manSteagnnaurdnisijuslikenskteaabnnugja.uhmklaawh asseajnat.an [13] 60 Kelembapan Udara dan Kerpasan Kertas Model STPM Kertas spesimen STPM untuk membiasakan pelajar terhadap format peperiksaan 502 Kertas Model STPM yang sebenarnya.

GLOSARI Glosari JAWAPAN Senarai istilah penting A dalam buku ini dengan BAB 1 5Ad4CAipPi8boAsPutEAeoeoasnEAnCkptbnancGetAtCaenatcgeigutrnlbsnmrrauAloretiikpiniyaenuujasnamsokraAelenyiat.mnnadcaallKkrilmrA.tpareoa-aoolaiMminu,yitiacnAhinae.mlinnpkbManlaAaenmgdrdsaak)ukeduplnm(jrgteeaasluuuygoaengruukasatgmaatApegnaistsarAramsayunlejsKhTysak)kkepiutasaunNaodamgar,aneurpalpsSraAuoumrihjakpatgnariitlikKtistutsuepoeoasbagaajloawEAnluaeihuaupFaAuannakitnkhu1ednvunnumbumstdArsuhrAmaieakagrgaTga8ua,ekaaebbEreimaibmsaslknrnama,dabaeNmkhdpmirlaraA,kfiaa(lkedbitwanlnrkoaeuiisaemulnb.stesnarpobszattuueagbumagatdhnryabuskapuaicursiilneniPdttamskiuukaanatLrkasamktaeayuoainitdarsieohgiKemuklaanuaAdmpngapdmaaaantbenadaakmhdnbntniunitnegkekkanzlbahnumfasag1tlnaaaaiteadfkr,aaarigwatgieae,nteKlnna9yblptddmrptipaearamkwdamopgurgAiv,uakn8mauua,AiluekAotpetnldlaiweablndaanikddeo9saumsspursneameastawderiFrumyilamkuaasainp,)irmnttelnrkuSkgaanneuainhTaaaannrraptanteprAAyamdohauenbgadaenkatdidunsktaogtAPenjananaknpPngakeaealkankaLiadnfabknmaaannghmaweilearsenaatdragslyagiieueatesmaaipkrselnaP,irk,eebaiCniagvnpsraiagnnkipamkadirnanapdfkrtalgeaen(atnailalooaatoaiinainidtlgtfnebabndianpeepnnkglasfsgneunktittsmtngairahah/,eurgaakaegaaaaulkipgr(grbeuctdgaau(hnukrnnkrrke.rapueSuauwraumAugennadkysaubr.n,eulnikhaenndnunr1ipkgiogatnesaasheykdtpnnyealan,)raaiaree9uieaakmanbarrk,aaodrnenadtaarnonsfidmggrinn7khnauoga,naanyarnaneailgpaaegtpac4nitakPdskossiglyrgancuogadeb,olBrrttatooAaasieadmaaga,eaaueanlmaaar,uakmmmlnflntnbanmeanmmtinrnmksuuibaglpegairAtgbdrreigAadoiagninusaaeninueauabfejsuraainanartaiagSgutkmrknynlabunnednrkaknsarki.nytaiddisdgiaaolEatuibsigaa)aarrdnuakuedpadsEiaiAilkiudranorkaralAdybians(daauraaenataaik,epacaofsblpasseaSnnlaauglu,rnainfNprod.eauiemtaeatnkrann)-Esaatstig(gtekmanpgnanmrpagipaauyilFtgttitkanaKAakuaimnrureloaugahata.eakakauToandinegwuanruabmaardsAlliNuiusbledmtblaraaZainprtretidiiiapaeashnaueiaa,samlihshmnies)ic,jhbsaedalrniarksuhueklbeurueaan.kruabeidm,pstarapiybessgaursnlbamgaapujaapanneaeeaandauenaanaaniiatnennerhmrhynkttitarneurdaitirtudunjaiakaagahliinna.atsalusnatkajti,ennakagyanaineaCaiiermfdAmdig,easnnruatart,dgaCnkaauu.Farblswa.drCeeSiada-iotonendanbeeaCuandndtiaEbssksaenCrbuaranusgadlesiouedhalaAugnBgaakstgahaca(nidlnarkniatsiksicaKdt,unilgNi.pgeinttanspBdeuiOunalua(unkupmrelaka-uibcoua.snsoniokknltelnne,B.oatoanadrnaubb.DrlBedtfaimnnbdueaigriegkoitaalBmuknadeoekghtknditihSagfysamndTa.nenaBrvbalrrkapantaaeknuaunriigip,trelne(inarAaaaniojntjjaBaanktaBooarieu,Anaharntensi,BBlrkngj.wO/.snrlmsdodkadiaaAgirfa“sdkuatjePiogopasOadet(nikli,aburmite(nfraanep(kHeSeucnkaemrnrSiAieniudteelAagwwDrtrahuthkasSpmsfaEngtoiunrnotilkie(TkeuauaisansnpeaaoumalraakkhgsekanArbaaadtieaenesirnemybguntiuafsrolsiyasrkeg,katnmkbgaeemainiauoasN,thryekptpaiidanknNarrfuaahranatppegcndmbfaaiinlenbaiAnedgKarnelab1pk.aueaaugeandna)ynyginloaaaaeurtni9aaslawernlbaBgogaegdaannrkimPanLsasensdng6nannat-niuapbdgtt,tbeS,buPednLaOawbi/ngB7GiigyuggghymesobaarnenkyiyrAago.aaFoaak,aaikgasixasnuahloalydgajeansspsitnp.desaluiahyiilnuoangianasaalriageTaealdliihtnNaaigmsajakneiig”naanscunhssgiabunakpahn,enAnehs,aktkie,nemgaturagbionagaia,wngnaaaddaprmwwngnfStnbdkpta,ikbnyoieuiwsnulNiiha,nauatraEiuoiepibdaseuaelmdt)NnaspmaDo,aZenmkaaKindnsr.ania.nsAiyiktkiga-lknaiugaatneSugseank,ereudgioawauyiini.Naarnaasaugrgrnhmosapunnanamgnda.aCdnanurlaanabdkginanmTnjgiaaytankFauujaatpunire)baaahaasaysrdranaegaannanehnblkinkag)nrietiiaBmdaandriner-n”l.dtpktehkkaetgmn,ebnu,iuibkg)sy.uorK)MaaBrranpanauuu.gueekpuk.iidad,;nmnannanaehlnnderognnennaeaadstthiycbt(itnmaimlraSnaeegrneeuguilnnMaugsaaaaeekaidntrinrcigaaykngnppkeskpeuenaa)di,a,deasdiMtaaaitro,enunknintuayejlpumamkissslnruhsAlbgetyagSaptalarteakeaeeaieitpgukaetainaukiaeyeaeepsrxnphisgidebtpbnar,twnkamstnlpilsauegiegaiiraaaaiausoj,kcjimnjadekpmodrrttbriaaaanphtaeshoaazetttrroieeamisuTlsm,iimennedcntpoki)hplirni,ss,rnnkb,geIea-natdnbiubnahsubaeu)aienepadggntadlainnaiudena.ajnsikaoharsnkdadahuanagurlkkkias“ugctaemrukar,enoeanraakdmgegstco,eitalamhusnsnsnnpitriuuaeaemsydldakrlieyatiaeereprinsnisaadaaiayiraglnesalansabiratagaenuinmruntadlaeni.irgtanielttiagskCtgnpigbmc,ptugietp(m,bekgab.gaepgihAaibkdarone,oNnruSrdo,siaaaaisDurnanotamaeatsnmnehalnnaadlnroaegaiaii,up,krckAnnarNyakadiulrJguaNanai.aaeA.rtnnpZAiaTFgousAsTnhiniaCaA, i, penerangan maksudnya.

Soalan Struktur Jawapan 11S o2a J tBE LlON H aE B-J aNBBn- BOJtLBSBp L T 4 MU HPJ F NB BEQEIFaCiCU J -OBLJsSIJJ-JPOBsVpBJ O B TJVTaHBPJL BJe[B MJ UB UBi DLXnTBB LSIJM sPM iQP O JBJ TJOJOULaB1B JO O B .LJVFSJ 4EO KTJJUCT5nO O ZTTTMVSJJV HJtZBBUTB O F JOVFC SB rZSMS CBV OHTOB BE U"'P JJCJBT ZE BBa BCTBTBX FUJ Q BPQCGFrB"TILBJBB J UtQLOM GI BUOPLP SJF BFOoHTF4oBPJ LFBJOFNJVFUQHXBIJ UL"ELFTNQ GE5UJSQPBOOpB sUQBT UBOOFW F FBCSG BU IJBTBBBfBGU.NLJJSS PBLLBoEULJBFSN USCJSOLNJCF UeTQFPCML BMNW.

VUBUEUNVHHEBBJJUJSBsPBBB [B rJ0VSFQPFFPCaS OJSFSJIBCL fVBFBQTBPMUBLOIBWOaBOP UPTCNSOCpFBOOVFHeN VOBOT OQ[ J F T GGPJ HBTTPISLOZN OrFi HLLFCBUVKP ZG FLQCGsB G PZBPJVIOEBTBBaSFFSDHFUB FBSEaOOFBE JVFE BBOJN BTLCB OQUJSVSQSSX[BBSLnBS OHITKJBIPJXBBGBO NBNEBTVBBBBBB UFXNBO GFOBPVQT LL NJ B THOJODM FM LNTBUH JSNSQPFJTKFB T MBB BVC B TSB JB U BBOCEU FMPGMJJMSLJ M OBFFCU N FFVLOaFJSK E OONFoJECCO JBBTaToCJJO CS O CSJ r ONB S B B GIFL FFTJCOrECE B BBEBELBFaEJEFELHM L MS -TCSVBaIBNFVBB TBOHJJB OBsVFMSVBM JBNFVO OkUVBLJO OEBB OIBLFOBEISZ OVMCT ESlLCIQ O G LOBHQBB JHCaJBV B EUBdFC HBN SOBOMVBILSHQJSNOQBBOu JT,Q JWUBSEBBSOa WJJCHTTZH IJ JFTFO FX HJ BLtBJ JM NB -ErZVB NFTPJOVB B BSNN E MQOGCB, SiSOBBUBUBQBB NQO EOOBPFJUBXNFPB BBN,L&MOOEE QBFB MF5UFH B TSBM MLOPOT NT MT JO KBBBJNSBBQBJSLFOB JLFFBBEJOFTSBNEHMJVTNVOOTBNIIUSFOOPP ONBIFUSPSSPBUJ5VGJP BCVTLO HN0 S NFCGFMH B OFT $BV 0TOOJMO POMENOFMC B SMCGaSBMPNBV BSBGVNLLJEPN ' OPBJJCPBPBF[BO PTBCOFQsCV OOUOSLSTBVIT BP$M MFQSOJLNTF MPOSFMVBJEJUJ B JFBV BuG IBFLTSQF O TGHBV P OT LO NO JFININNNOOJJJFI tB P NPB F FXJNT B HZSOaH-B BE JSOTLOBLSTBFJGS FFOBFmCBBCLBOUUC BBNC GFBCKB OT ONJOOJJBCOQHS VBQFBBUB JLB POSOQV BaBNHCEZBCEFMLBESBNJ OFZOHFJ JNCIBUOBBBCNJVN U BBTVQBBVMS VTFPMOBVBOJ BLBBNJILOU FOFC U VTTOBSIC O LNEE MBOOBNQB F GHFBVMUH,*CBF BIVOBBaFH UOQBFEQI BJJJ SCSBCO S OSOn Pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan SFI L BB F JBBBQ OLBUUF HQ TtUOOBNaSJLF 5Z FaFTCHB JFUMQS BpSFKLB B SJFrSOOB JS VBF TUPQLiO a FUNTJEBEsNNBBOPQUBFB aNVSFdONPZMCMQOPEnQMBOCFEu QFBB B BHB B ITHVBaBpSZIETOFJV BBVM e BV BlOBX IOQTamQ ON V BpB Hit OiQGs s a at Lah4 nt QBsTtF CG%SFF IDNbFC'NtUCBJaJ.

SF ePEt PJSBFCVs tMF rOZBOEGS,SLBO CFNKuP EbJNBt B5 IBLTGUS0 EBta P0HOBGbVMEFeVVFM6J BFIBVBsEXNNOFH2SNrL*JOaEQLTESNO aMOV. OBBO u k IKhJB BBTJMCBC DsF BNMBQET tEBBBbE B LLJeQBOE JFFMFT VNENHHF kBJkJUEOTBkVLBNHaBBB FB DOSOQaPNSJSBFUJPL*aMBteBOVBJOOBNB FahU OBLNVMU UFpNVBTON i ZTJLBFSkT rV TF L PMQ FJHlT C BESJBJJJOai NJNJSJLCB TTbwPOL-UaSEFMBU L BOTLELsQJ QoOBFU BVQJZVpFOtVBBQQBITE FBNoPO aLLlBTBBEBBZFPVIV OkaPB QUJS FBLOOHG QiSLFCJHJNJSnN nSVBSOOTnEOBBEOLUBLHps aFENsFPHMTNVXNJCB ZC S -BJF BBBO JNJ aOJFOQUiiJUBSFBBQBMp NSTFFBB O dIPEL B BMBU Fg tSBBFB aPBVSPVPTnHTP C BONFIBJ HFMOO UrJi OLHBOBFSQVSieUN BwFVJUiVLkPL EsLTHEX TMQB KBoL Bo KBPEOJUrOO PBJXHnFTFTO BQENaCOM BELBTNBBT THoFB CJT DLkB gNCGBOJZ KMVSQLLMT BBBEnVJVTB JMBOO B EeBsBFBVFBO MFPPSeBZsHPOBBB KSVBJOTOEUIBLCJ NBfQ rJE Z IJJQ FPVSQiOETnPZVLION L BOFM ZT e SQMHO CBdOPB JVmB O JB FpB-LEOB ZV TVODOBN TTJJNB JrB- BOOBHBP LUNa NEBOUwH IeFETJJOJF BBOEBOH ae NC B E oUTJE HUHMBTE oJEMCVnJZTBPBBD E ZHSEQHsSBHF FJJHFVQBBUsBJBQFUB F BkOJVJPQSgBP O BBLoFHB4BBBMJI IB fO TF QJ NXNBO S JOTBTEUE JEIHBNoTJsSeTMPs TOFLF TJVEBOHFE6SBZJBQB IBHGBiJOf OVNBrNBBUFkBOOJBEQ OTSIBd CHBBFOIBeFaBJCUQ MEBMaOOHO EEsBOOF L F TBM BJOVSBEJFOrSUB aF w FOFOiBFNBB -J H BN MUVBSBTBCNBdIOEa O USIBOHSw)BJOBLOOJJN UES VEBaI BOTJBOFUXGSUaJP M BZ J H OBB HFUHP S JTB P BCOX2nBEEQ CBJNBLMM aMBB LBJQTCQU IFBB 0ONNBBSLSFVUBOS JBLCBJS JU FnEOJJEVBQJPTFSONTBLPNQ FBSESLFBUNBTUO F N"O VJB E nJNBNBLOFBEM MO B HSJ EETBVUCH QNO FVFBO TM OVMPSoSLJ DBB ZVUD OFMBBFMEFGBBFUIFLNP BUB MP BQK ONVkOSFSFVFVO OBLJOO BEOTBUCBMFO T JUT FQC NSQt HBSOD VLOS SB OGC JTH MBFUUGLFiTP TCBBJJO BFBNLFVBVJEJVlXELBF H ZV%SBBLTJPOS QT TOOTOuF SNQ IB HULIUSBSLB B OUBUPNBFLBIVJFBCBBNS HHs JB N OF EUBO OSOFN N UO BTTUOOOTVFe QJNTF LLCGT BKVJTB V O O GPEJFMFBMnPBPNZEVUSOFBJCT BB F FFOEIGBJIBBBHO COBTHBCMQ SIOTJBBLTV PVUTLUNSQC HBF SBJGF UNHJC BFGBBVB BBJ BN UOPBLN F 2 MJV OFOOVPPEPNJUPUBEC C SB JT*SB 0NHSBV JJ1S N VK EHMBL LU TBSBM N BJBGBBJ BBNOH FPMFFMJTSNJ JUJLOHLOB TIO M XOB* B UEJOQU BCPBOI NBBJO O T BMJ VF JF J OH U BFLTNPZN BOUTJ J OOVFCJ U HFTQFO F JTHFOB H¡JKTLZKUVN OJ TB OFFQBVU $SLTBISBTJHJBLJBV NJB BONTF FFE[N SFJ BJQS FL QU MCBK BSL VBSJ N CJJ %JFSBU B FE BTT L BCJLJOELPLO BSFJOMB O BNQJB Pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan OBELLUTOFHBSBO OBB BNBKB BIL VLZBO OO OHCXE VTNBEB BUH BPB JOLXBJT OTT MS Z TF VJHEB B BIIOHBO VS J J Jawapan kepada Praktis STPM dan Kertas Jawapan 505 Model STPM.

(iii) JSAAWAMPAN BABPEL KANDUNGAN Ciri-ciri UNIK dalam buku ini (ii) BAB 5 Fenomena Iklim: El Nino 80 Format Pentaksiran (vii) (Kemarau), La Nina (Banjir), Analisis Soalan Geografi 2 (942/2) dan Siklon 80 STPM Baharu (Semester 2) 2020 (viii) 85 Ulasan Soalan STPM Baharu (Semester 2) 2020 (ix) 5.1 Fenomena El Nino dan La Nina 94 5.2 Siklon BAHAGIAN A: Praktis STPM 5 Alam Sekitar Fizikal Tema 1: Sistem Atmosfera BAB 1 Struktur, Kandungan dan 1 BAB 6 Kaitan Sistem Atmosfera 95 dengan Manusia Tenaga dalam Sistem Atmosfera 95 6.1 Kesan Rumah Hijau dan Penipisan 104 1.1 Maksud Atmosfera 1 Lapisan Ozon 114 1.2 Struktur Atmosfera 2 117 1.3 Kandungan Atmosfera 8 6.2 Pencemaran Udara dan Jerebu 124 1.4 Tenaga di Dalam Sistem Atmosfera: 6.3 Fenomena Hujan Asid 12 6.4 Iklim Mikro: Iklim Bandar Matahari sebagai Sumber Tenaga 18 Praktis STPM 6 Praktis STPM 1 BAB 2 Unsur-unsur Cuaca dan Iklim, 20 BAB 7 Perubahan Iklim 125 Sinaran dan Bahangan serta Bajet Haba 20 7.1 Konsep Perubahan Iklim 125 22 7.2 Episod Perubahan Iklim Dunia 126 2.1 Unsur-unsur Cuaca dan Iklim 7.3 Mekanisme Perubahan Iklim: 2.2 Sinaran dan Bahangan 24 127 2.3 Bajet Tenaga dan Imbangan Haba dalam 33 Pemanasan Global 37 7.4 Pengaruh Manusia terhadap Perubahan 129 Sistem Bumi-Atmosfera 2.4 Taburan Tenaga Sinaran Global Iklim Global Masa Kini 131 Praktis STPM 2 7.5 Punca dan Sumber Perubahan Iklim: 133 145 BAB 3 Kelembapan Udara dan Kerpasan 39 Pemanasan Global 147 7.6 Kesan Perubahan Iklim: Pemanasan Global 3.1 Air dan Kelembapan Udara 39 7.7 Impak Pemanasan Global di Malaysia 151 3.2 Proses Sejatan 42 7.8 Langkah Menangani Perubahan Iklim Global 153 3.3 Proses Pemeluwapan dan Pembentukan Awan 43 7.9 Langkah Menangani Perubahan Iklim: 3.3 Kestabilan Atmosfera dan Kadar Tukaran 49 3.5 Pembentukan Kerpasan dan Mekanisme Pemanasan Global di Malaysia 52 Praktis STPM 7 Kejadian Hujan di Kawasan Tropika Lembap 60 Praktis STPM 3 8 Kemahiran Amali: Sistem Atmosfera 8.1 Data Suhu dan Hujan 8.2 Graf Garis 8.3 Graf Bar (Histogram – Data Hujan) 8.4 Graf Gabungan 8.5 Graf Bulatan 8.6 Rajah Sebaran/Serakan (Scatter Diagram) 8.7 Rajah Mawar Angin (Wind Rose) 8.8 Peta Isoplet (Peta Garis Senilai) Praktis STPM 8 BAB 4 Tekanan Udara, Edaran Atmosfera 61 BAB 155 dan Sistem Angin SAMPEL 155 4.1 Tekanan Udara 61 157 4.2 Edaran Atmosfera 65 159 4.3 Sistem Angin Dunia 68 160 4.4 Angin Tempatan 74 161 Praktis STPM 4 78 162 164 166 169 (iv) Tema 2: Sistem Hidrologi BAHAGIAN B: Alam Sekitar Manusia BAB 9 Fasa Air dan Proses dalam 170 Tema 3: Pembangunan Ekonomi dan Impak Alam Sekitar Kitaran Hidrologi 170 BAB 14 Sektor-sektor Ekonomi 245 9.1 Fasa Air dalam Sistem Hidrologi 172 9.2 Taburan dan Simpanan (Storan) Air Global 173 14.1 Klasifikasi Sektor-sektor Ekonomi 245 9.3 Kitaran Hidrologi 175 9.4 Proses-proses dalam Kitaran Hidrologi 189 14.2 Ciri-ciri Sektor Ekonomi 248 Praktis STPM 9 14.3 Kepentingan atau Sumbangan Kegiatan Ekonomi kepada Pembangunan BAB 10 Edaran Air Tanih Sosioekonomi Negara 249 10.1 Air Tanih 191 14.4 Perkembangan Semasa Sektor-sektor Ekonomi: 10.2 Sistem Akuifer 10.3 Pergerakan Air Tanih 191 Kemajuan, Isu dan Masalah yang Dihadapi 255 10.4 Potensi Sumber Air Tanih: Kajian Kes 194 196 Praktis STPM 14 266 di Malaysia Praktis STPM 10 198 BAB 15 Sektor Pertanian 268 199 15.1 Jenis dan Ciri-ciri Sektor Pertanian 268 BAB 11 Imbangan Air 201 15.2 Faktor-faktor yang Mempengaruhi 273 11.1 Imbangan Air atau Imbangan Hidrologi 201 Kegiatan Pertanian 276 11.2 Imbangan Air Negatif dan Fenomena 15.3 Kepentingan atau Sumbangan Sektor Pertanian 278 206 15.4 Masalah dan Isu dalam Sektor Pertanian Kemarau 211 15.5 Kesan Negatif Aktiviti Pertanian terhadap 281 11.3 Imbangan Air Positif dan Fenomena Banjir 215 286 Praktis STPM 11 Alam Sekitar dan Langkah-langkah untuk 290 Mengatasi 15.6 Bioteknologi Pertanian Praktis STPM 15 12 Kaitan Sistem Hidrologi BAB 16 Sektor Perikanan 291 dengan Manusia BAB 217 16.1 Jenis dan Ciri-ciri Sektor Perikanan 291 12.1 Kepentingan dan Kesan Aktiviti Manusia 16.2 Faktor-faktor dan Kepentingan Sektor terhadap Sumber Air dan Sistem Hidrologi: 217 294 Kajian Kes di Malaysia 219 Perikanan di Asia Pasifik 221 16.3 Masalah-masalah dan Kesan-kesan Sektor 299 12.2 Banjir Kilat 12.3 Kemerosotan Kualiti Sumber Air 223 Perikanan di Malaysia 303 12.4 Pembandaran dan Kesan terhadap Sistem 230 16.4 Program Pembangunan Sektor Perikanan 304 234 307 Hidrologi di Malaysia 12.5 Pengurusan Sumber Air 16.5 Perikanan Akuakultur di Malaysia Praktis STPM 12 Praktis STPM 16 BAB 17 Sektor Perhutanan 308 SAMPEL BAB 13 Kemahiran Amali: Sistem 236 17.1 Taburan, Jenis, dan Ciri-ciri Hutan Tropika 308 Hidrologi 17.2 Kepentingan dan Sumbangan Sektor 236 313 13.1 Graf Garis 238 Perhutanan 316 13.2 Graf Bar 241 17.3 Fenomena Penyahhutanan 13.3 Lembangan Saliran 244 17.4 Langkah-langkah Pemeliharaan dan 321 Praktis STPM 13 326 Pemuliharaan Sumber Hutan di Pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan Praktis STPM 17 (v) BAB 18 Sektor Perlombongan 328 21.2 Ketidakseimbangan Pembangunan antara 406 Wilayah di Malaysia; Masalah dan Isu 18.1 Taburan dan Jenis Aktiviti Perlombongan di 328 BAB 414 Malaysia 331 21.3 Strategi Mengimbangi Pembangunan 425 334 Ekonomi antara Wilayah 426 18.2 Faktor-faktor dan Kepentingan Sektor 337 Perlombongan di Malaysia 339 Praktis STPM 21 426 347 432 18.3 Kesan-kesan Aktiviti Perlombongan terhadap 22 Kemahiran Amali: 436 Alam Sekitar Pembangunan Ekonomi dan 439 Impak Alam Sekitar 18.4 Langkah-langkah Melestarikan Sumber Perlombongan di Malaysia 22.1 Graf 22.2 Rajah 18.5 Sumber Tenaga Fosil dan Sumber Tenaga 22.3 Peta Koroplet Gantian Praktis STPM 22 Praktis STPM 18 Tema 4: Globalisasi Ekonomi dan Kerjasama Serantau BAB 19 Sektor Perindustrian 349 BAB 23 Globalisasi Ekonomi dan 440 Dasar Luar Negara Malaysia 19.1 Jenis dan Ciri-ciri Industri Perkilangan 23.1 Konsep Globalisasi Ekonomi dan Saling 440 Bergantung antara Negara 443 di Malaysia 349 445 23.2 Proses dan Faktor dalam Globalisasi Ekonomi 448 19.2 Perkembangan Semasa: Faktor yang 23.3 Komponen Globalisasi Ekonomi 450 23.4 Kesan-kesan Globalisasi Ekonomi 454 Mempengaruhi Perkembangan Industri 23.5 Globalisasi Ekonomi di Malaysia 457 23.6 Dasar Luar Negara Malaysia Perkilangan di Malaysia 353 Praktis STPM 23 19.3 Kepentingan Industri Perkilangan di Malaysia; Masalah dan Isu yang Dihadapi 362 19.4 Program Pembangunan Sektor Industri Perkilangan di Malaysia 367 BAB 24 Kerjasama Serantau dan 459 Segi Tiga Pertumbuhan 19.5 Kesan-kesan Aktiviti Industri Perkilangan terhadap Alam Sekitar 369 19.5 Pembangunan Lestari dalam Sektor Industri 24.1 Konsep Kerjasama Serantau dan Perkilangan 374 Kepentingannya 459 Praktis STPM 19 376 24.2 Kerjasama Ekonomi Asia Pasifik (APEC) dan Sidang Kemuncak Asia Timur (EAS) 462 BAB 20 Sektor Perkhidmatan 377 24.3 Persatuan Negara-negara Asia Tenggara (ASEAN) dan Kawasan Perdagangan Bebas ASEAN (AFTA) 468 20.1 Sektor Perkhidmatan: Kajian Kes Malaysia 377 24.4 Kerjasama Ekonomi Serantau di Luar 20.2 Sektor Pelancongan: Kajian Kes Malaysia 383 20.3 Sektor Pengangkutan dan Perhubungan: Asia Pasifik 476 392 Kajian Kes Malaysia 24.5 Segi Tiga Pertumbuhan ASEAN 478 20.4 Faktor-faktor yang Mempengaruhi 394 24.6 Kerjasama Serantau ASEAN untuk Melindungi Perkembangan Sistem Pengangkutan dan 398 Perhubungan 401 Alam Sekitar 486 20.5 Kepentingan Sistem Pengangkutan dan Perhubungan 403 Praktis STPM 24 490 20.6 Sistem Pengangkutan Pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan 404 20.7 Kesan Perkembangan Jaringan Pengangkutan 25 Kemahiran Amali: Globalisasi 492 terhadap Persekitaran Fizikal di Malaysia Ekonomi dan Kerjasama Serantau Praktis STPM 20 BAB 25.1 Graf 492 SAMPEL25.2 Rajah 497 Praktis STPM 25 501 BAB21 Proses Pembangunan Ekonomi 405 KERTAS MODEL STPM 502 JAWAPAN 505 21.1 Konsep dan Petunjuk Pembangunan Ekonomi 405 GLOSARI 548 (vi) FORMAT PENTAKSIRAN Geografi Semester 2 terdiri daripada dua bahagian, iaitu; Bahagian A: Alam Sekitar Fizikal dan Bahagian B: Alam Sekitar Manusia.

Kedua-dua bahagian ini akan diuji dalam bentuk soalan struktur dan soalan esei. Soalan yang dikemukakan kepada calon merangkumi semua tajuk dalam sukatan pelajaran bagi Semester 2.

Soalan akan menguji mengenai pengetahuan dan kefahaman konsep geografikal, menganalisis faktor, proses dan saling kaitan antara fenomena geografi, membuat pertimbangan dan keputusan dalam konteks geografikal serta membuat kemahiran amali kartografi yang berkaitan dengan tajuk yang dipelajari dalam Semester 2.

Mulai tahun 2012 dan seterusnya format kertas peperiksaan bagi Geografi Semester 2 STPM Baharu (942/2) adalah seperti yang berikut: Kod dan Nama Kertas 942/2: Geografi Semester 2 Catatan Tarikh peperiksaan Akhir Semester 2 – Akhir Mei Masa peperiksaan 2 Jam Peperiksaan akhir Semester 2 dilaksanakan Jenis Soalan Soalan struktur dan soalan esei sebelum atau pada cuti pertengahan tahun penggal persekolahan di Tingkatan 6 Atas. Pembahagian Soalan Bahagian Bahagian A: Alam Sekitar Fizikal Bahagian B: Alam Sekitar Manusia Pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan Soalan Soalan 1: Soalan struktur (Soalan wajib) Soalan 1: Soalan struktur (Soalan wajib) • Wajib dijawab semuanya • Wajib dijawab semuanya • Mengandungi 5 atau 6 pecahan soalan • Mengandungi 5 atau 6 pecahan soalan • Bernilai 15 markah.

• Pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan 15 markah Soalan 2 dan Soalan 3: Soalan esei (Soalan Soalan 2 dan 3: Soalan esei (Soalan pilihan) pilihan) • Pilih dan jawab 1 soalan sahaja sama ada • Pilih dan jawab 1 soalan sahaja sama ada Soalan 2 atau Soalan 3 Soalan 2 atau Soalan 3 • Bernilai 25 markah • Bernilai 25 markah Agihan markah 40 Markah 40 Markah Wajaran markah 80 markah dari keseluruhan semester Wajaran peratus 32% dari keseluruhan semester Penilaian Penilaian berpusat oleh Majlis Peperiksaan Malaysia (MPM) Nota 1 Aras soalan yang ditanya akan berasaskan Taksonomi Bloom yang baharu iaitu Aras Mudah, Aras Sederhana dan Aras Sukar.

Aras Mudah (Pengetahuan dan Kefahaman), Aras Sederhana (Aplikasi dan Analisis ), Aras Sukar (Penilaian dan Kreatif). Dalam konteks STPM Baharu, nisbah taburan soalan Mudah : Sederhana : Sukar ialah mengikut ratio 25% : 50% : 25%. 2 Soalan yang ditanya bagi Bahagian A dan Bahagian B adalah dalam bentuk struktur (esei pendek – Soalan 1), esei panjang, atau kemahiran amali (Soalan 2 atau Soalan 3).

Soalan kemahiran amali melibatkan pengiraan, persembahan kartografi (graf, rajah, carta, dan peta) serta menganalisis data, graf, rajah, carta, dan peta. 3 Jika calon tidak berpuas hati mengenai keputusan peperiksaan Semester 2, maka calon boleh mengulangi semula Kertas Geografi 2 (942/2) ini pada Semester 3 yang akan berlangsung pada akhir tahun di Tingkatan 6 Atas.

SAMPEL (vii) Analisis Soalan Geografi 2 (942/2) STPMSTPM Baharu (Semester pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan 2020 TEMA 1: SISTEM ATMOSFERA Soalan Catatan Tahun 2020 Soalan 1(a): Melengkapkan jadual berkaitan ciri lapisan troposfera dan stratosfera.

Soalan 1(b): Menghuraikan fungsi lapisan troposfera dan stratosfera. Soalan 1(c): Menjelaskan tiga aktiviti manusia yang menyebabkan perubahan pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan gas di atmosfera. Soalan 2(a): Membincangkan enam kesan fenomena El Nino terhadap sektor pertanian.

Soalan 2(b): Mencadangkan enam langkah mitigasi untuk mengurangkan kesan El Nino terhadap sektor pertanian. TEMA 2: SISTEM HIDROLOGI Tahun Soalan Catatan 2020 Soalan 3(a): Menilai sejauhmanakah jenis tanah mempengaruhi proses larian air permukaan di kawasan Tropika Lembab. Soalan 3(b): Menjelaskan bagaimana aktiviti manusia dapat mempengaruhi edaran air tanih. TEMA 3: PEMBANGUNAN EKONOMI DAN IMPAK ALAM SEKITAR Tahun Soalan Catatan 2020 Soalan 4(a): Menyatakan tiga aktiviti ekonomi dalam sektor tertier.

Soalan 4(b): Menjelaskan tiga kepentingan sektor pengangkutan dan perhubungan kepada ekonomi sesebuah negara. Soalan 4(c): Menghuraikan kesan pembangunan sistem pengangkutan keretapi elektrik terhadap alam sekitar fizikal, alam sekitar manusia dan penduduk. Soalan 5(a): Menghuraikan enam sumbangan sektor ekonomi sekunder terhadap pembangunan kawasan luar bandar di Malaysia.

Soalan 5(b): Membincangkan enam cabaran dalam mempergiatkan sektor ekonomi sekunder di Malaysia. TEMA 4: GLOBALISASI EKONOMI DAN KERJASAMA SERANTAU Tahun Soalan Catatan 2020 Soalan 6(a) (i): Melukis graf bar yang sesuai untuk menunjukkan imbangan SAMPELSoalan perdagangan antara Malaysia dengan setiap negara anggota kemahiran amali Soalan 6(a) (ii): ASEAN terpilih pada tahun 2010. – melukis graf Soalan 6(b): Menjelaskan tiga pola imbangan perdagangan Malaysia dengan bar.

negara anggota ASEAN terpilih pada tahun 2010. Membincangkan empat peranan kerjasama ekonomi dalam menggalakkan perdagangan dalam kalangan negara pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan ASEAN.

(viii) Ulasan Soalan STPM Baharu STPM(Semester 2) 2020 SOALAN 1 Soalan 1(a) Calon perlu melengkapkan jadual yang diberikan seperti berikut: Lapisan Jarak dari aras laut Gas utama Lapisan pemisah antara dua lapisan Troposfera 10 km dari aras laut Oksigen dan karbon dioksida Tropopaus Stratosfera 50 km dari aras laut Ozon dan CFC Soalan 1(b) Calon perlu menghuraikan fungsi lapisan berikut; • Troposfera: Lapisan ini menampung kehidupan manusia, haiwan dan tumbuhan kerana ia membekalkan oksigen, karbon dioksida dan juga air hujan.

Lapisan ini juga menjadi penebat bahangan matahari dan juga bahangan bumi. Ia berfungsi menyerap ke dua-dua bahangan tersebut untuk membolehkan suhu bumi yang stabil. Ia menghalang kehilangan haba dari permukaan bumi. • Stratosfera: Lapisan ini mengandungi gas ozon yang berfungsi menyerap, menyerak, menapis dan memantul sinaran ultra lembayung dari matahari dan seterusnya melindungi manusia, tumbuhan dan haiwan daripada radiasi berlebihan sinaran tersebut.

Soalan 1(c) Calon perlu menjelaskan tiga aktiviti manusia yang menyebabkan perubahan kandungan gas di atmosfera. Antaranya ialah, pertama aktiviti perindustrian yang banyak membebaskan gas karbon dioksida, sulfur dioksida di udara.

Kedua aktiviti pengangkutan yang meningkatkan kandungan gas karbon monoksida dan ketiga aktiviti domestik seperti pembakaran terbuka yang membebaskan gas karbon dioksida, penggunaan aeorosol yang membebaskan gas CFC dan lain-lain. SOALAN 2 Soalan 2(a) Calon perlu membincangkan enam kesan fenomena El Nino terhadap sektor pertanian. Antaranya ialah memusnahkan tanaman seperti padi sawah akibat kekurangan bekalan air kerana El Nino menyebabkan cuaca panas melampau.

Tanaman juga musnah akibat kebakaran – cuaca panas melampau. Produktiviti pertanian merosot apabila penghasilan tanaman merosot seperti produk sayur-sayuran dan buah-buahan.

Aktiviti pertanian seperti pembajakan tidak dapat dijalankan. Namun begitu, El Nino juga boleh memberikan kesan positif seperti mempercepatkan proses pendebungaan ketika musim panas dan berangin, proses penuaian lebih mudah. Soalan 2(b) Calon perlu menjelaskan enam langkah mitigasi untuk mengurangkan kesan El Nino terhadap sektor pertanian. Antaranya ialah pembenihan awan untuk menurunkan hujan di kawasan tanaman seperti tanaman padi sawah.

Penggunaan air bawah tanah untuk mengairi kawasan pertanian seperti penggunaan telaga tiub, penggunaan sumber air takungan lain seperti tasik dan kolam untuk mengairi kawasan pertanian, pemindahan air antara lembangan saliran atau antara sistem empangan untuk pertanian dan lain-lain. SOALAN 3 Soalan 3 (a) Calon perlu menilai sejauhmanakah jenis tanah mempengaruhi proses larian air permukaan di kawasan Tropika (ix) SAMPEL Lembab.

Di antara isi-isi penting yang boleh dijelaskan di bawah faktor jenis tanah ialah, ciri-ciri tanah (tanah pasir, laterit, liat dll), keporosan dan larut resap, peratus (%) liang pori yang akan menentukan darjah takungan dan keresapan, struktur dan tekstur tanah dan lain-lain. Selain itu, calon perlu menghuraikan faktor-faktor lain selain daripada jenis tanah. Antaranya seperti faktor litupan tumbuhan, faktor hujan mengikut masa, faktor aktiviti manusia khususnya dalam konteks penurapan muka bumi.

Soalan 3 (b) Calon perlu menjelaskan bagaimana aktiviti manusia dapat mempengaruhi edaran air tanih. Antara aktiviti manusia yang menjejaskan edaran air tanih ialah penyahhutanan/pemusnahan hutan secara besar-besaran (pembalakan), penurapan muka bumi untuk pembinaan medan letak kereta dan jalan raya, penyediaan sistem saliran (longkang, parit dll), pembinaan bangunan dalam kawasan bandar.

Termasuk juga aktiviti penghutanan semula, penghijauan bandar, tanaman rumput dan lain-lain yang memberikan impak positif kepada edaran air tanih. SOALAN 4 Soalan 4(a) Pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan perlu menyatakan tiga aktiviti ekonomi dalam sektor tertier. Antaranya ialah seperti sektor pelancongan, perniagaan runcit dan borong, perdagangan, perkhidmatan kerajaan dan swasta dsb.

Soalan 4(b) Calon perlu menjelaskan tiga kepentingan sektor pengangkutan dan perhubungan kepada ekonomi sesebuah negara. Antaranya ialah sektor pengangkutan dan perhubungan memacu kegiatan ekonomi setempat kerana ia berfungsi mengangkut input dan output ekonomi.

Pusat- pusat pertumbuhan ekonomi akan tumbuh sejajar dengan perkembangan sektor pengangkutan dan perhubungan. Meningkatkan darjah ketersampaian antara tempat daripada segi masa dan jarak perjalanan, contohnya sistem lebuh raya. Mempercepatkan pembauran inovasi antara tempat melalui perkembangan sistem perhubungan/ICT yang menyebabkan kawasan mundur boleh bertukar menjadi maju.

Mengangkut penumpang dan barangan dalam tempoh masa yang cepat dan kuantiti yang ramai seperti LRT, MRT, ERL dan lain-lain. Soalan 4(c) Calon perlu menghuraikan kesan pembangunan sistem pengangkutan kereta api elektrik terhadap alam sekitar fizikal, alam sekitar manusia dan penduduk.

Antara kesannya ialah mengurangkan kesan negatif terhadap alam sekitar fizikal seperti mengurangkan kesan pencemaran udara. Kesan terhadap alam sekitar manusia dan penduduk pula seperti mengurangkan kesesakan, mempercepatkan masa perjalanan, meningkatkan darjah ketersampaian antara tempat, keselesaan dan kecekapan pengurusan perjalanan/sistematik dan tepati masa.

SOALAN 5 Soalan 5(a) Calon perlu menghuraikan enam sumbangan sektor ekonomi sekunder terhadap pembangunan kawasan luar bandar di Malaysia. Sektor ekonomi sekunder ialah sektor perkilangan. Antara sumbangan sektor perkilangan terhadap pembangunan kawasan luar bandar ialah memajukan sektor ekonomi primer yang berkaitan seperti perladangan kelapa sawit dan getah apabila diwujudkan kilang memproses kelapa sawit dan getah di kawasan luar bandar, contohnya di kawasan FELDA dan FELCRA.

Menyediakan peluang pekerjaan kepada penduduk, meningkatkan pendapatan perkapita penduduk, menaikkan taraf hidup dan kualiti hidup penduduk termasuk kuasa beli dan tabungan, memajukan kawasan setempat di luar bandar dengan penyediaan infrastruktur seperti perumahan, bekalan air dan elektrik, meningkatkan kemudahan sosial (sekolah, klinik, balai polis dan lain-lain) dan juga boleh mewujudkan bandar-bandar baharu sebagai pusat pertumbuhan ekonomi setempat.

Soalan 5(b) Calon perlu membincangkan enam cabaran dalam mempergiatkan sektor ekonomi sekunder di Malaysia. Antaranya ialah cabaran ekonomi global akibat pendemik Covid 19 yang menjejaskan permintaan terhadap produk (x) SAMPEL sektor perkilangan - pengucupan eksport. Pengoperasian kilang terpaksa ditutup/ditangguhkan apabila pekerjanya dikuarantin.

Cabaran daripada segi peningkatan kos operasi yang menyebabkan pelabur memilih destinasi pelaburan yang lebih rendah kos operasinya seperti ke Vietnam.

Cabaran sumber tenaga manusia/tenaga buruh yang tidak cukup, tenaga tempatan yang tidak berdaya saing dalam konteks 3D, cabaran teknologi yang masih sederhana dan tidak kompetetif, karenah birokrasi kerajaan dan cabaran iklim pelaburan yang tidak kondusif seperti keadaan politik yang tidak stabil yang boleh mengurangkan keyakinan pelabur asing. SOALAN 6 Soalan 6(a)(i) Calon perlu melukis graf bar yang sesuai untuk menunjukkan imbangan perdagangan antara Malaysia dengan setiap negara anggota ASEAN yang terpilih pada tahun 2010.

Graf bar yang paling sesuai ialah graf bar cermin apabila calon mengira imbangan perdagangan dengan cara/formula nilai EKSPORT – nilai IMPORT. Graf bar cermin yang dilukis mestilah dilengkapkan dengan tajuk, skala dan petunjuk.

Soalan 6(a)(ii) Calon perlu menjelaskan tiga pola imbangan perdagangan Malaysia dengan negara anggota ASEAN terpilih pada tahun 2010. Berdasarkan graf bar yang dilukis, pola imbangan perdagangan boleh dijelaskan sama ada mengalami defisit atau infisit. Defisit apabila nilai eksport lebih kecil dari nilai import, seperti dengan negara Filipina dan Indonesia.

Keadaan imbangan perdagangan ini merugikan Malaysia. Manakala imbangan perdagangan dengan negara Brunei Darussalam, Kemboja, Myanmar, Thailand dan Vietnam ia mengalami keadaan infisit (eksport melebihi import).

Imbangan perdagangan ini menguntungkan Malaysia. Soalan 6(b) Calon perlu membincangkan empat peranan kerjasama ekonomi dalam menggalakkan perdagangan dalam kalangan negara anggota ASEAN.

Antara peranan kerjasama ekonomi yang boleh dibincangkan ialah peranannya daripada segi perluasan pasaran barangan sesama ASEAN melalui penghapusan dasar perlindungan yang diamalkan oleh setiap negara. Kedua, mewujudkan kawasan/zon bebas cukai di sempadan antara negara. Ketiga, memperkasa semula peranan segitiga pertumbuhan ASEAN seperti di kawasan IMT–GT, IMS–GT, EAGA supaya ia menjadi zon pemangkin perdagangan antara negara ASEAN.

Keempat, memperkasa peranan AFTA daripada segi penyelarasan harga produk, kepelbagaian produk yang dipasarkan, rantaian industri yang melibatkan antara negara dan sebagainya. (xi) SAMPEL BAB Struktur, Kandungan dan Tenaga dalam 1 Sistem Atmosfera Jadual Populariti Soalan STPM Subtopik 2015 2016 2017 2018 2019 2020 1.1 Maksud Atmosfera ✓ 1.2 Struktur Atmosfera ✓ ✓ 1.3 Kandungan Atmosfera ✓ 1.4 Tenaga di Dalam Sistem Atmosfera: Matahari sebagai Sumber Tenaga 1.1 Maksud Atmosfera Hasil Pembelajaran Menyatakan struktur dan 1 Atmosfera ialah satu lapisan nipis gas tanpa bau, warna dan rasa yang berada di kandungan atmosfera.

atas permukaan bumi disebabkan oleh tarikan daya graviti bumi. Laman Web 2 Di bumi, atmosfera didapati dari paras permukaan tanah, hingga sekitar 1000 Layari laman web berikut km di atas permukaan bumi atau paras laut dan dikekalkan di tempatnya oleh untuk mengetahui graviti bumi. Atmosfera terdiri daripada satu lapisan udara yang mengelilingi dan maklumat lanjut mengenai meliputi bumi.

atmosfera: http:// ms.wikipedia.org/wiki/ 3 Isi padu, atmosfera terdiri daripada komponen nitrogen (78%) dan oksigen (21%), atmosfera dengan sedikit argon (1%), karbon dioksida, wap air dan gas-gas lain. 1 4 Atmosfera melindungi kehidupan di bumi dengan menyerap radiasi sinaran ultra-lembayung (UV) dari matahari dan mengurangkan Darjah (ºC) 20 40 suhu ekstrem antara siang -80 -60 -40 -20 0 dan malam.

70 5 Sejumlah 75 peratus 100 Termosfera 60 daripada atmosfera bumi berada dalam jarak 11 80 Mesopaus 50 Ketinggian (batu) km dari permukaan Ketinggian (km) tanah. Atmosfera tidak Mesosfera mempunyai sempadan 40SAMPEL mendadak, tetapi menipis perlahan-lahan apabila 60 Stratopaus ketinggian bertambah.

40 Stratosfera 30 6 Namun, tiada kepastian 20 sempadan antara atmosfera Lapisan dan angkasa lepas. Garisan 20 ozon Tropopaus 10 Karman, pada 100 km Troposfera 0 (62 batu), sering digunakan sebagai sempadan antara -120 -80 -40 0 40 80 atmosfera dengan angkasa. Darjah (ºF) Rujuk Rajah 1.1. ▲ Rajah 1.1 Lapisan Atmosfera 1.2 Struktur Atmosfera BAB Info Ilmu Troposfera BAB Atmosfera terdiri daripada 1 Istilah troposfera berasal dari perkataan Greek “Tropos” yang bermaksud berputar.

beberapa lapisan dan Keadaan ini menjelaskan sifat lapisan ini yang mengalami perolakan/golakan dan dinamakan mengikut percampuran. 1 fenomena yang terjadi di 2 Troposfera merupakan lapisan atmosfera yang paling nipis dan paling hampir lapisan berkenaan. dengan permukaan bumi.

Troposfera bermula dari permukaan bumi sehingga ke Peralihan antara satu lapisan tropopaus (antara ketinggian 10 hingga 16 kilometer, bergantung kepada lapisan dengan satu latitud). lapisan yang lain berlaku secara bertahap. Lapisan 3 Dalam lapisan tropopaus, suhu berkurangan kesan daripada pertambahan udara berkenaan ketinggian altitud, iaitu sekitar 17 °C hingga –52 °C. Kebanyakan sistem cuaca berlaku di bawah lapisan tropopaus. 2 dibahagikan kepada: • Troposfera 4 Campuran gas-gas dalam lapisan ini adalah yang paling ideal untuk kehidupan • Stratosfera di bumi.

Di lapisan ini kehidupan juga terlindung dari pancaran radiasi yang • Mesosfera dipancarkan oleh matahari dan objek langit lain. Rujuk Rajah 1.2. • Eksosfera BAB • Termosfera Troposfera. Lapisan ini menampung kehidupan manusia, haiwan dan tumbuhan. 3 Lapisan ini membekalkan oksigen, karbon Hasil Pembelajaran dioksida dan juga air hujan. Fenomena cuaca juga berlangsung di lapisan ini seperti ribut, Menghuraikan ciri struktur kilat, petir, hujan, salji dan lain-lain.

atmosfera. 4 STPM 2016 S2(a) BAB INPUT STPM (2016) Soalan 2 (a): Dengan Eksofera lakaran gambarajah, huraikan struktur utama 400 km BAB5 lapisan atmosfera. Termosfera 300 km Huraian: Soalan ini menghendaki calon Mesosfera 50 km menghuraikan struktur 40 km utama lapisan atmosfera Stratosfera 10 km berdasarkan kepada Troposfera BAB6 gambarajah yang dilukis.

pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan

Calon haruslah menjawab BAB struktur utama lapisan ▲ Rajah 1.2 Lapisan troposfera atmosfera ialah lapisan troposfera, stratosfera, 5 Taburan suhu di lapisan troposfera semakin berkurangan secara seragam mengikut mesosfera, termosfera, ketinggian. Sifat ini dikenali sebagai kadar tukaran adiabatik. dan eksosfera. Setiap 6 Purata penurunan suhu ialah kira-kira 6.5 °C pada setiap 1 km peningkatan 7 lapisan perlu dihuraikan ketinggian. Semakin tinggi jarak menegak, maka suhu semakin sejuk.

ciri-ciri fizikal seperti suhunya, ketinggiannya, 7 Halaju angin semakin meningkat apabila ketinggian bertambah sehingga ke paras dan ciri-ciri keistimewaan bawah sempadan lapisan tropopaus yang menjadi kawasan utama arus udara jet. yang membezakan antara SAMPEL satu lapisan dengan lapisan yang lain. 8 Manakala di bahagian hampir dengan permukaan bumi, halaju dan edaran angin amat bergantung kepada topografi dan kekasaran permukaan.

2 Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera 9 Selain itu, lapisan troposfera mengandungi hampir semua wap air, udara, dan STPM 2020 S1(a) awan. Aktiviti perolakan yang dikaitkan dengan pembentukan pelbagai jenis awan, kerpasan dan pergerakan angin berlaku di lapisan ini.

INPUT STPM (2020) 1BAB 2 10 Cuaca yang dialami di permukaan bumi dibentuk oleh perubahan yang berlaku di Soalan 1 (a): Lengkapkan 3BAB lapisan troposfera.

Bahan-bahan pencemar udara seperti karbon dioksida, sulfur ciri lapisan troposfera dan 4 oksida, karbon monoksida, hidrokarbon dan partikel terampai juga terkumpul di stratosfera dalam jadual. 5BAB lapisan ini. 6 Huraian: Soalan ini 7BAB 11 Lapisan atas troposfera dipisahkan dari lapisan stratosfera oleh lapisan tropopaus. menghendaki calon Tropopaus ialah lapisan sempadan yang sangat penting terhadap fenomena menyatakan ciri lapisan meteorologi (cuaca).

Lapisan ini wujud sebagai kawasan songsangan suhu atau troposfera dan stratosfera lapisan isoterma. dari segi jarak dari aras laut, gas utama dan 12 Lapisan tropopaus bertindak sebagai penutup kepada sebarang proses perolakan lapisan pemisah antara yang berlaku di dalam troposfera. Ketinggian tropopaus sekitar 16 hingga 17 km dua lapisan.

pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan

Calon dari garisan khatulistiwa manakala 8 hingga 9 km di kawasan kutub. haruslah menjawab ciri lapisan troposfera dari 13 Lapisan tropopaus di khatulistiwa mengalami kejatuhan suhu mengikut ketinggian segi jarak dari aras laut sehingga –80 °C, manakala lapisan tropopaus di kutub mengalami kejatuhan suhu ialah 0-18 km, gas utama mengikut ketinggian sehingga –60 °C.

ialah oksigen dan karbon dioksida, manakala 14 Berasaskan mekanisme pertukaran tenaga, lapisan troposfera dibahagikan ciri lapisan stratosfera kepada: dari segi jarak dari aras (a) Lapisan laminar (lurus): Merupakan lapisan antara muka bumi dengan laut ialah 18-50 km, atmosfera bawah. Pemindahan tenaga berlaku di lapisan ini secara pengaliran gas utama ialah ozon lurus.

dan klorofluorokarbon, (b) Lapisan geseran (berpusar): Berada di atas lapisan laminar iaitu pada dan lapisan pemisah ketinggian 1 000 meter dari aras laut. Di dalam lapisan ini, semua pemindahan antara lapisan troposfera haba secara menegak berlaku secara turbulens atau pergerakan secara dan stratosfera ialah pusaran. tropopaus. (c) Lapisan atmosfera bebas: Berada di atas lapisan geseran. Terdapat pergerakan udara yang bebas dari sebarang kesan geseran permukaan bumi Info Ilmu BAB yang tidak rata.

Di lapisan ini pergerakan angin adalah sangat kencang kerana tidak mengalami sebarang kesan geseran. Stratosfera meliputii BAB kawasan yang bermula Stratosfera BSAMPELABdari lapisan troposfera (antara ketinggian 1 Perkataan stratosfera berasal dari bahasa latin “Stratum” yang bermaksud 10 - 16 kilometer, iaitu perlapisan yang menghuraikan sifat semula jadinya yang berstrata dan tanpa bergantung kepada perolakan. latitud) sehingga ke lapisan mesosfera (lebih 2 Stratosfera merangkumi kawasan bermula daripada lapisan troposfera (ketinggian kurang 50 kilometer).

10 hingga 16 pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan, bergantung kepada latitud) sehingga lapisan mesosfera (lebih kurang 50 km). Suhu stratosfera akan meningkat dengan altitud 3 Suhu stratosfera meningkat dengan altitud (ketinggian) disebabkan oleh kehadiran kerana kehadiran lapisan lapisan ozon pada ketinggian 25 km.

ozon pada ketinggian 25 kilometer. 4 Molekul ozon menyerap sinaran ultra-lembayung dari matahari menyebabkan suhu meningkat pada aras tersebut (maksimum ~270 Kelvin di sempadan atas Molekul ozon menyerap stratopaus), dan pada masa yang sama melindungi bumi daripada sinaran uv. sinaran ultra-lembayung (uv) dari matahari 5 Di bahagian stratosfera paling bawah, halaju angin cenderung berkurangan apabila menyebabkan suhu altitud (ketinggian) meningkat.

Manakala di bahagian stratosfera atas halaju angin meningkat pada aras berkenaan meningkat semula mengikut ketinggian. tersebut (maksimum ~270 Kelvin di sempadan atas stratopaus), dan pada masa yang sama melindungi bumi daripada sinaran uv.

Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera 3 BAB Info Ilmu 6 Umumnya angin tersebut menjadi angin timuran pada musim panas dan angin baratan pada musim sejuk. BAB Stratosfera menganjur keluar dari troposfera 7 Lapisan stratosfera adalah sangat kering dan tidak mengandungi awan serta tidak dengan ketebalan kira-kira mengalami fenomena cuaca. Stratosfera mengandungi sejenis gas yang sangat 40 km.

Suhu stratosfera penting iaitu gas ozon (O3). agak tetap, iaitu kira-kira –50 °C hingga –57 °C. Oleh 8 Ozon adalah salah satu daripada gas-gas yang membentuk atmosfera dan terdapat di lapisan stratosfera.

Ozon terdiri daripada molekul triatom oksigen (O3) yang 1 kerana suhu ini di bawah terikat antara satu sama lain dalam bentuk ikatan kovalen. takat sejukbeku air, tiada awan yang terdapat di 9 Ikatan gas-gas ozon ini akhirnya membentuk lapisan ozon yang tebal yang lapisan ini. mampu berfungsi menyerap, menyerak, menapis, dan memantul sinaran ultra- Walau bagaimanapun, lembayung(UV) daripada terus menembusi lapisan troposfera bumi. di sini terdapat angin berhalaju tinggi yang 10 Oleh sebab itu lapisan ozon yang wujud di antara stratosfera dan mesosfera bertindak untuk melindungi bumi daripada sinaran ultra-lembayung yang 2 disebut “aliran jet”.

Angin berlebihan. Rujuk Rajah 1.3. ini bertiup ke timur BAB atau barat pada aras -80 -60 -40 -20 0 20 40 60 80 ºCelsius Lapisan Stratosfera merupakan yang berlainan. Angin 120 lapisan kedua selepas troposfera. ini lazimnya membantu 110 Lapisan ini sangat istimewa kerana pergerakan kapal terbang 100 ia memiliki lapisan ozon (ozon jet.

9900 layer) yang bersempadan dengan 80 lapisan mesosfera. Lapisan ozon 3 Penglihatan di lapisan 70 yang terdiri daripada triatom stratosfera jelas dan 60 oksigen berfungsi menyerap, melancarkan pergerakan 50 menyerak, memantul, dan menapis kapal terbang kerana 40 sinaran UV daripada terus tiba ke terletak di atas lapisan 30 permukaan bumi. Oleh sebab itu yang terlibat dalam aktiviti 20 lapisan ozon bertindak melindungi cuaca.

10 seluruh hidupan di bumi. 4 BAB STPM 2020 S1(b) BAB INPUT STPM (2020) ▲ Rajah 1.3 Kedudukan lapisan ozon dalam stratosfera. BAB5 Soalan 1 (b): Huraikan 11 Jumlah ozon dalam atmosfera berubah mengikut lokasi geografi dan musim. fungsi lapisan troposfera BAB dan stratosfera. 12 Ozon disukat dalam unit Dobson (Du). Contohnya, 300 Du setara dengan 3 mm tebal lapisan ozon yang tulen jika dimampatkan ke tekanan paras laut.

Huraian: Soalan ini menghendaki calon 13 Sebahagian besar ozon stratosfera dihasilkan di kawasan tropika dan diangkut menghuraikan fungsi ke latitud yang tinggi dengan skala besar putaran atmosfera semasa musim sejuk hingga musim bunga. Umumnya kawasan tropika memiliki ozon yang 6 lapisan troposfera dan rendah. stratosfera. Calon haruslah menjawab fungsi lapisan 14 Molekul ozon juga tidak stabil dan ikatan kovalen ozon akan terurai kepada troposfera ialah mengawal molekul O2 dan satu atom oksigen apabila terkena sinar lambayung (UV).

Proses suhu atmosfera melalui berkekalan tersebut dikenali sebagai kitaran ozon-oksigen. penyerapan, penyerakan dan pemantulan haba 15 Kitaran ini mampu dihentikan oleh atom klorin, florin, atau bromin dalam atmosfera; bahan ini didapati dalam sebatian stabil terutama klorofluorokarbon 7 matahari oleh wap air, yang mampu sampai ke stratosfera dan terurai oleh sinaran lambayung habuk, debu, awan berkenaan.

dan bahan-bahan SAMPEL terampai dan fungsi lapisan stratosfera ialah mengawal kadar kemasukkan sinaran ultra lembayung dari matahari ke dalam atmosfera bumi bagi mengurangkan kepanasan suhu atmosfera. 4 Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera 16 Kitaran NOx bagi pembentukan ozon juga boleh diganggu oleh air di paras atmospherik, menukar NOx kepada bentuk yang lebih stabil.

Rujuk Rajah 1.4. Penghasilan ozon 0 + 03 1 Cahaya Ultra- 02 2 Lembayung 3 02 0 4BAB 03 + 5 6 Pemusnahan ozon 7 ▲ Rajah 1.4 Pembentukan dan pemusnahan ozon.

Mesosfera BAB 1 Mesosfera berasal dari perkataan Greek iaitu “meso” yang bermaksud pertengahan. Info Ilmu BAB Mesosfera berada di atas lapisan stratosfera hingga ke ketinggian 80 km dari permukaan bumi. Mesosfera ialah BAB lapisan udara ketiga. 2 Mesosfera dianggap sebagai permulaan bahagian atas atmosfera. Di lapisan ini Suhu atmosfera akan BAB suhu mulai menurun semula mengikut ketinggian dan mencapai paras –90 °C berkurangan apabila di lapisan mesopaus, iaitu lapisan mesosfera yang paling tinggi dan menjadi pertambahan altitud sempadan dengan lapisan termosfera di atasnya.

sehingga ke lapisan keempat termosfera. 3 Lapisan mesosfera amat penting kepada manusia untuk mengelakkan meteor jatuh ke bumi kerana bahan meteor mula terbakar dan dihancurkan di lapisan ini. Zarah udara yang terdapat di sini akan 4 Mesosfera merupakan lapisan udara ketiga, di mana suhu atmosfera akan berku- mengakibatkan berlaku rangan dengan pertambahan altitud sehingga ke lapisan keempat termosfera.

pergeseran dengan objek yang datang dari angkasa 5 Zarah udara yang terdapat di lapisan ini akan mengakibatkan berlaku pergeseran dan menghasilkan suhu objek yang datang dari angkasa dan menghasilkan suhu yang tinggi. Kebanyakan yang tinggi. meteor yang sampai ke bumi biasanya terbakar di lapisan ini. Kebanyakan meteor yang 6 Mesosfera terletak di antara 50 km hingga 80 km dari permukaan bumi, manakala sampai ke bumi biasanya suhunya berkurang dari (18 °C hingga –90 °C).

Tekanan udara di mesosfera terbakar di lapisan ini. adalah sangat rendah iaitu berkurangan dari 0.6 mb pada ketinggian 60 km kepada 0.01 mb pada ketinggian 80 km. BAB 7 Suhu berkurangan mengikut ketinggian apabila ketinggian atmosfera mencapai BSAMPELAB 80 km iaitu sehingga mencapai –90 °C. 8 Di kawasan ini, wujud awan noktilusen. Awan noktilusen adalah sejenis awan yang sangat nipis dan lembut sehingga tidak boleh dilihat dengan mata kasar.

9 Awan ini hanya boleh dilihat apabila terdapat taburan cahaya yang disebabkan oleh molekul air pada waktu malam di musim panas, iaitu sekurang-kurangnya sejam selepas matahari terbenam.

10 Zarah awan berkenaan terdiri daripada ais yang berasal daripada habuk meteor yang dibawa ke atas oleh wap air melalui perolakan peringkat tinggi. Proses perolakan ini terjadi akibat pengurangan suhu secara menegak mengikut ketinggian di mesosfera. Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera 5 11 Ais yang berasal daripada zarah habuk meteor berkenaan mencair dan mengewap selepas melalui atmosfera dalam jumlah yang sangat banyak.

Partikel-partikel ais tersebut mengalami turbulens dua-dimensi yang membentuk awan noktilusen, iaitu awan yang sangat nipis dan terang ketika dilewati sinar matahari dan merupakan awan tertinggi dari permukaan laut.

BAB Info Ilmu Termosfera BAB1 Lapisan termosfera 1 Lapisan termosfera terletak di atas mesosfera dan di bawah eksosfera. Lapisan terletak di atas mesosfera termosfera bermula kira-kira 80 km dari permukaan bumi hingga 500 km ke BAB dan di bawah eksosfera. 1 000 km. Termosfera merupakan lapisan teratas atmosfera iaitu eksosfera bermula. Lapisan ini hanya BAB mempunyai sedikit udara. 2 Lapisan ini hanya mempunyai sedikit sahaja udara.

Fenomena aurora (tirai cahaya) terhasil di sini kesan daripada tindak balas angin suria dengan medan BAB2 Fenomena aurora (tirai magnet bumi. Di lapisan ini sinaran ultra-lembayung akan menyebabkan berlaku cahaya) terhasil di sini pengionan. BAB kesan daripada tindak balas angin suria dengan 3 Perbezaan suhu antara siang dan malam melebihi 100 °C. Di bahagian lapisan medan magnet bumi. paling bawah termosfera dipenuhi dengan gas nitrogen dan oksigen dalam bentuk Di lapisan ini juga sinaran molekul asal.

UV akan menyebabkan 4 Suhu di sini amat tinggi sehingga mencapai hampir 1 200 °C akibat sinaran 3 pengionan menghasilkan matahari dan aktiviti pengionan. Suhu meningkat mengikut ketinggian pada kadar ionosfera. perlahan. Lapisan termosfera bermula kira 80 km di atas 5 Jumlah molekul oksigen semakin bertambah dan melebihi molekul nitrogen permukaan bumi hingga apabila ketinggian melebihi paras 200 km.

antara 500-1000 km iaitu 6 Di lapisan termosfera suhu akan meningkat mengikut ketinggian sehingga 4 lapisan teratas atmosfera, mencapai 1 200 °C disebabkan oleh daya penyerapan sinaran ultra-lembayung eksosfera bermula. yang tinggi oleh molekul oksigen.

Suhu di sini amat tinggi akibat sinaran matahari 7 Kuasa penyerapan molekul oksigen terhadap sinaran ultra-lembayung di lapisan dan aktiviti pengionan ini sangat penting untuk melindungi manusia daripada keterikan bahangan sehingga boleh mencapai matahari. 5 hampir 2000°C. 8 Atmosfera semakin dipengaruhi oleh bahangan suria dalam bentuk sinaran X dan sinaran lembayung yang menyebabkan berlaku proses pengionan pada paras 6 melebihi 100 km hingga 500 km.

7 9 Proses pengionan akan menyebabkan berlaku pemisahan elektron bercas negatif daripada atom oksigen dan molekul nitrogen. BAB 10 Oleh sebab itu pada ketinggian melebihi 100 km lapisan termosfera dipenuhi oleh ion-ion yang boleh memantulkan gelombang radio yang sangat penting untuk satelit telekomunikasi. Lapisan tersebut dikenali sebagai ionosfera. 11 Lapisan ionosfera adalah lapisan bahagian atas termosfera sebelum bertemu dengan lapisan eksosfera.

Lapisan ionosfera bermula dari 100 km hingga 500 km dalam lapisan termosfera tersebut. 12 Kebanyakan satelit komunikasi yang mengorbit bumi berada di lapisan ionosfera. Misalnya gugusan satelit penentu kedudukan global atau (GPS) telah dibangunkan dan dilokasikan di lapisan ini bagi tujuan navigasi dan menentukan kedudukan di permukaan bumi.

13 Di dalam lapisan termosfera juga mengalami fenomena aurora. Aurora ialah fenomena cahaya terang yang berwarna-warni dapat dilihat di langit malam, SAMPEL 6 Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera biasanya di kawasan kutub. Oleh sebab itu dikenali sebagai “aurora kutub” (atau Info Ilmu 1BAB “aurora polaris”) oleh sesetengah saintis. 2 Fenomena Aurora 3BAB 14 Fenomena aurora di kutub utara dikenali sebagai aurora borealis yang dinamakan merupakan pemandangan 4 bersempena dengan nama Dewi Fajar Rom, Aurora, dan nama Greek untuk angin cahaya berwarna-warni 5BAB utara, Boreas.

yang hanya berlaku pada 6 waktu malam di kawasan 7BAB 15 Keadaan ini kerana di Eropah aurora kerap dilihat kemerah-merahan di ufuk utara yang berhampiran dengan seolah-olah matahari akan terbit dari arah tersebut.

kutub. BAB 16 Aurora borealis juga dipanggil cahaya utara, dan sering berlaku pada September Aurora juga dikenali sebagai BAB hingga Oktober dan Mac hingga April. ’The Northern Lights’. 17 Fenomena aurora yang berlaku di kutub selatan dikenali sebagai aurora australis Aurora terjadi kerana atau cahaya selatan.

Aurora australis mempunyai sifat-sifat yang serupa dengan berlaku solar storm aurora borealis. (ribut suria) di kawasan permukaan matahari atau 18 Aurora berlaku melalui perlanggaran elektron-elektron. Aurora berpunca dari akibat ketidakseimbangan elektron yang mempunyai tenaga 1-15 volt. cas pada zarah-zarah di kawasan lapisan fotosfera 19 Cahaya akan terhasil apabila elektron berlanggar dengan atom di ionosfera, terhadap matahari.

lazimnya di altitud 80 km hingga 150 km. Zarah- zarah bercas ini 20 Pancaran oksigen atom paling menonjol iaitu garis kehijauan pada 557.7 akan berlanggar dengan nanometer dan (terutamanya dengan elektron bertenaga lebih rendah pada altitud atom-atom di atmosfera lebih tinggi) garis merah tua pada 630.0 nanometer. seperti atom oksigen dan nitrogen apabila 21 Kedua-duanya merupakan peralihan berterusan untuk masa yang lama, yang memasuki kawasan menerangkan pencerahan dan penyuraman yang beransur-ansur (0.5-1 saat) sinar medan magnet bumi.

aurora. Perlanggaran ini akan 22 Banyak garis lain turut dapat diperhatikan, terutama garis dari molekul nitrogen menghasilkan pelbagai yang berlanggar dan berubah lebih pantas berbanding pancaran oksigen. warna cahaya mengikut kedudukan atom-atom Eksosfera dan Magnetosfera tersebut. 1 Eksosfera adalah lapisan teratas atmosfera bumi dan merupakan sempadan antara Perlanggaran zarah bercas atmosfera bumi dengan angkasa lepas.

Lapisan ini terletak antara 500 km hingga dengan atom oksigen 1 000 km dari permukaan bumi. boleh menghasilkan warna kuning kehijauan 2 Lapisan eksosfera dibentuk oleh gas dan atom oksigen, hidrogen dan helium (kira- sekiranya berkedudukan kira 1% daripadanya diionkan).

Atom helium neutral dan atom hidrogen boleh tidak berapa tinggi terbebas ke angkasa lepas kerana perubahan perlanggaran molekul berkenaan. dan warna merah jika mencapai jarak melebihi 3 Berhampiran dengan mesosfera pula atom hidrogen digantikan dengan pecahan lebih 200 batu. molekul wap-wap air dan metana.

Info Ilmu 4 Kekerapan zarah yang diionkan terus meningkat melalui eksosfera dan selepas melintasi ketinggian 2 000 km iaitu di lapisan magnetosfera yang berada pada Eksosfera merupakan ketinggian 4 000 km dan 20 000 km dari permukaan bumi, terdapat hanya elektron lapisan teratas di (negatif) dan proton (positif) yang dibentuk oleh angin suria. atmosfera bumi, dan merupakan sempadan 5 Zarah bercas ini tertumpu pada dua jalur yang dikenali sebagai jalur bahangan antara atmosfera bumi Van Allen atau plasmasfera.

dan angkasa lepas. pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan Lapisan magnetosfera wujud disebabkan medan magnet bumi yang terletak di sini.

Lapisan ini terletak di Lapisan ini yang bertindak sebagai perisai perlindungan, terletak pada ketinggian antara 500-1000 km 4 000 dan 20 000 km di atas permukaan bumi. hingga kira-kira 10,000 km dari permukaan bumi. Hampir tiada udara atau gas di lapisan ini. Satelit yang mengorbitbumi terletak di sini. BSAMPELAB Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera 7 1 7 Lapisan ini bertindak melindungi bumi daripada pancaran bahaya dari angkasa.

Pada ketinggian 80 000 km dari permukaan bumi, atmosfera bumi bercantum BAB dengan atmosfera matahari yang dikenali sebagai heliosfera. BAB2 Hasil Pembelajaran 8 Setiap planet mempunyai tarikan graviti masing-masing. Kutub utara dan selatan Menghuraikan ciri yang menghasilkan gelombang elektromagnetik.

kandungan atmosfera. 9 Bumi adalah contoh kewujudan kutub utara dan pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan selatan dengan kuasa STPM 2016 S2(b) polariti masing-masing. Tarikan antara dua polariti kutub ini menghasilkan apa yang digelar sebagai magnetosfera.

3 INPUT STPM (2016) 10 Selain bumi, planet yang lain seperti Utarid, Jupiter, Zuhal, Uranus, dan Neptun juga mempunyai magnetosferanya sendiri. BAB Soalan 2 (b): Huraikan unsur yang terkandung 1.3 Kandungan Atmosfera dalam lapisan atmosfera. 1 Atmosfera merupakan zon lapisan yang menyelubungi bumi serta terdiri daripada BAB Huraian: Soalan ini struktur tertentu.

Atmosfera juga berfungsi sebagai penghalang kepada sinaran ultra ungu yang berbahaya kepada hidupan. BAB4 menghendaki calon menghuraikan unsur 2 Sebahagian daripada proses kitaran hidrologi turut berlaku di atmosfera, iaitu BAB yang terkandung dalam pembentukan hujan dan kerpasan, sejatan dan sejat-peluhan. lapisan atmosfera. Calon haruslah menjawab 3 Atmosfera berperanan penting kepada hidupan di bumi kerana terdapat gas unsur yang terkandung seperti nitrogen (78%), oksigen (21%), argon (0.9%), karbon dioksida (0.03%), dan gas-gas lain seperti neon, helium, kripton, ozon, radon dan lain-lain 5 dalam lapisan atmosfera (0.003%).

ialah pelbagai gas, wap air, dan partikel-partikel 4 Gas-gas tersebut mempunyai kepentingan tersendiri. Nitrogen membekalkan terampai. Setiap unsur nitrat untuk pertumbuhan tumbuhan dan haiwan melalui proses edaran nitrogen.

yang dikemukakan perlu dijelaskan dari segi sifat 5 Pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan penting untuk hidupan di bumi untuk proses pernafasan. Karbon dioksida fizikalnya, komposisinya, penting untuk tumbuhan menjalankan proses fotosintesis. 6 jenis-jenisnya serta 6 Wap air di atmosfera membolehkan proses pemeluwapan yang membentuk hujan fungsi/peranan setiap dan air hujan penting untuk kehidupan. unsur tersebut terhadap fenomena cuaca.

7 Gas-gas dalam atmosfera juga penting untuk kegiatan perindustrian. Gas argon digunakan untuk tiub radio, industri memateri dan gas mentol. Gas nitrogen, 7 Pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan Ilmu oksigen, dan karbon dioksida digunakan dalam pelbagai jenis industri. Kandungan gas kekal dalam Atmosfera: 8 Selain itu gas-gas tersebut juga bertindak sebagai pengimbang kepada bajet haba BAB dunia.

Banyak cahaya ultraungu dipantul semula atau diserap oleh atmosfera bumi. 9 Ketika proses penapisan, lebih kurang 47% bahangan solar diterima daripada matahari supaya bumi tidak menjadi terlalu panas untuk tumbuhan, haiwan, dan manusia.

10 Karbon dioksida, wap air, dan awan menyerap gelombang panjang bumi untuk memanaskan lapisan atmosfera supaya bumi tidak menjadi terlalu sejuk. 11 Keadaan yang terlalu sejuk menghalang kehidupan di bumi meneruskan kelangsungan hidup. 12 Daripada segi kandungan atau komponennya, lapisan atmosfera semula jadi dibentuk oleh tiga komponen gas yang penting iaitu gas kekal, gas berubah, dan juzuk bukan gas.

Jenis Gas Isi padu SAMPEL (%) Nitrogen 78.09 Oksigen 20.95 Argon 0.93 8 Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera Komponen/Kandungan Atmosfera Komponen Gas Kekal 1 Komponen gas kekal terdiri daripada tiga gas utama iaitu nitrogen, oksigen, dan argon. Nitrogen dan oksigen membentuk kira-kira 99% isi padu atmosfera. 2 Daripada segi meteorologi gas nitrogen dan oksigen dianggap pasif.

Namun 1 begitu daripada segi kimia, gas oksigen adalah aktif dan bersedia bergabung dengan unsur-unsur yang lain. BAB 3 Argon pula adalah gas lengai dan daripada segi kimianya gas argon tidak bertindak balas dengan gas atau sebatian lain di atmosfera. 4 Nitrogen 2BAB (a) Nitrogen ialah unsur kimia di dalam jadual berkala yang mempunyai simbol 3 “N” dan nombor atom 7.

(b) Merupakan gas yang tak berwarna, tak berbau, tanpa rasa dan kebanyakannya lengai, dwi atom, dan bukan logam. (c) Merangkumi 78% atmosfera bumi dan merupakan juzuk dalam semua tisu hidupan. (d) Nitrogen membentuk banyak jenis sebatian penting seperti asid amino, ammonia, asid nitrik, dan sianida. 5 Oksigen BAB (a) Pada suhu dan tekanan biasa, oksigen didapati sebagai dua atom oksigen 4 dengan formula kimia O2. BAB (b) Oksigen merupakan gas yang dibebaskan oleh tumbuhan ketika proses fotosintesis dan diperlukan oleh haiwan untuk pernafasan.

(c) Oksigen membentuk ikatan kimia dengan hampir semua unsur lain, dan dari sinilah datangnya takrifan pengoksidaan. 6 Argon Info Ilmu 5BAB (a) Gas argon merupakan gas nadir.

Gas argon biasanya digunakan dalam lampu 6 berpendarfluor untuk mengelakkan filamen mentol teroksida dengan cepat, Gas-gas berubah yang 7BAB mentol tidak terbakar, dan tahan lama. terdapat di dalam (b) Argon juga mengelak permukaan mentol daripada menjadi hitam. atmosfera terhasil secara (c) Argon juga digunakan untuk mengelak oksigen dalam udara bertindak balas semula jadi dan terbentuk dengan logam panas ketika kerja pengimpalan sedang dijalankan. akibat aktiviti manusia.

Komponen Gas Berubah Jenis-jenis gas berubah yang sangat penting 1 Wap air dalam proses meteorologi (a) Wap air (dalam bentuk gas) di dalam atmosfera boleh berubah bentuk (perubahan cuaca) iaitu: menjadi cecair (air) dan pepejal (ais) setelah melalui proses-proses seperti • Wap air pemeluwapan dan pemejalwapan.

• Gas ozon (b) Jumlah wap air di dalam atmosfera sentiasa berubah-ubah. Misalnya 0% di • Karbon dioksida kawasan gersang dan bertambah menjadi 3% hingga 4% di kawasan Tropika BSAMPELAB Lembap. (c) Kandungan wap air dalam atmosfera berkait rapat dengan suhu udara dan ketersediaan air di permukaan bumi. (d) Oleh sebab itu peratus kandungan wap air di dalam amosfera di kawasan Tropika Lembap adalah tinggi ekoran daripada kadar sejat-peluhan yang tinggi dari permukaan air dari laut, sungai, tasik dan litupan tumbuhan yang tebal.

(e) Wap air dianggap tidak wujud pada ketinggian antara 10 ke 12 km dari permukan bumi. Keadaan ini berlaku kerana wap-wap air di dalam atmosfera Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera 9 BAB Info Ilmu dibekalkan oleh sejat-peluhan air dari permukaan bumi dan dibawa ke atas oleh angin (turbulens) yang aktif pada paras kurang dari 10 km dari permukaan BAB Karbon dioksida terhasil bumi.

daripada pembakaran (f) Fungsi wap air ialah untuk menghasilkan kerpasan dan penting untuk BAB bahan organik sekiranya menyerap, menyerak, menapis, memantul bahangan matahari daripada terus kehadiran oksigen dipancarkan ke permukaan bumi. BAB mencukupi. (g) Air (H2O) merupakan sebatian kimia yang boleh berada dalam bentuk cecair, pepejal dan gas. Formula kimia bagi air adalah H2O, iaitu setiap molekul air BAB Juga dihasilkan daripada mengandungi dua atom hidrogen dan satu atom oksigen.

(h) Hubungan terjadi antara elektron-elektron yang membentuk bahagian luar BAB1 pelbagai mikroorganisma atom dan merupakan mata rantai kuat yang dinamakan ikatan kovalen. kesan daripada penapaian BAB dan pernafasan selular. 2 Karbon dioksida (a) Karbon dioksida adalah gas atmosfera yang terdiri daripada satu atom karbon Tumbuhan menggunakan dan dua atom oksigen.

Karbon dioksida merupakan sebatian kimia yang karbon dioksida dikenali dengan formulanya CO2. semasa fotosintesis, (b) Merupakan komponen kedua penting dalam komponen gas berubah. Karbon dioksida memasuki atmosfera melalui tindakan organisma hidupan di lautan 2 menggunakan kedua- dan di daratan. dua karbon dioksida dan (c) Karbon dioksida penting kerana keupayaannya untuk menyerap bahangan oksigen untuk membina gelombang panjang dari permukaan bumi (bahangan terestrial).

karbohidrat. (d) Juga penting dalam proses fotosistesis. Tumbuhan menyerap karbon dioksida dan membebaskan oksigen yang digunakan oleh manusia untuk bernafas. Tumbuhan membebaskan (e) Justeru itu proses fotosistesis merupakan proses untuk mengekalkan imbangan oksigen ke atmosfera yang gas karbon dioksida dengan oksigen dalam atmosfera.

(f) Pada dekad kini, atmosfera mengandungi lebihan karbon dioksida yang 3 akan digunakan untuk dilepaskan oleh aktiviti manusia. pernafasan oleh haiwan, (g) Gas karbon dioksida dilepaskan ke udara dari aktiviti perindustrian dan asap manusia dan organisma- kenderaan yang menggunakan bahan api fosil seperti petroleum dan arang organisma lain.

batu. (h) Aktiviti pembakaran terbuka dan penyahhutanan yang akan menyebabkan Kehadiran gas karbon karbon dioksida terbebas ke udara. dioksida di atmosfera (i) Impak lebihan karbon dioksida terhadap peningkatan suhu dunia adalah sangat signifikan. Oleh sebab itu karbon dioksida dinamakan sebagai gas 4 bumi pada kepekatan rumah hijau (green house gases) memerangkap bahangan bumi (bahangan rendah dan bertindak terestrial).

sebagai gas rumah hijau. (j) Peningkatan suhu di seluruh dunia dikenali sebagai fenomena pemanasan global. Juga merupakan komponen utama dalam 3 Gas ozon kitaran karbon. (a) Gas ozon di dalam atmosfera banyak terdapat di ketinggian antara 15 hingga 35 kilometer dari permukaan bumi iaitu di lapisan stratosfera. 5 (b) Kandungan gas ozon di dalam atmosfera adalah sedikit iaitu kurang daripada 2 ppm berat udara atau hanya 0.00006% isi padu udara kering.

Info Ilmu (c) Gas ozon terdiri daripada tiga molekul oksigen (O3). Setiap molekul oksigen boleh bergabung dengan molekul oksigen lain yang tidak terurai dan 6 Gas ozon berperanan membentuk O3. untuk menapis, (d) Kadang-kala unsur oksigen juga boleh bergabung dengan N2 untuk menyerap, menyerak, membentuk nitrogen oksida apabila bertindak balas dengan cahaya sehingga dan memantulkan mampu membentuk ozon. bahangan suria (sinar ultra (e) Jumlah ozon dalam atmosfera berubah mengikut lokasi geografi dan musim.

ungu) daripada terus ke Ozon disukat dalam unit Dobson (Du). permukaan bumi. gas-gas SAMPEL 7 ozon membentuk lapisan ozon yang melindungi manusia daripada menerima sepenuhnya bahangan suria.

pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan

10 Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera (f) Contohnya, 300 Du setara dengan 3 mm tebal lapisan ozon yang tulen jika STPM 2020 S1(c) dimampatkan ke tekanan paras laut. INPUT STPM (2020) 1BAB (g) Sebahagian besar ozon stratosfera dihasilkan di kawasan tropika dan diangkut 2 ke latitud yang tinggi dengan skala besar putaran atmosfera iaitu semasa Soalan 1 (c): Jelaskan tiga 3BAB musim sejuk hingga musim bunga. aktiviti manusia yang 4 menyebabkan perubahan 5 (h) Umumnya kawasan tropika memiliki ozon yang rendah.

kandungan atmosfera. 4 Gas-gas lain Huraian: Soalan ini (a) Gas metana menghendaki calon (i) Merupakan gas yang terhasil melalui proses anaerobik (kurang oksigen) menjelaskan tiga di kawasan tanah lembap (tanah bencah) semula jadi seperti kawasan aktiviti manusia yang paya dan sawah padi.

menyebabkan perubahan (ii) Juga terhasil melalui proses pereputan dan penguraian haiwan, kandungan atmosfera. pembakaran biojisim. Calon haruslah menjawab (b) Nitrus oksida tiga aktiviti manusia yang (i) Gas ini terhasil oleh mekanisme biologi di lautan dan di dalam tanah. menyebabkan perubahan Juga dihasilkan menerusi pembakaran bahan api industri, kenderaan, kandungan atmosfera kapal terbang dan penggunaan baja kimia. ialah aktiviti perindustrian, (ii) Akan dimusnahkan apabila tindak balas foto kimia berlaku di lapisan aktiviti pembinaan dan stratosfera dan jangka hayat pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan kira-kira 132 tahun.

aktiviti pertanian. (c) Klorofluorokarbon (CFC) (i) Gas ini memasuki atmosfera melalui aktiviti manusia seperti dari BAB penggunaan bahan penyembur (aerosol), peti sejuk, alat pendingin hawa, bahan pencuci, dan pelarut. Info Ilmu BAB (ii) Gas klorofluorokarbon sangat berbahaya kerana berupaya untuk menghakis lapisan ozon. Gas metana, nitrus oksida, (iii) Molekul CFC naik ke atmosfera dengan kadar perlahan dan bergerak ke dan klorofluorokarbon arah kutub seterusnya terlerai oleh proses foto kimia menjadi atom klorin.

dan gas karbon dioksida (iv) Atom klorin berupaya memutuskan ikatan kovalen oksigen dalam membentuk gas-gas ozon. rumah hijau (green house (v) Dianggarkan jangka hayat CFC di dalam atmosfera antara 55 hingga ke gases) yang berpotensi 116 tahun.

kepada peningkatan suhu dunia BAB Komponen Juzuk Bukan Gas Gas-gas tersebut berupaya untuk 6 1 Juzuk bukan gas dikenali juga sebagai aerosol. Juzuk bukan gas terdiri daripada memerangkap bahangan habuk, debu, dan zarah higroskopik (garam klorin yang terhasil menerusi sejatan yang dibebaskan oleh BAB air laut). bumi daripada dilesapkan ke angkasa. 2 Kepekatan juzuk bukan gas di dalam atmosfera adalah berbeza iaitu daripada Di samping gas-gas rumah 7 beberapa zarah sehingga kepada jutaan zarah bagi setiap meter padu udara.

hijau berkenaan, terdapat juga jenis gas reaktif 3 Juzuk bukan gas yang terampai di udara khususnya dalam keadaan udara kering yang dihasilkan oleh dinamakan sebagai partikel terampai (PM10). kitaran sulfur, nitrogen, dan halogen klorin 4 Partikel terampai terdiri daripada asap, jelaga, habuk, dan debu halus yang terhasil yang terdapat di dalam melalui pembakaran terbuka di kawasan pelupusan sampah, kebakaran hutan dan atmosfera.

juga letusan gunung berapi. Antaranya ialah nitrogen 5 Kehadiran PM10 sangat berkesan untuk menghasilkan fenomena jerebu yang dioksida, nitrit oksida, dan boleh mengurangkan jarak penglihatan. sulfur dioksida. Kehadiran gas-gas berkenaan pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan Di dalam situasi lain, kehadiran juzuk bukan gas khususnya partikel-partikel amat penting untuk terampai (PM10) boleh menyerakkan sinaran matahari sehingga langit kelihatan menghasilkan hujan asid.

bewarna kemerahan (perang). BSAMPELAB Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera 11 BAB 7 Proses serakan berkenaan dikenali sebagai Serakan Mie. Pada skala global sumber juzuk bukan gas ini mungkin 4 atau 5 kali lebih banyak berbanding dengan yang dikeluarkan oleh sumber tempatan dan wilayah. 8 Misalnya dianggarkan kira-kira 20,000 tan metrik setahun debu halus dilayangkan oleh angin di kawasan gurun sahara.

9 Debu halus berkenaan dimendapkan semula apabila halaju angin berkurangan. 1 Oleh sebab itu kehadiran debu halus di atmosfera adalah sekejap. 10 Partikel-partikel terampai (PM10) juga dimendapkan semula ke bumi akibat hujan. Hujan yang turun adalah dalam bentuk hujan asid. Selepas hujan langit kelihatan cerah (bersih) semula dari bahan-bahan partikel terampai. BAB2 1.4 Tenaga di Dalam Sistem Atmosfera: Info Ilmu Matahari sebagai Sumber Tenaga Utama BAB Tenaga suria memasuki atmosfera bumi pada 1 Matahari merupakan sebuah sfera besar yang terdiri daripada gas-gas bersinar.

BAB kadar 1,366 watt per meter Hidrogen merupakan komponen matahari yang besar, diikuti oleh helium. persegi (W/m2). BAB 2 Dianggarkan hidrogen mewakili 90% daripada jumlah kandungan matahari, 3 Faktor latitud, musim sementara helium mewakili 8%. BAB tahunan, dan cuaca akan mengurangkan 3 Punca tenaga matahari adalah hasil daripada pertukaran hidrogen kepada keperolehan tenaga pada helium di dalam pusat matahari.

paras bumi. 4 Pertukaran tersebut merupakan satu reaksi nuklear besar yang mengeluarkan Sebanyak 6% daripada jumlah haba bahangan yang besar, iaitu kira-kira 3.86 x 1033 ergs/saat.

4 sinaran suria tuju 5 Sistem bumi-atmosfera hanya menyerap satu nilai yang kecil sahaja, iaitu 1/2210 (penyuriaan) dipantulkan juta daripada jumlah daripada segi operasi seluruh sistem atmosfera ialah tenaga manakala 16% diserap haba dari matahari. lalu menghasilkan sinaran puncak pada khatulistiwa 6 Mengikut Prinsip Keabadian (Termodinamik), tenaga tidak boleh hilang atau yang berukuran 1,020 W/m² musnah tetapi boleh bertukar bentuk kepada bentuk lain seperti tenaga kinetik dan tenaga potensi.

5 apabila bergerak merentasi atmosfera. Bentuk-bentuk Tenaga di Dalam Atmosfera Keadaan atmosfera 1 Tenaga yang dikeluarkan oleh matahari dan dihantarkan melalui angkasa lepas ke purata (awan, debu, bumi dikenali sebagai tenaga elektromagnet/tenaga bahangan. dan pencemaran) akan mengurangkan jumlah 2 Tenaga ini merupakan sumber tenaga utama untuk menggerakkan semua proses penyuriaan pada kadar di dalam sistem bumi-atmosfera.

6 20% melalui pantulan dan 3 Jenis tenaga dibezakan dengan cara penghantaran tenaga, iaitu tanpa memerlukan 3% melalui penyerapan. sesuatu medium seperti yang dikehendaki oleh pengaliran atau perolakan. 7 4 Seterusnya tenaga bahangan matahari akan bertukar menjadi tenaga haba. BAB 5 Tenaga haba (Q) ialah tenaga yang dipindahkan antara dua sistem yang disebabkan oleh perbezaan suhu antara dua sistem tersebut.

6 Pengaliran haba berlaku apabila wujud perbezaan suhu antara dua sistem seperti Rajah 1.5. SAMPEL 12 Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera Panas Aliran Haba Sejuk (Suhu Rendah) (Suhu Tinggi) Sempadan ▲ Rajah 1.5 Pengaliran haba.

7 Ukuran unit tenaga haba ialah Joule (J). Pengaliran haba boleh juga diukur dengan Info Ilmu 1BAB Watt (W) atau Js–1. 2 Tenaga haba mengalir dari 3 8 Haba ialah tenaga yang dipindahkan. Haba yang dipindahkan ke sesuatu sistem kawasan yang bersuhu 4 dianggap positif manakala haba yang dikeluarkan dari sesuatu sistem dianggap tinggi ke kawasan yang 5 negatif.

Rujuk Rajah 1.6. bersuhu rendah. 6 7 Sistem Q Negatif (Haba keluar) Semua objek (jirim) BAB Q Positif (Haba masuk) mempunyai tenaga dalaman yang berkaitan ▲ Rajah 1.6 Pengaliran tenaga dalam sesebuah sistem. dengan pergerakan rawak atom dan molekul dalam 9 Sistem yang mengalami pertambahan suhu atau tenaga dikatakan menerima haba jirim.

Tenaga dalaman ini BAB atau pengaliran haba positif. berkadaran terus kepada suhu objek berkenaan. BAB 10 Sistem yang mengalami pengurangan suhu atau tenaga dikatakan kehilangan haba atau pengaliran haba negatif. Objek akan menukar BAB tenaga dalaman sehingga 11 Tenaga elektromagnet akan mengalami banyak perubahan setelah pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan suhu kedua-dua objek ruang atmosfera bumi.

sama apabila dua objek yang berlainan suhu 12 Berdasarkan hukum termodinamik, iaitu tenaga tidak boleh dicipta atau bersentuhan secara terma.

dimusnahkan, maka tenaga elektromagnet cuma berubah bentuk ke bentuk yang lain. Jumlah tenaga haba yang dimiliki oleh kedua-dua 13 Umpamanya, permukaan kolam yang kena tenaga elektromagnet akan menjadi objek adalah sama.

Proses beransur-ansur panas disebabkan oleh pertukaran tenaga elektromagnet kepada ini dinamakan sebagai tenaga haba rasa. pengaliran tenaga. 14 Pada masa berkenaan, proses sejatan akan berlaku di permukaan air kolam tersebut BAB disebabkan oleh pemanasan haba. BSAMPELAB 15 Wap-wap air yang naik dan masuk ke dalam atmosfera akan membawa tenaga haba sebagai tenaga haba pendam. 16 Lama-kelamaan kawasan kolam air akan menjadi terlalu panas dan terbentuk satu kawasan tekanan rendah.

17 Udara yang sejuk akan masuk ke dalam sel tekanan rendah itu sebagai tenaga kinetik yang bergerak. 18 Akhirnya, wap-wap air yang naik ke atas akan membentuk awan yang terapung- apung di atmosfera sebagai tenaga keupayaan. 19 Wap-wap air akan bertukar menjadi titisan-titisan air yang jatuh sebagai kerpasan apabila berlaku proses pemeluwapan.

Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera 13 BAB 20 Pada peringkat ini tenaga keupayaan ditukar menjadi tenaga kinetik. Dalam cara begini tenaga sentiasa bertukar-tukar bentuk di dalam sistem bumi-atmosfera. BAB 21 Oleh sebab itu, di dalam sistem atmosfera terdapat empat bentuk tenaga iaitu: BAB (a) Tenaga kinetik (i) Merupakan tenaga yang terhasil di dalam objek yang bergerak. BAB (ii) Di dalam atmosfera tenaga kinetik terhasil akibat pergerakan atmosfera BAB1 itu sendiri seperti tiupan angin.

(b) Tenaga keupayaan BAB (i) Merupakan tenaga potensi yang “tersimpan” dalam sesuatu objek. (ii) Misalnya tenaga yang disimpan oleh titisan-titisan air di dalam awan BAB sebelum jatuh ke bumi sebagai hujan. (c) Tenaga haba pendam 2 (i) Merupakan tenaga haba yang diserap dan disimpan di dalam sesuatu objek.

Tenaga ini akan dibebaskan apabila berlaku perubahan pada objek tersebut. (ii) Contohnya tenaga haba yang diserap oleh pepejal (ais) semasa proses pembekuan. Tenaga ini akan dibebaskan semula apabila berlaku pencairan. 3 (iii) Tenaga haba pendam akan berpindah dari suatu tempat ke tempat yang lain disebabkan oleh pertukaran fasa air. (iv) Perubahan tersebut bergantung kepada jenis fasa yang berubah, iaitu sama ada haba diserap atau dikeluarkan.

(v) Contohnya dalam proses pertukaran cecair kepada gas (600 kal g-1 haba 4 pendam dibebaskan) dan pepejal kepada gas (678 kal g-1 haba pendam dibebaskan). Manakala 77 peratus haba pendam wujud dalam proses pengaliran dan perolakan. (d) Tenaga haba rasa (terma) (i) Haba rasa (sensible heating) ialah tenaga yang dialirkan dari satu jisim ke satu jisim yang lain apabila berlaku perbezaan suhu.

5 (ii) Sebanyak 23 peratus tenaga haba rasa wujud bersama angin dan air. (iii) Tenaga haba rasa mengalir dari kawasan bersuhu tinggi ke kawasan bersuhu rendah.

(iv) Suhu tenaga dalaman kedua-dua objek akan bertukar apabila dua objek yang berlainan suhu bersentuhan secara terma. (v) Jumlah tenaga yang dipindahkan adalah sama dengan jumlah tenaga 6 yang ditukar. Misalnya permukaan air yang menerima tenaga matahari menyebabkan air beransur-ansur menjadi panas. Kepanasan air tersebut boleh kita rasai.

Pemindahan Tenaga Haba di Dalam Atmosfera 7 1 Rupa bentuk jirim yang menjadi modul dalam proses pemindahan tenaga haba di dalam atmosfera terdiri daripada pepejal, cecair, dan gas.

2 Jirim terdiri daripada zarah-zarah atau molekul-molekul yang boleh berubah bentuk kepada pepejal, cecair atau gas dan sebaliknya. Semasa berlaku perubahan bentuk jirim dari satu fasa ke fasa yang lain maka serentak dengannnya akan berlaku pula proses pemindahan dan pertukaran bentuk tenaga. 14 Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera SAMPEL 3 Jadual 1.2 merujuk kepada perbezaan sifat-sifat jirim. Bentuk/ Pepejal Cecair Gas Sifat Keadaan Bergetar sekitar Bergerak secara rawak Bergerak secara bebas dan rawak 1 gerakan atom kedudukan keseimbangan dengan kelajuan sederhana dengan kelajuan sangat tinggi Susunan atom Teratur dan rapat Tidak teratur, jarak antara Tidak teratur atom jauh Jarak antara atom terlalu jauh BAB Daya tarikan/ Kuat Sederhana Sangat lemah tolakan Bentuk Tegar, isi padu serta bentuk Tiada bentuk tetap Tiada bentuk tertentu (mengikut 2 tertentu seperti ketulan/ Isi padu malar (mengikut bentuk bekas).

Contoh oksigen. 3 bongkah ais bentuk bekas). 4BAB Contohnya air. 5 6 ▲ Jadual 1.2 Sifat-sifat jirim. 4 Pemindahan tenaga haba di atmosfera berlaku melalui lima cara iaitu: BAB (a) Konduksi/pengaliran (i) Konduksi ialah pengaliran haba dari satu jasad ke jasad yang bersentuhan BAB dengannya. (ii) Haba dipindahkan disebabkan oleh salah satu jasad tersebut mempunyai BAB zarah atau molekul yang lebih bertenaga berbanding dengan zarah atau molekul dalam jasad yang kedua.

(iii) Sebahagian daripada aliran tenaga antara permukaan bumi dengan atmosfera dialirkan melalui konduksi (proses tenaga haba dipindahkan melalui sentuhan dengan molekul berdekatan). (iv) Konduksi lebih cepat berlaku apabila ada konduktor (pengalir haba) seperti batu. (v) Manakala bahan seperti kayu dan udara adalah konduktor yang lemah yang tidak mengalirkan haba. (vi) Proses pengaliran haba berlaku dari molekul bersuhu tinggi ke molekul bersuhu rendah seperti Rajah 1.7.

Aliran Haba BAB Suhu Tinggi Suhu Rendah (TenagaTinggi) (Tenaga Rendah) ▲ Rajah 1.7 Konduksi atau pengaliran haba. 7 (vii) Satu contoh proses pengaliran haba ialah apabila kita memanaskan hujung BSAMPELAB sebatang besi dalam tempoh tertentu. (viii) Lama-kelamaan keseluruhan batang besi mengalami kepanasan hingga ke bahagian hujung. (ix) Keadaan ini disebabkan oleh berlaku proses pengaliran haba antara molekul-molekul di dalam batang besi tersebut sehingga seluruh molekul- molekul di dalam batang besi menjadi panas.

Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera 15 BAB1 (x) Kuantiti haba yang dipindahkan dalam proses pengaliran bergantung kepada beberapa faktor yang berikut: BAB2 Info Ilmu – Masa.

Lebih banyak haba dipindahkan apabila lebih lama masa Contoh pemindahan haba diambil dalam proses perpindahan/pengaliran. BAB secara perolakan ialah – Perbezaan suhu. Perbezaan suhu yang besar antara dua sistem atau di dalam kejadian hujan dua jasad akan menyebakan lebih banyak haba dialirkan. Haba tidak BAB perolakan.

mengalir jika perbezaan suhu ialah sifar. – Luas keratan rentas. Pengaliran haba bertambah dengan pertambahan BAB Hujan ini berlaku luas keratan rentas jasad yang bersentuhan. – Panjang atau jarak. Jika haba dipindahkan melalui satu jarak yang BAB3 apabila permukaan panjang, maka jumlah haba yang dipindahkan lebih kecil.

bumi dipanaskan oleh bahangan matahari. (b) Perolakan Udara di bahagian atas (i) Perolakan berlaku disebabkan oleh perubahan ketumpatan cecair dan gas dipanaskan terlebih yang berpunca daripada perubahan suhu. dahulu melalui proses (ii) Bendalir (cecair dan gas) menjadi lebih ‘ringan’ apabila suhu bertambah perolakan haba. Kesannya akibat pemanasan. 4 jasad air di permukaan (iii) Contohnya apabila air atau gas dipanaskan, maka isi padu akan bertambah bumi (tasik,sungai,paya, dan ketumpatan akan berkurangan.

dan laut) akan berubah menjadi wap. (iv) Keadaan ini menyebabkan bendalir yang lebih panas ditolak ke atas dan bendalir yang sejuk ditolak ke bawah mengambil tempatnya. Udara panas tersebut akan mengembang dan (v) Bendalir yang sejuk akan dipanaskan dan ditolak ke atas. Dengan ini satu aliran berterusan berlaku yang dikenali sebagai arus perolakan.

5 menjadi lebih ringan lalu naik ke atas., udara panas (vi) Haba yang dipindahkan melalui bendalir dengan cara demikian dikenali tadi akan mengalami sebagai perpindahan secara perolakan. penyejukan adiabatik dan bertukar menjadi awan (vii) Di dalam atmosfera, udara yang dipanaskan oleh tenaga haba matahari apabila sampai ke paras akan mengembang dan bergerak ke atas disebabkan wujud proses pemeluwapan.

perolakan. 6 Awan bertambah besar (viii) Kumpulan udara yang mengembang dan naik ini membentuk bungkusan dan berat dan akan turun udara (air parcell). sebagai hujan perolakan apabila sampai ke tahap (ix) Bungkusan udara akan mengalami penyejukan adiabatik (iaitu suhu di tepu.

dalamnya semakin menurun sehingga mencapai 0 °C) apabila bungkusan udara itu naik semakin tinggi. 7 (x) Pada tahap ini berlaku pula proses pemeluwapan. Manakala kumpulan BAB udara sejuk pula akan turun mengisi kekosongan yang ditinggalkan oleh kumpulan udara panas berkenaan bagi menghasilkan keseimbangan udara.

(xi) Proses ini berlaku kerana terdapat arus perolakan yang berperanan memindahkan tenaga haba dalam atmosfera. (c) Sinaran (radiation) atau bahangan (i) Sinaran ialah tenaga yang dibebaskan oleh bahan dalam bentuk gelombang elektromagnet atau photon.

(ii) Pemindahan haba oleh sinaran tidak memerlukan medium. Contohnya, haba dari matahari dipindahkan ke planet bumi melalui ruang vakum dan tidak memerlukan sebarang perantara (medium).

(iii) Pemindahan berlaku secara terus melalui sinaran atau bahangan. Semua pepejal, cecair dan gas membebaskan, menyerap atau memindahkan haba melalui sinaran pada tahap yang tinggi.

(iv) Sinaran haba dianggap suatu fenomena permukaan untuk bahan pepejal seperti logam, kayu, dan batu kerana sinaran haba yang dibebaskan daripada bahagian dalam bahan tidak sampai ke permukaan. SAMPEL 16 Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera (v) Manakala sinaran yang terkena permukaan bahan di berkenaan diserap Info Ilmu 1BAB oleh beberapa mikron sahaja (10-6m). 2 Angin lintang merupakan 3BAB (vi) Permukaan yang gelap akan menyerap haba dengan lebih baik dan lebih angin yang bertiup secara 4 banyak berbanding dengan permukaan yang berkilat dan cerah.

melintang daripada arah 5 perjalanan. 6 (vii) Permukaan yang gelap boleh menyerap lebih kurang 97% sinaran haba berbanding dengan permukaaan yang berkilat iaitu cuma menyerap 10% Angin lintang boleh dikira sahaja.

dengan mendarabkan kelajuan angin dengan (viii) Permukaan yang menyerap kesemua sinaran dikenali sebagai blackbody. sinus bagi sudut antara (ix) Semua objek menyerap dan membebaskan sinaran haba pada masa yang angin lintang dengan arah sama. Jumlah haba yang diserap dan yang dibebaskan mesti seimbang. perjalanan. (x) Namun sekiranya jumlah haba yang dibebaskan melebihi haba yang diserap maka sesuatu jasad berkenaan akan mengalami pengurangan BAB suhu.

(xi) Manakala jika jumlah haba yang diserap melebihi haba yang dibebaskan, BAB jasad akan mengalami pertambahan suhu. (xii) Penyerap sinaran haba yang baik juga membebaskan sinaran haba dengan BAB baik.

(xiii) Sebaliknya penyerap sinaran haba yang tidak baik juga tidak membenarkan sinaran haba dibebaskan dengan sempurna. (d) Alir lintang (i) Tenaga haba dipindahkan secara mendatar oleh pergerakan angin.

Contohnya edaran angin dunia iaitu angin selatan memindahkan udara panas di khatulistiwa ke arah kutub di hemisfera utara bagi menghasilkan keseimbangan haba global.

(ii) Sistem angin dunia ialah udara yang bergerak yang diakibatkan oleh putaran bumi (kesan Coriolis). (iii) Angin juga bertiup disebabkan oleh pemanasan tidak sekata di permukaan bumi yang mengakibatkan perbezaan tekanan udara (angin akan bertiup dari tekanan tinggi ke tekanan rendah).

Semasa angin bertiup, angin akan memindahkan haba di sekitarnya. (e) Pemindahan haba pendam (i) Merujuk kepada tenaga haba yang diserap oleh ais yang cair atau sejatan air di sesuatu lokasi.

(ii) Haba akan dibebaskan ke tempat lain di dalam atmosfera apabila wap air terpeluwap atau membeku kemudiannya. BAB 7 BSAMPELAB Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera 17 1Praktis STPM Soalan Struktur 1 Soalan Sebenar STPM 1 (a) Lengkapkan ciri lapisan troposfera dan stratosfera dalam jadual yang berikut. BAB Lapisan Jarak dari aras laut Gas utama Lapisan pemisah antara dua lapisan 2 Troposfera BAB Stratosfera [5] 3 (b) Huraikan fungsi lapisan yang berikut: (i) Troposfera BAB 4 (ii) Stratosfera BAB BAB5 [4] [6] BAB (c) Jelaskan tiga aktiviti manusia yang menyebabkan perubahan kandungan atmosfera.

(i) 6 (ii) (iii) 7 BAB SAMPEL 18 Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera 2 Rajah 1 di bawah ini menunjukkan lapisan-lapisan atmosfera bermula dari permukaan bumi.

1 BAB (v) 2 BAB 400 km 3 BAB (iv) 300 km 4 BAB (iii) [5]BAB 50 km 5 (ii) 40 km (i) 10 km [15] [10] ▲ Rajah 1 Struktur lapisan atmosfera bumi.

6 (a) Kenal pasti lapisan-lapisan atmosfera berikut. (i) (ii) (iii) (iv) (v) Soalan Esei Soalan Sebenar STPM 1 (a) Dengan lakaran gambarajah, huraikan struktur utama atmosfera. (b) Huraikan unsur yang berkandung dalam lapisan atmosfera. STPM 2016 S2 BAB 7 BSAMPELAB Struktur, Kandungan dan Tenaga dalam Sistem Atmosfera 19 STPMKERTAS MODEL Bahagian A: Alam Sekitar Fizikal [40 markah] Jawab Soalan 1 dan satu soalan lain sama ada Soalan 2 atau Soalan 3.

1 (a) Takrifkan maksud atmosfera. [3] (b) Bagaimanakah lapisan troposfera berperanan untuk mencorakkan cuaca di permukaan bumi?

[4] (c) Jelaskan bagaimana lapisan atmosfera mengawal suhu di permukaan bumi. [4] (d) Jelaskan kesan negatif terhadap persekitaran fizikal apabila kandungan atmosfera berubah akibat daripada aktiviti manusia. SAMPEL [4] 502 Kertas Model STPM JAWAPAN BAB 1 Lapisan Mesosfera • Lokasinya adalah kira-kira 50 km hingga 80 km dari Soalan Struktur muka bumi.

Udara di dalamnya amat nipis dan suhu 1 (a) Jarak dari Lapisan pemisah di dalamnya semakin jatuh apabila semakin tinggi aras laut antara dua lapisan keangkasa sehingga mencecah negatif 80 °C. Di kawasan Lapisan Gas utama ini wujudnya awan noktilusen. Iaitu sejenis awan yang sangat nipis dan lembut sehingga ia tidak boleh Troposfera 0 – 18 km Oksigen/ dilihat dengan mata kasar.

Di lapisan ini berlakunya Karbon dioksida pemusnahan dan penghancuran meteorit (tahi bintang). Lapisan Termosfera Ozon/ Tropopaus • Lokasinya adalah antara 80 km hingga 100 km dari Stratosfera 18 – 50 km Kloroflurokarbon muka bumi. Suhunya meningkat (menjadi panas) dengan cepat apabila semakin tinggi. Ini kerana gas (CFC) oksigen dan nitrogen dalam lapisan ini menyerap banyak sinar lembayung matahari dan menukarkannya menjadi (b) (i) Mengawal suhu atmosfera melalui penyerapan, tenaga haba.

Lapisan tanpa gas. Lapisan Ekosfera penyerakan dan pemantulan haba matahari oleh wap • Iaitu lapisan teratas atmosfera bumi, sekaligus merupakan sempadan antara atmosfera bumi dan air, habuk, debu, awan dan bahan-bahan terampai. angkasa lepas. Lapisan ini terletak antara 500 -1000 km dari permukaan bumi.

Lapisan eksosfera dibentuk oleh (ii) Mengawal kadar kemasukan sinaran ultra lembayung gas dan atom oksigen, hidrogen dan helium (kira-kira 1% daripadanya diionkan). Atom helium neutral dan atau sinaran inframerah dari matahari ke dalam atom hidrogen boleh terbebas ke angkasa lepas kerana perubahan perlanggaran molekul berkenaan.

atmosfera bumi bagi mengurangkan kepanasan suhu (b) Unsur yang terkandung dalam lapisan atmosfera: atmosfera. Gas kekal nitrogen • Merupakan gas yang tak berwarna, tak berbau, tanpa rasa (c) (i) Aktiviti perindustrian melalui pembebasan asap dan kebanyakannya lengai, dwiatom dan bukan logam. • Ia meliputi 78% atmosfera bumi serta menjadi juzuk pembakaran bahan api fosil telah menambah kandungan dalam semua tisu hidupan dalam bentuk sebatian seperti asid amino, ammonia, asid nitrik dan sianida.

karbon dioksida, karbon monoksida dan gas nitrogen Gas kekal oksigen • Oksigen terdiri daripada dua atom dengan formula kimia ke dalam atmosfera. Keadaan ini menyumbang kepada O2.

• Terhasil menerusi tumbuhan ketika proses fotosintesis, fenomena hujan asid serta jerebu. dan diperlukan oleh haiwan untuk respirasi. Oksigen menjadi “nyawa” kepada manusia dan binatang. (ii) Aktiviti pembinaan bangunan, jalan raya dan • Kombinasi antara oksigen dengan unsur-unsur kimia yang lain akan menjadi ”oksida” seperti ferum + oksigen pembangunan bandar telah meningkatkan jumlah = ferum oksida, sulfur + oksigen = sulfur oksida.

Proses ini dinamakan sebagai pengoksidaan. bahan pepejal terampai dalam atmosfera seperti debu Gas berubah wap air • Merupakan sebatian kimia yang boleh berada dalam dan habuk. bentuk cecair, pepejal dan gas. • Formula kimia bagi air adalah H2O, yang membawa (iii) Aktiviti pertanian ladang telah menyebabkan pertam- maksud setiap molekul air mengandungi dua atom hidrogen dan satu atom oksigen.

bahan gas oksigen ke dalam atmosfera kerana pertam- • Di dalam atmosfera wap air (dalam bentuk gas) boleh berubah bentuk menjadi cecair (air) dan pepejal (ais) bahan tumbuh-tumbuhan ladang seperti getah, kepala setelah melalui proses-proses seperti pemeluwapan dan pemejalwapan. sawit, koko dan sebagainya membolehkan pembebasan Gas berubah karbon dioksida • Secara kimia gas karbon dioksida terdiri daripada satu atom gas oksigen yang lebih banyak ke dalam atmosfera.

karbon dan dua atom oksigen dengan formulanya CO2. 2 (a) Lapisan-lapisan atmosfera. Jawapan 505 (i) Troposfera (iv) Termosfera (ii) Strafosfera (v) Ekosfera (iii) Mesosfera Soalan Esei 1 1 (a) Struktur utama atmosfera ialah JSAMAWAPEPALN BAB Lapisan Troposfera • Lokasinya paling hampir dengan permukaan bumi. Kete- balannya berbeza-beza mengikut kawasan bumi iaitu 18 km di khatulistiwa dan 8 km di kutub.

Lapisan ini mengandungi gas oksigen, karbon dioksida, hidrokarbon, wap air dan lain-lain. Fenomena cuaca berlangsung di lapisan ini seperti ribut, kilat, petir, hujan, salji dan lain-lain.

Lapisan Stratosfera • Lokasinya adalah di atas lapisan Troposfera dan menganjur ke kira-kira 50 km dari permukaan bumi. Lapisan ini tidak berawan, kering dan lebih stabil. Ia dikenali sebagai Ozonsfera. Lapisan ini mengandungi gas ozon yang berfungsi menyerap sinar lembayung matahari dan seterusnya melindungi manusia, tumbuhan, dan haiwan daripada radiasi berlebihan sinaran. Lapisan ini amat sesuai untuk kapal terbang supersonik. GLOSARI A enam anggota ASEAN iaitu; (Malaysia, Indonesia, Negara Thai, Singapura, Filipina, dan Brunei), tiga negara anggota NAFTA Abiotik Komponen bukan hidupan dalam sesebuah ekosistem.

(Amerika Syarikat, Kanada, dan Mexico), dua anggota ANZAC (Australia dan New Zealand), negara perindustrian baharu Asia Air larian permukaan (Surface run off) Air yang mengalir di (Hong Kong, Taiwan, dan Korea Selatan) serta China, Jepun, permukaan bumi tanpa alur yang berlaku apabila semua liang pori Papua New Guinea, dan Chile.

tanah sudah penuh dan tepu dengan susupan air hujan. ASEAN Persatuan Negara-negara Asia Tenggara. (Association AFTA Kawasan Perdagangan Bebas ASEAN ialah satu bentuk Of Southeast Asian Nations) yang ditubuhkan melalui Deklarasi usaha sama dalam kalangan negara ASEAN untuk mengurangkan Bangkok 1967.

atau menghapuskan tarif/cukai bagi sesetengah barangan atau produk yang diperdagangkan dalam kalangan negara ASEAN. Atmosfera Lapisan udara yang terdapat di sekeliling bumi yang Tujuan utama AFTA ialah untuk memperkukuhkan kedudukan terdiri daripada gas, wap-wap air, dan partikel-partikel terampai. ASEAN dalam konteks pasaran serantau dan global. Awet segar Proses dingin beku hasil pertanian, perikanan, dan Aglomerasi industri Pengelompokan industri di satu kawasan penternakan sebelum dipasarkan untuk menjamin kualiti produk.

khas seperti di kawasan perdagangan bebas (FTZ) iaitu industri yang berkaitan diletakkan berdekatan antara satu sama lain bagi B tujuan memanfaatkan faedah ekonomi bidangan seperti faedah pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan bersama, perkongsian teknologi dan kepakaran, penjimatan Banjir kilat Limpahan air melebihi daya tampung sistem saliran kos pengangkutan, dan perkongsian pelbagai kemudahan asas.

yang berlaku dengan cepat terutamanya selepas hujan lebat. Sering terjadi di bandar-bandar besar. Fenomena banjir ini “cepat berlaku Agro pelancongan Aktiviti pelancongan yang berkaitan atau dan jangka hayatnya juga singkat”.

berasaskan sumber pertanian dan perikanan. Barometer Alat yang digunakan untuk mengukur tekanan Akta Kualiti Alam Sekeliling 1974 Akta atau perundangan udara. yang digubal untuk mengawal kemerosotan kualiti alam sekitar di Malaysia akibat aktiviti pembangunan dan ekonomi. Beban sungai Bahan atau muatan sungai seperti bahan ampaian, bahan larutan, dan bahan golekan Akuakultur Penternakan ikan, udang, mutiara, tiram, dan lain- lain sama ada di kawasan air tawar atau air payau seperti di Benteng Tembok yang dibina untuk mengawal hakisan cerun dalam kolam, sangkar, sungai, tasik, paya, muara, dan sebagainya.

oleh larian air permukaan, hakisan pantai oleh ombak, arus dan angin, hakisan tebing oleh air sungai. Benteng diperbuat daripada Alam sekitar budaya Alam sekitar yang dibuat atau dijana konkrit, “retanining wall”, guni pasir, dan dari groin dan gabion oleh manusia seperti petempatan bandar dan luar bandar, (sangkar dawai yang diisi batu).

jaringan pengangkutan dan telekomunikasi, guna tanah pertanian, perindustrian, dan sebagainya Biodiversiti (kepelbagaian biologi) Meliputi aspek kehidupan pelbagai spesies fauna dan flora. Termasuk habitat, ekosistem, Alam sekitar fizikal Alam sekitar semula jadi seperti bentuk dan rantaian makanan, kelangsungan genetik, kesuburan genetik, bumi (gunung, bukit, lembah, lurah), saliran (sungai, paya, ancaman kepupusan spesies, penghijrahan spesies, spesies yang tasik, laut), tumbuhan semula jadi (fauna dan flora) dan iklim serta dilindungi dan sebagainya.

cuaca. B.O.D (Biochemical Oxygen Demand). Satu indicator yang Aliran lumpur (mud flow) Lumpur yang mengalir menuruni digunakan untuk menunjukkan kadar pencemaran air yang cerun-cerun bukit. Lazimnya bergerak dalam alur atau lurah disebabkan oleh enfluen/sisa toksik dari kilang seperti sisa asid, tertentu seperti di dalam galur dan galir.

raksa, florin, sulfur, dan sebagainya. Sumber air yang mengandungi kandungan BOD yang tinggi menunjukkan air pergerakan aliran air di permukaan tanah melalui sungai dan anak sungai dinamakan tercemar Anemometer Alat yang digunakan untuk menyukat kelajuan dengan teruk.

angin. C Angin Merujuk kepada udara yang bergerak dari kawasan tekanan tinggi ke kawasan tekanan rendah. Celcius Skala metrik yang digunakan untuk menyukat suhu di sesuatu tempat/kawasan. Antisiklon Kawasan tekanan udara tinggi, iaitu garisan-garisan isobarnya adalah hampir bulat dengan tekanan tertinggi berada di Cerucuk Tiang kayu atau konkrit yang dipacakkan ke dalam pusatnya.

tanah untuk dijadikan sebagai asas binaan bangunan, jeti, jambatan dan lain-lain. APEC Kerjasama Ekonomi Asia Pasifik (Asia Pasifik Economic Cooperation) ialah satu pertubuhan separuh rasmi yang telah CFC (Klorofluorokarbon) Bahan kimia yang digunakan dalam dibentuk pada November 1989, di Canberra, Australia. Kini aerosol, peti sejuk, alat pendingin hawa yang berbentuk gas, dan APEC mempunyai 18 buah negara anggota yang terdiri daripada terbebas ke atmosfera hingga boleh memusnahkan lapisan ozon.

SAMPEL 548 Glosari • Berdasarkan Sukatan Pelajaran STPM Terkini • Kandungan menepati kehendak Sistem Peperiksaan Terkini STPM • Rujukan komprehensif untuk pelajar yang akan menduduki peperiksaan Geografi Kertas 2 (942/2) pada akhir Semester 2 Ciri-ciri utama buku ini: Buku-buku dalam siri ini: • Nota padat dan tepat dalam bentuk poin untuk memudahkan pembelajaran dan pemahaman • Lajur sisi yang bermuat dengan hasil pembelajaran, nota pengukuhan, ringkasan isi, dan tag soalan STPM tahun-tahun lepas • Jadual populariti soalan STPM tahun-tahun lepas • Praktis yang menepati piawai peperiksaan • Kertas model peperiksaan sebagai ujian persediaan • Ditulis oleh penulis yang berpengalaman luas serta berwibawa SASBADI SDN.

BHD. 198501006847 Hak cipta terpelihara. Tiada mana-mana bahagian daripada terbitan ini boleh diterbitkan semula, disimpan untuk pengeluaran, atau ditukarkan dalam sebarang bentuk atau dengan alat apa-apa pun jua, (Anak syarikat milik penuh Sasbadi Holdings Berhad 201201038178) sama ada dengan cara elektronik, mekanik, penggambaran, rakaman, dan sebagainya tanpa kebenaran daripada pemilik hak cipta terlebih dahulu.

Lot 12, Jalan Teknologi 3/4, Taman Sains Selangor 1, Kami berterima kasih kepada individu dan pertubuhan yang membenarkan kami menggunakan bahan Kota Damansara, 47810 Petaling Jaya, Selangor Darul Ehsan. mereka dalam penerbitan ini. Meskipun usaha untuk mengesan dan merakamkan penghargaan kepada Tel: +603-6145 1188 Fax: +603-6145 1199 pemilik hak cipta dilakukan dengan sepenuh hati, namun kami masih tidak berjaya menyampaikan Laman web: www.sasbadisb.com e-mel: [email protected] penghargaan kami kepada sesetengah pihak.

Kepada pihak yang berkenaan, kami meminta maaf secara © Sasbadi Sdn. Bhd. 198501006847 ikhlas. Kami mengalu-alukan sebarang maklumat yang membolehkan kami merakamkan penghargaan ISBN 978-983-77-24-56-3 kepada pemilik hak cipta dalam cetakan atau edisi yang akan datang. Sisipan Soalan Sebenar STPM: Hak cipta Kertas Soalan Teks diset dalam 11/13 pt Times PU21TGE2SAMPELISBN 978-983-77-24-56-3 © Majlis Peperiksaan Malaysia, Kementerian Pendidikan Malaysia Dicetak di Malaysia oleh Hak cipta Cadangan Jawapan Metrobay Industry Sdn.

Bhd 199701014606 © Sasbadi Sdn. Bhd. 198501006847 No. 12, Jalan 7/1 Kawasan Perindustrian Seri Kembangan 43300 Seri Kembangan, Selangor Darul Ehsan Semua cadangan jawapan disediakan oleh pihak penerbit.

Majlis Peperiksaan Malaysia tidak dipertanggungjawabkan terhadap sebarang kelemahan atau kesilapan jawapan tersebut. Sasbadi Group Semenanjung Malaysia : RM51.90 Sabah & Sarawak : RM54.90

Presentasi tugas TRR Siklus Hidrologi dan Daerah Aliran Sungai




2022 www.videocon.com