Senja datang mentari pun redup semburat nya berwarna

senja datang mentari pun redup semburat nya berwarna

Breaking News • Memilih Villa di Anyer untuk Libur Lebaran • Bersiap Seseruan di 9 Wahana Baru Dufan Tahun 2019 • Kereta Api dan Romantisme Perjalanan • Cimory Senja datang mentari pun redup semburat nya berwarna Day Out!

• Jejak Langkah di Raja Ampat • Malaysia, Tenggara Yang Patut Dikunjungi Sebelum Tua • Kyriad Muraya dan Setangkup Kenangan • Grand Keisha Hotel Yogyakarta • Tempat Makan dan Wisata Sejarah di Labuan • 4 Rekomendasi Tempat Menginap dan Hotel di Labuan Malaysia Panas, debu, dan alat berat, itu yang terbayang dalam benak hampir setiap orang ketika saya menyebut kata tambang.

Namun cobalah padankan kata tambang tersebut dengan nama Nusa Tenggara Barat dan jalan-jalan atau pelesiran, pasti yang dibayangkan sudah sedikit berbeda. Mungkin mulai hadir di pelupuk mata kita kemegahan sebuah tambang terbuka berdiameter ratusan meter, pulau-pulau kecil nan eksotis, deru ombak yang memecah di tepian pantai, romansa saat mentari kembali ke peraduan dan warna biru yang mewah di atas langit. Dan itu benar, sembilan hari memenuhi undangan Sustainable Mining Bootcamp (SMB) yang diselenggarakan oleh PT.

Newmont Nusa Tenggara di Sumbawa Barat, saya mendapatkan banyak sekali pengalaman yang luar biasa. Dalam suasana yang santai dan penuh keakraban, saya dan 26 peserta Sustanaible Mining Bootcamp 5 bukan hanya berkesempatan melihat dan mendapatkan informasi langsung kegiatan tambang namun juga keindahan berbagai tempat di Kabupaten Sumbawa Barat (KSB) dari tanggal 14 s.d.

22 Februari 2016. Beberapa tulisan saya tentang kegiatan tambang di PT Newmont Nusa Tenggara (PTNNT) di Batu Hijau sudah dituliskan di blog saya www.donnaimelda.com dari beragam aspek dan atau sudut pandang. Sejak perjalanan menuju Batu Hijau, proses penambangan, pengolahan menjadi konsentrat, penempatan tailing hingga dua rangkaian tulisan mengenai program tanggung jawab sosial yang dilakukan PTNNT untuk masyarakat lingkar tambang senja datang mentari pun redup semburat nya berwarna Kecamatan Jereweh, Maluk dan Sekongkang.

Namun tulisan kali ini sedikit berbeda, saya ingin mengajak pembaca sedikit bersantai-santai meski masih berbicara seputar tambang dengan berbincang seputar keindahan Kabupaten Sumbawa Barat. Tulisan ini adalah sudut pandang lain hasil kunjungan ke beberapa tempat wisata selama kegiatan bootcamp yang luar biasa padat itu sembari menengok beberapa infrastruktur dan fasilitas yang dibangun PTNNT di area lingkar tambang.

Tempat-tempat inilah yang kemudian membuat saya jatuh cinta pada Sumbawa Barat. • Teluk Benete Keindahan Teluk Benete ini saya nikmati sejak Kapal Cepat Tenggara Satu milik PTNNT yang membawa saya dari Pelabuhan Kayangan Lombok mulai memasuki perairan sekitar Sumbawa Barat.

Saya sangat menikmati birunya langit di atas Nusa Tenggara, begitu juga dengan gradasi warna biru permukaan air laut yang kadang biru tua, biru muda hingga biru kehijau-hijauan serupa tosca. Kecantikan laut dengan bukit-bukit yang menonjol ke arah laut mengingatkan saya dengan keindahan Laut Flores di Nusa Tenggara Timur. Musim yang sudah memasuki masa penghujan membuat bukit-bukit itu terlihat menghijau dan asri.

Kontras dengan warna bebatuan di bawahnya. Punggung bukit-bukit yang memanjang memancing imajinasi saya untuk berjalan menyusurinya. Lalu terbayang kesyahduannya saat sendiri berjalan menikmati hembusan angin di ketinggian dengan pemandangan lautan biru di bawahnya.

Sungguh sebuah eksotisme Nusa Tenggara yang selalu melekat dalam benak Di Teluk Benete inilah terdapat Pelabuhan Benete yang menjadi salah satu pintu gerbang untuk memasuki Pulau Sumbawa yang terletak di Provinsi Nusa Tenggara Barat selain Pelabuhan Poto Tano. Namun Pelabuhan Benete sesungguhnya memang bukan pelabuhan umum namun merupakan pelabuhan yang dibangun PTNNT untuk memfasilitasi segala kebutuhan berkaitan dengan kegiatan atau operasional tambang, baik untuk pengiriman barang, pengiriman konsentrat logam hasil produksinya dan transportasi manusia, baik karyawan dan tamu PTNNT juga masyarakat umum.

Dari kejauhan, pantai yang terletak Desa Goa, Kecamatan Jereweh, Kabupaten Sumbawa Barat ini tampak landai, airnya tenang dengan pasirnya yang cenderung berwarna gelap. Teluk Benete sendiri bukanlah tempat yang dikhususkan untuk tempat wisata meski pada saat saya melewati tempat tersebut terlihat satu dua orang sedang duduk-duduk santai menikmati pantai. Selain digunakan sebagai pelabuhan, tempat ini juga merupakan perkampungan nelayan dengan garis pantai yang terlihat indah di antara perbukitan sehingga cukup menarik untuk disinggahi.

• Pantai Lawar Salah satu hal yang saya suka dari pantai-pantai di Sumbawa Barat adalah pantainya yang tidak terlalu ramai. Seperti Pantai Lawar ini misalnya, letaknya yang jauh dari jalan raya membuat pantai ini sangat sepi. Saat rombongan bootcamp datang, nyaris tak ada pengunjung lain yang berkunjung. Hanya ada sepasang turis asing yang datang, itu pun tak lama kemudian mereka meninggalkan lokasi setelah bermesra sesaat. Mungkin romansa mereka –yang membuat saya iri itu– terganggu oleh kelakar kami.

Oh, romansa… Pantai ini sepertinya bukan pantai yang sering didatangi warga atau setidaknya bukan tempat yang dikelola dengan baik dibandingkan dengan Pantai Maluk dan Pantai Rantung. Hal ini terlihat dari aksesnya jalannya yang terhalang oleh tumbuhan karena jarang senja datang mentari pun redup semburat nya berwarna kendaraan besar. Pondokan yang tersedia pun terlihat tak terawat dan mulai melapuk.

Kesadaran masyarakat lokal tentang kebersihan sepertinya masih harus ditingkatkan karena terlihat sekali masih banyak sampah-sampah yang diletakkan sembarangan oleh pengunjung di pinggir pantai.

Namun sesungguhnya pantai ini di mata saya cukup menarik, terutama untuk menyepi. Dua buah bukit yang mengapit pantai membuat Pantai Lawar seperti terbingkai. Garis pantainya memiliki jarak yang pendek, sehingga kita tak perlu waktu yang lama untuk berjalan menyusuri pantai dari bukit di ujung yang satu ke bukit di ujung yang lain.

Batu-batuan besar yang berserak di sekitar bukit seolah mengundang saya untuk melompat-lompat di atasnya dan mengundang hasrat untuk berpose cantik dengan latar belakang batu-batuan tersebut.

Cobalah berjalan di pinggiran Pantai Lawar pada sore hari. Pasir pantainya yang putih dan halus nyaman sekali saat menyentuh telapak kaki dan menelusup di sela jemari. Sisa-sisa hangat menatari siang masih terasa di kaki. Mendekati bibir pantai, maka akan kita lihat tepian pantainya yang landai dan berombak tenang. Saya pun mulai berimajinasi tentang kenikmatan berendam sambil menanti senja tiba meski mentari tak akan terlihat saat turun karena terhalang bukit. • Pantai Poto Batu Pantai Poto Batu ini unik, membentang cukup panjang di sebuah ruas jalan dalam perjalanan dari Taliwang menuju Kecamatan Jereweh.

Di dalam bis yang membawa kami melaju menuju Desa Kertasari, saya menikmati sekali keindahan pantainya dari letak yang lebih tinggi di jalan raya.

Airnya bening, hingga bebatuan di dasar pantai terlihat bayang-bayangnya. Ditambah dengan pantulan warna biru langit di cuaca yang cerah membuat permukaan air lautnya membiru indah sekali.

Beruntung Mas Arie memberi kesempatan kami untuk mampir dan mengambil foto. Bis yang kami tumpangi sengaja berhenti di sebuah tempat yang terdapat sebuah gunungan batu besar mirip yang berlubang di tengahnya, mirip goa. Setengah berlari saya menuruni jalan di atas tanah berpasir untuk mengambil foto di tempat yang oleh masyarakat lokal diberi nama Poto Batu ini. Poto Batu berarti Batu di Ujung. Di beri nama demikian karena batu berlubang tersebut letaknya di salah satu sisi pantai yang dianggap bagian ujung pantai.

Selintas batuan tersebut seolah disusun lapis demi lapis, terlihat sangat menarik. Sayang seribu sayang, betapa gemasnya saya melihat hasil karya tangan-tangan usil yang mencoreti batu tersebut dan sungguh mengurangi keindahannya meski saya coba tepis dengan memperhatikan hal lain yang menarik.

Agak jauh di sebelah kanan gunungan batu tersebut, terdapat pemandangan unik lainnya, sebuah muara sungai yang mengalirkan air dari beberapa anak sungai di sekitar Taliwang. Saat itu mungkin sedang surut, daerah penghubung antara muara dan lautan itu tidak tertutup air sehingga menyerupai lapangan pasir yang terbuka. Dari informasi yang saya baca, muara ini kerap dikunjungi penduduk untuk memancing. Wah, pasti menyenangkan. Jangan tanya antusias kami mengabadikan tempat ini, segala sisi pantai diambil gambarnya, karena memang setiap sudut Pantai Poto Batu ini memang indah.

Bebatuan tersebut sungguh memperindah pemandangan. Beberapa dari kami sengaja menaiki gunungan batu tersebut hingga ke bagian puncak, Di sana telah terpancang tiang bendera dengan Sang Merah Putih berkibar dengan anggun di atasnya. Ah, Indonesia… kamu memang memesona.

• Pantai Kertasari Kunjungan kami ke Desa Kertasari sebenarnya tidak khusus untuk menikmati pantainya namun juga menjumpai penduduk lokal di sana.

Desa yang terletak di Kecamatan Taliwang ini memang istimewa, daerah ini terkenal sebagai sentra penghasil rumput laut di Kabupaten Sumbawa Barat Hampir sebagian besar penduduknya menjadikan budidaya Rumput Laut sebagai mata pencarian mereka yang utama selain sebagai nelayan dan menenun kain. Mungkin karena siang hari dan saat itu cuaca sangat terik, pantai ini terlihat sepi. Panasnya jangan ditanya, terik seakan membakar kulit. Saya yang sebenarnya kagum saat melihat hamparan pasir berwarna putih bersih, urung menjejakkan kaki di pasirnya yang putih bersih.

Tak ada pelancong yang datang siang itu kecuali rombongan kami dan penduduk setempat yang sedang mengurusi rumput lautnya. Kami menghabiskan sebagian besar waktu di sana untuk berinteraksi dengan masyarakat lokal. Sebagai desa binaan PTNNT yang telah mandiri, banyak hal menarik yang kami bisa gali di sana.

Bukan hanya terkait soal Rumput Laut namun juga soal kerajinan tenun kain hingga mencicipi hidangan khas setempat seperti Sate Kerang, Gulai Sepat, Urap Rumput Laut hingga Es Campur Rumput Laut.

Jangan tanya rasanya, juara! Bagi saya tak terbantahkan, ini makan siang paling enak yang saya rasakan selama bootcamp. Barulah setelah sore menjelang dan sinar mentari cukup bersahabat, kami bergeser ke bibir pantai dan menjejakkan kaki di pasir pantai yang putih dan halus itu.

Di sini kami duduk-duduk sambil memperhatikan bagaimana Rumput Laut dipanen, dibawa ke pinggir pantai dan dihamparkan untuk dijemur esok hari hingga sore menjelang dan kami pun akhirnya bergerak meninggalkan Pantai Kertasari sebelum senja tiba.

• Pantai Maluk Sebuah landmark besar berwarna putih bertuliskan PANTAI MALUK berdiri kokoh di atas pasir puth nan halus. Pondok-pondok atau gazebo untuk makan minum dan bersantai sudah tersedia. Bila anda datang ke tempat ini, pastikan anda tidak lupa menyicipi dendeng ala Sumbawa yang enaknya luar biasa yang disebut dengan Rarit. Pastikan pula saat anda berbincang, anda ditemani dengan Pisang Goreng dan Sambal Tujak serta sebutir Kelapa Muda sebagai minumannya.

Dijamin bikin betah, kenyang dan gagal move on. Kecamatan Maluk termasuk wilayah terdekat dengan pusat kegiatan tambang di Batu Hijau. Jumlah penduduk di lingkar dalam tambang ini cukup banyak, baik penduduk asli maupun pendatang yang berasal dari luar Sumbawa Barat. Tak heran bila dibandingkan dengan Pantai Kertasari dan Pantai Lawar, tempat ini jauh lebih ramai dikunjungi. Tempat yang infratrukturnya dibangun oleh PTNNT ini pun terlihat lebih terawat dan telah dikelola dengan baik.

Letaknya yang tak jauh dari jalan besar di pusat kota kabupaten membuat pantai ini tak hanya didatangi oleh mereka yang bertujuan untuk refreshing atau berwisata namun juga sekedar singgah untuk makan siang. Hal ini terlihat dari beberapa pengunjung berseragam PT. Newmont Nusa Tenggara yang datang untuk makan siang sambil berbincang sejenak lalu melanjutkan kegiatannya masing-masing.

Dua kali kami mendatangi pantai ini, dan dua kali pula saya ingin menceburkan diri di pantainya yang landai dan ombaknya relatif tenang. Apalagi pada siang hari, saat pertama kali kami datang untuk makan siang setelah sesi berbagi inspirasi dengan siswa siswi SMKN 1 Maluk. Siang itu pengunjung belum banyak yang datang. Berbeda dengan kondisi sore hari saat kami melepas Tukik, terlihat lebih ramai dengan penduduk yang datang bersama keluarga.

Tampaknya mereka ingin refreshing dan menghabiskan hari sambil menikmati senja di pantai ini. Kami tiba di Pantai Rantung saat matahari baru saja tergelincir ke arah barat. Sinarnya masih terang menyilaukan mata sehingga saya harus menunggu sejenak hingga mentari turun dan redup sambil menulis beberapa paragraf sebelum akhirnya kaki ini berjalan menuju pantai. Tak sulit untuk mencari tempat menginap, di sini banyak terdapat penginapan berupa cottage atau homestay yang bisa digunakan untuk menginap atau sekedar singgah seperti kami.

Pantai ini unik, saat saya menyisiri garis pantainya, terlihat bahwa ternyata pasirnya berwarna kecoklatan dengan butirannya relatif lebih besar-besar dan membulat mirip merica atau ketumbar. Garis pantainya paling panjang di antara pantai-pantai yang lain yang kami datangi sehingga saya puas menikmati langkah demi langkah sendirian menyusuri pinggiran pantainya yang tak terlalu ramai menjauh dari pondokan.

Garis Pantai Rantung ini bentuknya melengkung-lengkung, dengan ujung lengkungan serupa bukit yang menjorok ke arah laut. Di sebuah titik di pantai ini bahkan terdapat sebuah tempat yang strategis sekali untuk menikmati sunset, di mana mentari yang turun persis berada di antara dua ujung bukit.

Saya pun memutuskan untuk menikmati sunset sendirian di sini, menikmati sinar keemasan mentari yang turun, di semburat merah jingga langit di atas Pantai Rantung. Saya tak tahu mengapa kemudian pantai ini bikin saya sentimentil sekali. Terutama saat tubuh saya rebah di atas hangatnya bulir pantai bak ketumbar di pantai ini.

Entah karena lelah setelah berpanas-panas keliling Water Treatment Plant di Santong, atau entah karena saya telah terbius pada aura senja yang tiba-tiba hadirkan rindu dan kenangan yang begitu kuat. Yang jelas saya benar-benar menikmati detik-detik mentari turun ke bumi hingga hilang dari pandangan kala itu.

• Air Terjun Perpas Kalau Pantai Rantung telah membuat saya jatuh merindu tak karuan, lain halnya dengan Air Terjun Perpas.

Tak ada roman-roman picisan dalam perjalanan menuju ke sana, namun keseruan yang dihadirkan memberikan pengalaman tersendiri. Untuk mencapai tempat ini, diperkirakan kami harus trekking berjalan menembus hutan kecil selama kurang lebih satu jam dari tempat parkir bus berada. Saya sempat berpikir sejenak untuk ikut atau tidak ke tempat air terjun tersebut berada. Bukan karena satu jam waktu trekking yang saya khawatirkan, namun medan yang harus dilalui apakah memiliki tanjakan yang curam atau tidak.

Terus terang saya bukan adventurer, punya trauma soal trekking, sehingga jelas tidak menyukai trekking di medan yang sulit. Saya cuma ibu-ibu yang doyan jalan dan mau bersusah payah asal medannya masih bisa dilalui dengan senyum cantik meski ngos-ngosan hehehe. Dan, alhamdulillah, ternyata memang trek-nya tak terlalu sulit. Waktu tempuh juga hanya sekitar 40 menit saja.

Sebagian besar tanjakan dan turunannya landai, hanya ada satu dua tanjakan yang relatif cukup tinggi dan panjang. Dalam perjalanan sesekali kami harus merunduk di bawah pohon-pohon besar yang tumbang atau melompatinya sambil menerobos vegetasi yang semakin dalam semakin rapat. Namun perjalanan masih bisa dinikmati. Selama trekking kami masih saling berbincang satu sama lain. Jalurnya sangat aman, hanya bertemu satu dua kaki seribu berukuran besar di balik pohon tumbang atau bebatuan.

Saya sih cuma berharap jangan ada ular melintas dari dalam semak. Sempat ketemu satu sih ular berwarna hijau di pinggir jalan setapak sebelum masuk hutan, tapi untunglah ular tersebut sudah mati. 40 menit trekking tak terasa melelahkan bila beramai-ramai dan suasananya menyenangkan seperti yang kami alami.

Terlebih saat gemuruh air terjun sudah terdengar makin jelas, tanda lokasi air terjun sudah dekat. Dan serunya, keberadaan air terjun ini seolah tiba-tiba menyeruak di depan mata.

Sesaat setelah menuruni setapak, lalu membelok, tiba-tiba di depan mata terbentang sebuah areal terbuka yang dikelilingi oleh hutan di bawah langit Sumbawa yang kala itu berwarna biru cerah.

Saya terpukau! Kaki kami berpijak di atas permukaan sebuah batu besar. Ya, batu besar! Tak terbayang berapa besar sesungguhnya batu yang kami pijak ini, kalau permukaannya saja seluas bidang yang kami tempati. Dan hal ini sukses membuat saya berperilaku norak luar biasa, Berpose dengan berbagai gaya, mengambil gambar di setiap sudut, sambil menghirup udara dalam-dalam.

Bersyukur sekali saya tidak mengurungkan niat saya ke sini tadi di parkiran Terbayang kalau saya mengambil keputusan seperti yang sudah-sudah, yaitu mengatakan tidak mau dan tidak mampu bahkan sebelum mencoba menjalaninya. Pasti menyesal. Air terjun perpas ini sebanrnya tidak terlalu istimewa. Tercurah dari tempat yang tidak terlalu tinggj, juga tidak lebar.

Tetapi…, kebersamaan kami, senja datang mentari pun redup semburat nya berwarna sepanjang jalan, canda selama berada di sana, terekam begitu lekat dan indah dalam benak. Foto serta rekaman video kala itu masih mampu menghadirkan rasa yang sama seperti saat video itu dibuat, bahkan ketika saya melihatnya kembali saat tulisan ini dibuat.

Saya sempat ragu-ragu untuk menyeburkan diri ke dalam kolam di bawah air terjun itu. Namun setelah puas berfoto, pikiran mulai bingung, mau ngapain lagi? Yang lain terlhat betah berlama-lama, bahkan beberapa diantara kami mulai terjun ke air, ada yang dengan melompat dari atas batu, ada yang bergelayutan dengan akar pohon bak Tarzan, dan ada pula yang menyeburkan diri dari pinggiran senja datang mentari pun redup semburat nya berwarna.

Saya mulai tergooda, mulai deh membuka jam tangan, menggulung celana panjang. Niatnya sih cuma main air. Saat itu mikirnya, nggak mungkin nyemplung dengan pakaian lengkap dan celana jeans tanpa membawa pakaian ganti. Bisa berabe saat trekking turun nanti dengan pakaian basah, resiko masuk angin dan celana jeans basah dan berat sudah terbayang di pelupuk mata. Eh, pas nyemplungin kaki, wuiiiiiih sejuknya merambat hingga ke betis. Nyemplungin tangan, cibang-cibung, basuh-basuh muka…, wah kok tambah seger.

Sementara itu Kak Cumi Lebay dari dalam air sudah teriak-teriak mengajak turun. “ayo, Mbak Don… nyebur!” Dan saya masih saja galau, nyebur kagak…nyebur kagak… dan akhirnya, tiba-tiba terpikir aja jangan sampe nyesel sudah senja datang mentari pun redup semburat nya berwarna ini nggak nyebur.

Makaaaa, byuuuuuuur …., aku pun masuk ke dalam kolam. Yeaaayyy. Jangan tanya rasanya, tak terkatakan. Saya masih bisa membayangkan sejuknya air itu merambati kulit dari kaki ke pinggang, naik ke dada, merambati punggung, merasuk hingga ke tulang iga, seolah menembus ke paru-paru hingga pada akhirnya seluruh tubuh ini merasakan kesejukan yang luar biasa. Sungguh luar biasa… dan membuat saya enggan mengakhirinya. Nah… bagi kalian yang akan bertandang ke Sumbawa Barat, pastikan jangan melewatkan tempat-tempat yang saya ceritakan di atas ya.

Wisata di lingkar tambang? Why not! Sampai jumpa di Sumbawa Barat
ayopelesiran.com
Ayo Pelesiran - Ketika Lensa dan Aksara Bicara - Teaveling Journey and Destination JUNI FEBRIANTI, Mahasiswi Pendidikan Bahasa Inggris dan Anggota Unit Kreativitas Mahasiswa (UKM) Jurnalistik STKIP Bina Bangsa Getsempena Banda Aceh, melaporkan dari Takengon, Aceh Tengah DALAM beberapa hari terakhir, saya sibuk memikirkan kegiatan yang bermanfaat untuk senja datang mentari pun redup semburat nya berwarna waktu luang.

Lalu, terlintas di benak saya untuk pergi mengeksplor tempat wisata yang ada di Dataran Tinggi Gayo. Sepertinya aktivitas yang jarang saya lakukan ini akan sangat berguna untuk membuat hari libur dan waktu luang saya menjadi lebih menarik dan bermakna. Setelah memikirkan beberapa tempat, saya pun mengajak sepupu saya yang merupakan seorang traveler. Ia sudah banyak mengunjungi tempat wisata di Gayo. Mendengar ajakan tersebut, dia langsung menyambutnya dengan antusias. Setelah berdiskusi, akhirnya kami putuskan untuk mengunjungi Pantan Terong sebagai destinasi wisata kami kali ini.

Pantan Terong merupakan salah satu destinasi wisata terkenal di Takengon, Aceh Tengah. Tempat ini menarik begitu banyak minat pengunjung. Wisatawan yang datang ke lokasi ini bukan saja penduduk setempat, melainkan juga wisatawan luar daerah dan turis mancanegara.

Mereka tertarik datang untuk melihat keindahan Kota Takengon dari atas puncak Pantan Terong karena di media sosial pun lokasi yang eksotik ini sudah viral. Pantan Terong adalah sebuah bukit yang terletak di puncak bukit Dataran Tinggi Gayo, Takengon, Kecamatan Bebesen, Aceh Tengah.

Bukit ini berada pada ketinggian lebih dari 1.350 meter di atas permukaan laut. Di tempat ini, selain tampak ibu kota Takengon dan Danau Laut Tawar secara keseluruhan, lapangan Pacuan Kuda Belang Bebangka di Kecamatan Pegasing juga terlihat begitu indah. Jika kita pergi ke sini pada waktu petang maka akan tampak pemandangan matahari terbenam (sunset). Pemandangan indah ini menjadi salah satu alasan mengapa banyak wisatawan atau traveler sangat menyukai tempat ini pada petang hari.

Butuh waktu sekitar 45-60 menit bagi saya dan sepupu saya sampai di tempat ini, hal ini dikarenakan tempat tinggal saya jauh dari Kota Takengon. Jika ditempuh dari Takengon akan memakan waktu sekitar 15 menit untuk sampai ke tujuan. Pergi ke Pantan Terong tentu saja membutuhkan persiapan. Misalnya, harus membawa jaket tebal, mengingat dinginnya cuaca di puncak Pantan Terong. Kami juga harus memakai sepatu dan kaus kaki tebal, karena jika tidak kaki kami akan sangat kedinginan dan itu dapat memengaruhi mood kami saat berada di puncak Pantan Terong.

Menuju ke Pantan Terong, kami mengendarai sepeda motor (sepmor). Jalan untuk menuju ke lokasi tujuan cukup bagus. Jadi, kami tak perlu khawatirkan tentang kondisi jalan. Selama perjalanan menuju puncak Pantang Terong kami saksikan banyak pohon pinus yang menjulang tinggi dan rumah-rumah penduduk.

Walaupun kami sudah sangat sering melewati Takengon, tapi kami tidak bosan sama sekali untuk melihat keindahan dan merasakan sejuknya udara di kota sejuk ini.

Sesampainya di Pantan Terong kami langsung disuguhi pemandangan Kota Takengon yang sangat indah dan luasnya Danau Laut Tawar yang sangat biru. Semua ini membuat kami sangat takjub, karena biasanya kami hanya dapat melihat danau terbesar di Aceh itu dari pinggiran Kota Takengon. Danau yang luasnya 70 km² ini dapat terlihat dengan sangat indah dari puncak Pantan Terong.

Dari tempat ini kami juga dapat merasakan udara yang segar karena memang lokasinya tidak dekat dengan perkotaan dan banyak pepohonan.https://f20728b253f308fce5a0938bd8a71cff.safeframe.googlesyndication.com/safeframe/1-0-37/html/container.html Masuk ke tempat wisata Pantan Terong kita harus bayar Rp 5.000 per orang.

Penjaga akan memintanya sebelum kita masuk. Setelah masuk, perasaan tambah semangat karena ingin melihat penampakan besar dan luasnya Kota Takengon. Banyak orang yang kami temui di sini, sebagian besar wisatawan banyak yang mengambil gambar dan video, tapi ada juga yang menikmati pemandangan dengan segelas minuman di tangan mereka.

Banyak pengunjung yang datang bersama keluarga ataupun teman-teman. Banyak tempat atau spot foto yang bagus untuk mengambil gambar dengan pemandangan indah. Pantang Terong memang sangat cocok dijadikan tempat berkumpul dengan keluarga atau teman.

Selain tempatnya yang indah dan hawanya yang sejuk, fasilitas yang disediakan di sana pun cukup memadai. Tersedia makanan dan minuman yang dapat dibeli oleh para pengunjung. Tak ingin melewatkan momen kebersamaan di Pantan Terong kami mengambil banyak foto dan mengabadikan momen tersebut dalam bentuk video singkat. Hanya kegembiraan dan perasaan senang yang tergambar di wajah semua pengunjung. Hal ini mengindikasikan bahwa Pantan Terong sangat memberikan energi positif kepada setiap pengunjung.

Hal itu juga terjadi pada kami, perasaan tenang dan senang kami rasakan, kegembiraan pun menghiasi batin kami. Agar terlihat lebih menarik, di objek wisata Pantan Terong tersedia perlengkapan foto yang dapat menjadikan hasil foto yang kita ambil menjadi lebih unik, seperti adanya payung tradisional Cina, hanbok, yakni baju tradisional dari negara ginseng Korea Selatan, ada pula kain khas daerah tinggi Gayo (ulen-ulen) dengan motif kerawang gayo.

Kita dapat menyewanya hanya dengan Rp 10.000-Rp 30.000 per item. Banyak pengunjung yang tertarik mengenakan barang-barang tersebut saat berfoto dan tentu saja kami juga menjadi tertarik. Kami menyewa payung tradisional Cina seharga Rp 15.000.

Lalu dengan payung tradisional Cina ini foto kami terlihat sangat bagus, apalagi dengan pemandangan Kota Takengon dan Danau Laut Tawar yang menjadi background foto kami. Kami mengambil banyak foto secara bergantian. Kami memotret dengan kamera handphone. Sebagian pengunjung juga menggunakan hp, tapi ada juga yang sengaja membawa kamera (tustel) guna mendapatkan hasil foto yang lebih bagus lagi. Pantan Terong merupakan tempat yang sangat cocok untuk dijadikan tujuan wisata. Berada di sini kita akan disuguhi indahnya suasana Kota Takengon.

Cuaca dingin di kota ini sangat cocok untuk menikmati kopi khas Gayo. Kami pun tak lupa menghabiskan waktu dengan meminum kopi sambil menceritakan hal-hal menarik yang terjadi di sekitar kami. Cuaca yang dingin membuat perut kami terasa lapar, kami pun membeli makanan yang dijual. Banyak penjual yang berjualan di sini, mulai makanan ringan sampai berat.

Banyak juga yang menjual kopi khas Gayo. Menikmati secangkir kopi di puncak bukit yang menawan tentu sensasinya beda jauh dengan menikmatinya di pusat kota yang tak jarang suasananya ingar bingar.

Tak lama berselang, kami pun beranjak pulang dengan perasaan yang sangat senang dan gembira. Ingin rasanya segera kembali ke puncak Pantan Terong yang eksotik ini. Sumber : Klik Hak Cipta pada Kementerian Pendidikan, Kebudayaan, Riset, dan Teknologi Republik Indonesia Dilindungi Undang-Undang. Disclaimer: Buku ini disiapkan oleh Pemerintah dalam rangka pemenuhan kebutuhan buku pendidikan yang bermutu, murah, dan merata sesuai dengan amanat dalam UU No.

3 Tahun 2017. Buku ini disusun dan ditelaah oleh berbagai pihak di bawah koordinasi Kementerian Pendidikan, Kebudayaan, Riset, dan Teknologi. Buku ini merupakan dokumen hidup yang senaniasa diperbaiki, diperbarui, dan dimutakhirkan sesuai dengan dinamika kebutuhan dan perubahan zaman. Masukan dari berbagai kalangan yang dialamatkan kepada penulis atau melalui alamat surel [email protected] go.id diharapkan dapat meningkatkan kualitas buku ini.

Bahasa Indonesia untuk SMP Kelas VII Penulis Rakhma Subarna Soie Dewayani Cicilia Erni Setyowai Penelaah Tiik Harsiai Mu’jizah Penyelia Pusat Kurikulum dan Perbukuan Koordinator Visual Itok Isdianto Ilustrator Andrianus Kokok Rahardjo Karnadi Penata Letak (Desainer) Sunarko Penyuning Tri Harini Penerbit Pusat Kurikulum dan Perbukuan Badan Peneliian dan Pengembangan dan Perbukuan Kementerian Pendidikan, Kebudayaan, Riset, dan Teknologi Jalan Gunung Sahari Raya No.

4 Jakarta Pusat Cetakan pertama, 2021 978-602-244-298-1 (no.jil.lengkap) 978-602-244-299-8 (jil.1 ) Isi buku ini menggunakan huruf Aleo 11/15 pt. Alessio Laiso, Kevin Conroy. xii, 220 hlm. 17.6 x 25 cm. iiKata Pengantar Pusat Kurikulum dan Perbukuan, Badan Penelitian dan Pengembangan dan Perbukuan, Kementerian Pendidikan, Kebudayaan, Riset, dan Teknologi mempunyai tugas penyiapan kebijakan teknis, pelaksanaan, pemantauan, evaluasi, dan pelaporan pelaksanaan pengembangan kurikulum serta pengembangan, pembinaan, dan pengawasan sistem perbukuan.

Pada tahun 2020, Pusat Kurikulum dan Perbukuan mengembangkan kurikulum beserta buku teks pelajaran (buku teks utama) yang mengusung semangat merdeka belajar. Adapun kebijakan pengembangan kurikulum ini tertuang senja datang mentari pun redup semburat nya berwarna Keputusan Menteri Pendidikan dan Kebudayaan Republik Indonesia Nomor 958/P/2020 tentang Capaian Pembelajaran pada Pendidikan Anak Usia Dini, Pendidikan Dasar, dan Pendidikan Menengah.

Kurikulum ini memberikan keleluasan bagi satuan pendidikan dan guru untuk mengembangkan potensinya serta keleluasan bagi siswa untuk belajar sesuai dengan kemampuan dan perkembangannya.

Untuk mendukung pelaksanaan Kurikulum tersebut, diperlukan penyediaan buku teks pelajaran yang sesuai dengan kurikulum tersebut. Buku teks pelajaran ini merupakan salah satu bahan pembelajaran bagi siswa dan guru. Pada tahun 2021, kurikulum dan buku akan diimplementasikan secara terbatas di Sekolah Penggerak.

Hal ini sesuai dengan Keputusan Menteri Pendidikan dan Kebudayaan Nomor 1177 Tahun 2020 tentang Program Sekolah Penggerak. Tentunya umpan balik dari guru dan siswa, orang tua, dan masyarakat di Sekolah Penggerak sangat dibutuhkan untuk penyempurnaan kurikulum dan buku teks pelajaran ini.

Selanjutnya, Pusat Kurikulum dan Perbukuan mengucapkan terima kasih kepada seluruh pihak yang terlibat dalam penyusunan buku ini mulai dari penulis, penelaah, reviewer, supervisor, editor, ilustrator, desainer, dan pihak terkait lainnya yang tidak dapat disebutkan satu per satu. Semoga buku ini dapat bermanfaat untuk meningkatkan mutu pembelajaran. Jakarta, Juni 2021 Kepala Pusat Kurikulum dan Perbukuan, Maman Fathurrohman, S.Pd.Si., M.Si., Ph.D.

NIP 19820925 200604 1 001 iiiPrakata Salam! Sekarang kalian sudah meninggalkan bangku sekolah dasar. Di bangku SMP ini, kalian mendapatkan teman baru dan materi belajar baru. Buku Bahasa Indonesia ini akan mengajak kalian mengeksplorasi ragam bacaan dari berbagai tema yang ada di sekitar kalian.

Diskusikan bacaan ini dengan teman dan guru kalian, ya. Tentunya, bacaan-bacaan ini dapat menambah pengetahuan kebahasaan dan kesastraan, serta menginspirasi kalian untuk mencipta dan berkarya. Semoga bacaan-bacaan ini makin membuat kalian gemar membaca dan menulis. Selamat menikmati lingkungan belajar yang baru! Semoga petualangan belajar kalian di kelas tujuh menyenangkan. ivDaftar Isi Halaman iii No Isi x-xi 1 Kata Pengantar 1 2 Ada Apa di Buku Ini?

37 3 Bab I Jelajah Nusantara 69 4 Bab II Berkelana di Dunia Imajinasi 101 5 Bab III Hal yang Baik bagi Tubuh 137 6 Bab IV Aksi Nyata Para Pelindung Bumi 175 7 Bab V Membuka Gerbang Dunia 208 8 Bab VI Sampaikan Melalui Surat 209 9 Indeks 210 10 Glosarium 211 11 Datar Pustaka 12 Datar Buku Rekomendasi untuk Kelas Tujuh 211-214 13 Proil Penulis 214-216 14 Proil Penelaah 217-218 15 Proil Penyunting 16 Proil Ilustrator 219 17 Proil Desainer 220 vDaftar Gambar No Nama Gambar Sumber Halaman 1.1 Bandrek 13 13 1.2 Gunung Papandayan 13 15 1.3 Yaki 17 19 1.4 Pamlet Wisata 19 Papandayan I 32 53 1.5 Pamlet Wisata 63 Papandayan II 71 74 1.6 Pamlet Wisata Green 74 Canyon I 78-79 1.7 Pamlet Wisata Green Canyon II 1.8 Diagram Benda Kesukaan 2.1 Alur Cerita 2.2 Diagram Alur Teks Naratif 3.1 Isi Piringku 3.2 Tip Waktu Makan Ideal 3.3 Lebih Baik Bawa Bekal 3.4 Tetap Rileks Saat di Kelas vi4.1 Contoh Senja datang mentari pun redup semburat nya berwarna Digital https://kompas.id/baca/ 112 utama/2019/12/05/saatnya- untuk-aksi-nyata-atasi- 121 perubahan-iklim/ 125 4.2 Awan Tsunami https://nationalgeographic.

151 grid.id/read/132284972/ 155 muncul-awan-seperti- 160 gelombang-tsunami- 188 di-aceh-ini-penjelasan- bmkg?page=all. Diunduh tanggal 22 Oktober 2020 pukul 13.02 WIB. 4.3 Berita Hoaks https://turnbackhoax. id/2020/01/16/salah- bendungan-bili-bili- melewati-batas-angka- normal/. Diunduh tanggal 13 November 2020 pukul 09.03 WIB. Bagian-bagian Sampul 5.1 Buku 5.2 Contoh Buku Noniksi 5.3 Peta Pikiran “Itam dan U” 6.1 Ragam Sapaan 6.2 Pronomina 189-190 viiDaftar Tabel Halaman No Nama Tabel 2 1.1 Tabel Pengetahuan Latar 11 1.2 Kalimat Perincian 13 1.3 Deskripsi Objek 18 1.4 Membaca Berpasangan 20 1.5 Perbandingan Pamlet 27 1.6 Perbandingan Informasi Lisan 28 1.7 Membandingkan Ciri-Ciri Objek 35 1.8 Releksi 40 2.1 Perbandingan Puisi 47 2.2 Membaca Puisi Teman 53 2.3 Menulis Ulang Alur Teks Naratif 57 2.4 Mengkaji Tokoh Cerita Fantasi 68 2.5 Releksi 70 3.1 Curah Gagasan 75 3.2 Perbandingan Infograik 80 3.3 Lembar Membaca Berpasangan 81 3.4 Mengenali Tujuan Teks Prosedur 83 3.5 Pelesapan 84 3.6 Mengenali Ragam Kalimat dalam Teks Prosedur 89 3.7 Mengidentiikasi Struktur Teks Prosedur 94 3.8 Merancang Teks Prosedur 99 3.10 Releksi 102 4.1 Perbedaan Berita Cetak dan Daring 103 4.2 Prediksi Sebelum Membaca 108 4.3 Prediksi Setelah Membaca viii4.4 Kosakata 111 4.5 Perbandingan Berita Cetak dan Digital 113 4.6 Identiikasi Unsur Berita di Berbagai Media 1z19 4.7 Unsur Kebahasaan dalam Berita Eksplanasi 123 4.8 Rambu-Rambu Memilih Berita 127-128 4.9 Mencermati Berita Hoaks 129 4.10 Rancangan Berita 131 4.11 Menyunting Berita 131 4.12 Releksi 135 5.1 Buku Favorit 139 5.2 Memahami Emosi Tokoh dalam Buku Bergambar 148 5.3 Analisis Sajian Visual dalam Buku Bergambar 150-151 5.4 Perbandingan Buku Fiksi dan Noniksi 155-156 5.5 Contoh Kalimat Menanggapi Buku 162-163 5.6 Menanggapi Teks Tanggapan 163 5.7 Analisis Struktur Teks Tanggapan 169 5.8 Rancangan Teks Tanggapan 170 5.9 Releksi 173-174 6.1 Jenis Surat dan Media Sosial 176 6.2 Unsur-Unsur Surat 182-183 6.3 Unsur-Unsur Surat Pribadi dan Surat Resmi 183 6.4 Analisis Isi Surat 185 6.5 Kata Baku dan Tidak Baku 191 6.6 Unsur Pesan Media Sosial 192 6.7 Merancang Pesan di Media Sosial 193 6.8 Perbandingan Informasi di Ruang Bincang 195 6.9 Identiikasi Fakta dan Opini Situs Masalah 200 6.10 Identiikasi Fakta dan Opini Tim Duta Adiwiyata 201 6.11 Releksi 206-207 ixAda Apa di Buku Ini?

Di kelas tujuh kalian akan meningkatkan pengetahuan dan keterampilan berbahasa Indonesia dan mencipta karya melalui aneka kegiatan yang menyenangkan. Kegiatan apa saja yang akan kalian lakukan dalam buku ini? Simbol yang kalian temukan dalam buku ini menandai kegiatan yang akan kalian lakukan.

Apa saja artinya? Tujuan Pembelajaran Gambar ini menunjukkan tujuan pembelajaran dan materi pokok yang akan kalian pelajari. Siap-Siap Belajar Gambar ini menandakan saatnya kalian mendiskusikan apa yang telah kalian ketahui tentang tema yang akan dipelajari. Kata Kunci Gambar ini menunjukkan kata-kata yang kalian dalami artinya pada bab ini. Kupas Teori Gambar ini menunjukkan kegiatan meningkatkan pengetahuan dan keterampilan berbahasa Indonesia yang baik dan benar.

Membaca Gambar ini menunjukkan saatnya kalian membaca dan memirsa dengan saksama. Menyimak Gambar ini menunjukkan kegiatan menyimak dengan saksama. Berdiskusi Gambar ini menunjukkan saat kalian diminta berbicara dan bertukar pendapat dengan teman. xMenulis Gambar ini menunjukkan waktu untuk menyajikan ide secara tertulis dan gambar. Mengamati Gambar ini menunjukkan saatnya kalian mengamati gambar dan mendiskusikannya. Kreativitas Gambar ini menunjukkan saatnya kalian mengerjakan sebuah proyek atau suatu karya.

Jelajah Kata Kegiatan Jelajah Kata mendata kata-kata yang menjadi fokus pada bab ini. Kalian juga dapat menelusuri artinya pada Kamus Besar Bahasa Indonesia. KBBI KBBI (Kamus Besar Bahasa Indonesia) adalah rujukan yang digunakan untuk menelusuri arti kata pada buku ini.

Tesaurus Tesaurus Tematis Bahasa Indonesia adalah rujukan yang digunakan untuk menelusuri pemakaian aneka kata, istilah, serta padanannya pada buku ini. Jurnal Membaca Gambar ini menunjukkan saatnya kalian membaca buku dan sumber bacaan lain, lalu mencatatnya di jurnal. Refleksi Gambar ini menunjukkan saatnya kalian mengingat kembali materi pembelajaran dan mereleksi cara kalian mempelajarinya.

xixiiKEMENTERIAN PENDIDIKAN, KEBUDAYAAN, RISET, DAN TEKNOLOGI REPUBLIK INDONESIA, 2021 Bahasa Indonesia Buku Siswa SMP Kelas VII Penulis: Rakhma Subarna, Soie Dewayani, Cicilia Erni Setyowai ISBN: 978-602-244-299-8 BAB I Jelajah Nusantara Pertanyaan Pemantik: 1. Mengapa teks deskripsi penting bagi kita? 2.

Apa saja unsur teks deskripsi yang baik? 3. Bagaimana menyajikan teks deskripsi yang baik? Tujuan Pembelajaran Pada bab ini kalian diajak untuk menjelajahi keindahan alam, keunikan tempat, dan makanan khas daerah melalui beragam teks deskriptif. Kalian akan mempelajari fungsi dan unsur teks deskriptif, menyimak dan mendiskusikan ragam sajian deskripsi, serta berlatih menyajikan teks deskriptif yang menarik.

Kata Kunci Teks deskripsi, objek, kata konkret, kalimat perincian, dan majas personifikasi. Bab I - Jelajah Nusantara - 1Siap-Siap Belajar Peserta didik kelas tujuh, selamat memulai pembelajaran di bangku SMP. Sebelum mulai belajar, perhatikan judul dan gambar pada awal bab ini, kemudian jawablah pertanyaan-pertanyaan ini.

Jika mengalami kesulitan, kalian dapat mendiskusikannya dengan guru dan teman-teman! 1. Apa yang kalian bayangkan ketika mendengar kata 'Jelajah Nusantara'? 2. Amati gambar pada pembuka bab. Apakah yang dilakukan oleh anak- anak pada gambar tersebut? 3. Tulislah nama-nama benda khas daerah kalian (dapat berupa makanan atau kerajinan) pada kolom ‘Saya Sudah Tahu’.

Tuliskan nama benda dari daerah lain yang ingin kalian ketahui pada kolom ‘Saya Belum Tahu’. Tabel 1.1 Tabel Pengetahuan Latar Saya Sudah Tahu Saya Belum Tahu Bandingkan jawaban kalian pada tabel dengan jawaban teman-teman kalian.

Adakah hal yang belum kalian ketahui, tetapi diketahui oleh teman kalian? Setelah membandingkan jawaban, kalian dapat mengetahui lebih jauh tentang benda-benda tersebut pada bacaan-bacaan berikut ini. Selamat menjelajah nusantara! 2 - Bahasa Indonesia - SMP Kelas VIIA. Memahami Isi Teks Deskripsi Kegiatan 1: Mengakses Informasi dan Mengambil Simpulan dari Teks Deskripsi Membaca Rafa menghabiskan akhir pekan bersama keluarganya. Kali ini mereka berwisata ke sebuah puncak yang sedang populer di Aceh, yaitu Pantan Terong.

Rafa tak menyesal mengusulkan destinasi wisata ini kepada keluarganya. Ia sering membacanya di internet. Kali ini ia dapat menyaksikan keindahan tempat ini dengan matanya sendiri.

Setiba di rumah, ia pun segera menuliskan pengalamannya ini di blognya. Pantan Terong yang Instagramable Pantan Terong adalah nama tempat wisata yang sedang populer di Kota Takengon. Akhirnya, aku menginjakkan kaki juga di sini. Kalau kalian berkunjung ke Aceh, sempatkan mampir juga ke bukit yang instagramable ini, ya.

Aku jamin, kalian tidak akan merasa rugi! Bab I - Jelajah Nusantara - 3Kami berangkat dari Banda Aceh pukul 01.00 siang. Pukul 08.00 malam kami tiba di rumah Paman di Kota Takengon. Setelah makan malam, Paman menyuruh kami bergegas tidur. Kami akan pergi segera setelah salat subuh. Siapa tahu kami bisa menyaksikan matahari terbit di Pantan Terong!

Kota Takengon masih gelap dan sepi saat kami berangkat pagi itu. Hanya dalam waktu 15 menit, kami sudah tiba di jalan mendaki ke arah puncak bukit.

Wow, jalanan kecil itu menanjak dan curam dengan tikungan-tikungan yang tajam! Deg-degan sekali rasanya. Untung Paman lihai mengendarai mobil. Kata Paman, hanya mobil berkondisi prima yang bisa memanjat jalanan securam ini. Untung saja ketegangan itu segera berakhir.

Sesampai di atas, Paman memarkir mobil di luar pagar dan kami pun masuk ke dalam. Dari ketinggian 1.830 meter di atas permukaan laut, kami dapat melihat warna langit yang jingga terkena semburat sinar matahari di balik deretan gunung- gunung yang kokoh.

Warna itu kontras sekali dengan perbukitan yang hijau, perkebunan, lembah-lembah yang sangat cantik, dan Kota Takengon yang terlihat kecil dari sini. Oh ya, kalian juga dapat melihat Danau Laut Tawar yang seperti berkilau diterpa sinar matahari pagi.

Pokoknya rasa kantuk karena bangun pada pagi buta tadi sudah terbayar dengan pemandangan cantik ini. Kata Paman, kalian juga dapat menikmati pelangi yang muncul setelah hujan. Wah, aku jadi penasaran! Lain kali aku harus ke sini lagi. Nah, matahari sudah makin tinggi, waktunya untuk swafoto. Wah, banyak sekali latar yang dapat dipilih untuk swafoto!

Ada ayunan di depan tulisan Pantan Terong yang dicat senada dengan warna bendera pusaka, merah dan putih. Apabila kalian berswafoto di sana, kalian akan mendapatkan latar lembah yang mengepung Kota Takengon di kejauhan. Keren, kan? 4 - Bahasa Indonesia - SMP Kelas VIIBagus, ya? Pasti kalian tidak tahu aku sedang menggigil kedinginan. Setelah berswafoto, apa lagi? Di sini kalian pun dapat mencicipi aneka jenis sajian kopi asli Tanah Gayo. Kalian dapat memilih berbagai varian minuman kopi, seperti espresso, cappuccino, mochacino, hingga latte.

Makin siang makin banyak pengunjung berdatangan. Matahari makin tinggi dan hawa sejuk memeluk kami. Angin yang bertiup memainkan rambut dan berputar di sekeliling tubuh membuat kami ingin berswafoto lagi dan lagi.

Sebelum pulang, ibuku membeli suvenir yang berbentuk kopi gayo. Katanya, kita harus membantu perajin lokal. Nah, tunggu apa lagi? Dengan mengunjungi Pantan Terong, kalian pun ikut mempromosikan wisata dan kerajinan lokal.

Segera berwisata ke Aceh dan menikmati kecantikan Pantan Terong, ya! Setelah membaca pengalaman Rafa, jawablah pertanyaan di bawah ini! 1. Apa objek yang dideskripsikan dalam tulisan Rafa di atas? 2. Di kota mana objek tersebut berada? 3. Pada pengantar tulisan, mengapa disebutkan Rafa tak menyesal mengusulkan destinasi wisata ini kepada keluarganya?

4. Tuliskan kembali dua kutipan kalimat Rafa yang menunjukkan kesannya terhadap objek tersebut! a. _____________________________________________________ b. _____________________________________________________ 5. Tempat wisata tak hanya menyuguhkan pemandangan yang instagramable, tetapi juga kisah di balik terbentuknya bentang alam, cerita di balik pembuatan cendera mata, serta makanan khas daerah tersebut. Kegiatan apakah yang pernah kalian lakukan saat berwisata selain mendokumentasikan keindahan tempat tersebut?

6. “Jangan ambil apa pun selain foto, jangan bunuh apa pun selain waktu, dan jangan tinggalkan apa pun selain jejak kakimu,” merupakan ungkapan penting yang perlu dicamkan oleh pengunjung tempat wisata. Menurut kalian, apa maksud pernyataan tersebut? Bab I - Jelajah Nusantara - 5Kegiatan 2: Mengenali Gaya Penulisan pada Teks Deskripsi di Media Sosial Kupas Teori Pernahkah kalian mendengar tentang atau membaca informasi dari media sosial di internet?

Blog dan Instagram adalah contoh media sosial di internet. Kalian dapat membaca pengalaman dan pendapat orang lain tentang suatu topik. Tentunya, kalian harus dapat memilih informasi yang benar, bermanfaat, dan baik. Berkonsultasilah dengan guru, orang tua, atau wali saat menjelajahi informasi di internet. Apabila menulis di media sosial, kalian dapat menyapa pembaca dengan lebih akrab.

Ini adalah beberapa contoh kalimat menyapa pembaca yang ditulis Rafa di blognya. (a) “Bagus, ya? Pasti kalian tidak tahu aku sedang menggigil kedinginan.” (b) “Apabila kalian berswafoto di sana, kalian akan mendapatkan latar lembah yang mengepung Kota Takengon di kejauhan.

Keren, kan?” Sekarang tulislah beberapa ungkapan lain yang digunakan Rafa untuk menyapa pembaca blognya. 1. _______________________________________________________ 2. _______________________________________________________ 3. _______________________________________________________ Kegiatan 3: Menjelajahi Arti Kata Menggunakan Kamus Jelajah Kata Di Indonesia kamus yang menjadi rujukan utama kata bahasa Indonesia dan artinya adalah Kamus Besar Bahasa Indonesia (KBBI).

KBBI tersedia 6 - Bahasa Indonesia - SMP Kelas VIIdalam format digital dan cetak. Berikut adalah cara mencari arti sebuah kata dalam kamus cetak. 1. Temukan kata dasar dari kata atau istilah yang ingin kalian cari. Misalnya, kata dasar 'meredup' adalah 'redup'. 2. Tentukan huruf pertama dari kata dasar tersebut.

Huruf pertama kata redup adalah “R”. 3. Buka kamus ke halaman huruf pertama, yaitu “R”. Huruf kedua, yaitu 'e', menentukan urutan semua kata dalam kamus yang berawalan 'r'.

4. Kalau kalian perhatikan, di depan setiap makna kata dari kata redup terdapat huruf kecil berwarna merah, yaitu a. Huruf ini merupakan singkatan dari jenis kata, yaitu adverbia. 5. Kalian dapat berlatih mencari kata yang ingin kalian ketahui maknanya dengan melihat huruf awal dan huruf kedua kata tersebut. Saat ini, KBBI daring dapat kalian akses di laman https://kbbi. kemdikbud.go.id/. Kalian tinggal mengetik kata dasar yang ingin kalian cari di kolom pencarian.

Nah, sekarang carilah kata swafoto, suvenir, kontras, perajin, dan semburat pada laman tersebut. 1. swafoto 2. suvenir 3. kontras 4. perajin 5. semburat Bab I - Jelajah Nusantara - 7Kemudian, isilah kalimat tidak lengkap dan rumpang ini dengan kata- katamu sendiri.

1. Suvenir yang dibuat oleh perajin di daerahku adalah ________________ 2. Sifat kedua kakak beradik itu sangat kontras.

Berbeda dengan sang adik yang banyak berbicara, sang kakak_______________________________ 3. Banyak tempat wisata menawarkan pemandangan indah sebagai latar swafoto. Pemandangan indah yang digunakan sebagai latar swafoto di Pantan Terong adalah __________________________________________ 4.

Rafa ikut membantu para perajin lokal dengan cara _________________ 5. Senja datang, mentari pun meredup.

Semburatnya berwarna ________, warna yang kusuka. Kalian belum menemukan kata instagramable di KBBI pada tahun 2020 ini. Instagramable adalah kata serapan dari bahasa Inggris yang disematkan pengguna Instagram pada sebuah tempat yang indah untuk digunakan sebagai latar swafoto di Instagram. Dengan menemukan arti kata-kata di atas, kalian berlatih senja datang mentari pun redup semburat nya berwarna kamus.

B. Memahami Unsur Bahasa dalam Teks Deskripsi Kupas Teori Teks deskripsi adalah teks yang melukiskan sesuatu sesuai dengan keadaan sebenarnya sehingga pembaca dapat melihat, mendengar, mencium, dan merasakan apa yang dilukiskan itu sesuai dengan citra penulisnya. Dalam teks deskripsi, penulis berusaha menggambarkan kesan dari hasil pengamatannya terhadap suatu objek kepada pembaca. Berikut adalah ciri dan tujuan teks deskripsi. (1) Menggambarkan atau melukiskan suatu benda, tempat, atau suasana tertentu.

(2)Melibatkan pancaindra (pendengaran, penglihatan, penciuman, pengecapan, dan perabaan) untuk menggambarkan objek. 8 - Bahasa Indonesia - SMP Kelas VII(3) Bertujuan agar pembaca seolah-olah dapat melihat atau merasakan sendiri objek yang dideskripsikan. (4) Menjelaskan ciri-ciri objek, seperti warna, ukuran, bentuk, dan keadaan suatu objek secara terperinci. Dalam kehidupan sehari-hari, kita berkomunikasi menggunakan deskripsi.

Tujuannya adalah menciptakan imajinasi pembaca sehingga ia seolah-olah melihat, mengalami, dan merasakan sendiri apa yang dialami oleh penulisnya. Teks deskripsi bertujuan untuk menggambarkan objek dengan cara melukiskan objek dari sudut pandang penulis.

senja datang mentari pun redup semburat nya berwarna

Melalui teks deskripsi, pembaca atau pendengar dapat membayangkan bentuk, rasa, rupa sebuah benda, atau suasana sebuah tempat atau peristiwa sehingga mereka akan lebih mudah memahami dan tertarik dengan penjelasan kita. \"Pasar Beringharjo yang Bapak cari letaknya tak jauh lagi di depan jalan ini.

Gedungnya berwarna hijau dengan jendela- jendela yang dicat kuning. Terdapat plakat besar bertuliskan Pasar Beringharjo. Di kiri kanan pintu masuknya berjajar payung-payung.” Bab I - Jelajah Nusantara - 9Isi teks deskripsi menggambarkan suatu objek secara konkret atau nyata; benar-benar ada (berwujud, dapat dilihat, diraba, dan sebagainya).

Lalu, objek tersebut dilukiskan secara lebih jelas menggunakan kalimat perincian; yaitu kalimat yang menyebutkan atau menguraikan suatu objek sampai ke bagian yang sekecil-kecilnya. \"Ini namanya Mosi. Bulunya hitam gelap dan lebat. Meski bulu dari samping wajah sampai bawah telinganya putih seperti uban, ia masih muda. Aku suka mengelusnya. Ia aktif pada malam hari, berjalan-jalan di atap rumah atau mencari senja datang mentari pun redup semburat nya berwarna di tanah.

Makanan kesukaannya selain cacing, dan serangga, adalah buah pepaya dan pisang.” kata konkret + kalimat perincian Kata konkret adalah kata yang mudah diserap pancaindra.

Misalnya, buku, meja, rumah, kuda. Untuk mencapai tujuan teks deskripsi, kita harus melukiskan bagian-bagian yang penting sedetail mungkin dengan menggunakan kalimat perincian. Misalnya, jika kita melukiskan betapa indahnya laut dalam di Wakatobi, kita harus memerinci situasi di dalam laut yang indah itu selengkap-lengkapnya sehingga pembaca dapat membayangkan bagaimana jika dia sendiri yang sedang menyelam di Wakatobi.

Apakah terumbunya yang cantik, ikan-ikannya yang beraneka ragam, atau hal lain? 1 0 - Bahasa Indonesia - SMP Kelas VIIKegiatan 4: Menyelisik Ragam Bahasa dalam Teks Deskripsi Membaca Bandingkan dua gambar berikut.

Menurutmu, deskripsi mana yang membuatmu ingin mencicipi kue balok ini? \"Kue balok itu enak sekali. Teksturnya lembut saat digigit “Kue itu dan isian cokelatnya akan lumer di enak.” mulutmu.

Manisnya juga pas.\" a. Ayo, membuat kalimat perincian! Kalian dapat menuliskan kembali kalimat deskriptif yang berisi penjelasan perinci dari wacana “Menyelisik Ragam Bahasa dalam Teks Deskripsi”.

Tabel 1.2 Kalimat Perincian Kalimat Kalimat Perincian Kami berangkat pagi sekali. Kota Takengon masih gelap dan Pemandangan matahari terbit di sepi saat kami berangkat pagi itu. Pantan Terong sangat cantik. Danau Laut Tawar indah sekali pada pagi hari. Jalan ke arah bukit Pantan Terong mengerikan. Ada banyak latar indah untuk berswafoto di Pantan Terong.

Selain kata konkret dan kalimat perincian, kalian juga dapat menggunakan majas saat menggambarkan suatu objek dalam teks deskripsi, misalnya majas personiikasi. Majas personiikasi adalah gaya bahasa yang mengumpamakan benda mati seolah-olah hidup seperti manusia. Bab I - Jelajah Nusantara - 11Contoh: Angin yang bertiup memainkan rambut dan berputar di sekeliling tubuh.

Benda mati tentu tidak bisa bergerak. Namun pada kalimat ini, angin digambarkan seolah hidup seperti manusia yang dapat memainkan rambut dan berputar. b. Tandai kata kerja yang membuat benda mati seolah-olah hidup pada kalimat di bawah ini. 1. Mobil itu batuk-batuk dan menyemburkan asap hitam saat lewat di depanku. 2. Kami senja datang mentari pun redup semburat nya berwarna diiringi nyala lilin yang menari-nari dalam kegelapan. 3. Bunyi sirene pemadam kebakaran itu menjerit-jerit menyuruh kami minggir.

4. Kasurku seperti memanggil-manggilku begitu aku memasuki kamar pada siang terik itu. 5. Rasa sambal yang pedas itu membakar lidahku. Sekarang bacalah kutipan novel ini baik-baik. Misteri Terowongan Kereta “Kalian tahu kenapa binatang ini disebut ‘kereta api’?” Bapak bertanya sambil takzim menatap langit-langit gerbong, ke sebuah kipas angin karatan yang tidak berfungsi lagi. Kami yang duduk rapi di sebelah Bapak, antusias ikut mengamati seluruh gerbong.

Celingukan ke depan belakang, menatap ke luar jendela, melihat batang pohon berpilin seperti berlari. Hutan pedalaman Sumatra yang selalu berkabut di pagi hari. Bapak tersenyum, dia sudah menduga kalau kami, jangankan menjawab pertanyaan, mendengarkan kalimatnya barusan pun tidak.

Dia paham, ini perjalanan pertama kalinya aku dan Burlian dengan kereta api. Meski si ular besi ini sudah menjadi bagian kehidupan kampung, dengan suara klaksonnya yang tidak pernah alpa, melenguh nyaring setiap subuh buta dan tengah malam, sejatinya kami dan boleh jadi anak-anak lain belum banyak yang menaiki kereta api dalam sebuah perjalanan sungguhan.

(Dikutip dari Tere Liye, 2010: 1) c. Dapatkah kalian menemukan majas personiikasi pada kutipan tersebut? Tandai dan tulislah pada buku tulis kalian! 1.______________________________________________________________ 2.______________________________________________________________ 1 2 - Bahasa Indonesia - SMP Kelas VIIKegiatan 5a: Mendeskripsikan Gambar Secara Lisan Berdiskusi Coba tulislah deskripsi gambar-gambar di bawah ini.

Berdiskusilah dengan seorang teman. Agar deskripsi kalian kaya, cobalah menggunakan kata konkret, kalimat perincian, atau majas personiikasi. Setelah selesai, baca tulisan kalian secara bergiliran. Tabel 1.3 Deskripsi Objek Objek Deskripsi Kalian (Bagaimana tampilan bandrek ini? Bagaimana harum yang tercium? Senja datang mentari pun redup semburat nya berwarna apa rasanya?) Gambar 1.1 Bandrek (Apa yang kalian lihat? Bagaimana warna matahari terbit?

Bentuk apa yang dilu- kiskan awan pagi itu?) Gambar 1.2 Gunung Papandayan (Bagaimana isik kera hitam/yaki terse- but? Unikkah bentuk rambutnya? Apa yang sedang mereka lakukan?) Gambar 1.3 Yaki Bab I - Jelajah Nusantara - 13Kegiatan 5b: Membuat Vlog Kreativitas Mencoba Tantangan: Vlog 1 Menit Jika kalian dapat mengakses internet, kalian dapat melakukan kegiatan tantangan ini.

1. Plih salah satu objek kesukaan kalian. Kalian dapat memilih makanan, tempat, hewan, pemandangan, atau yang lain. 2.Jelaskan objek tersebut dan mengapa kalian menyukainya selama 1 menit. Gunakan kalimat perincian atau majas personiikasi yang telah kalian pelajari, ya!

3.Cobalah aplikasi video editor yang kamu kuasai melalui ponsel atau laptopmu. 4.Unggah video tersebut di media sosial kalian. Jangan lupa, beri catatan atau caption yang menarik. Selamat berkarya! Kegiatan 6: Menilai Pamflet Wisata Mengamati Bacalah pamlet ini dengan teliti, lalu diskusikan isinya dengan teman. Taklukkan Puncak Papandayan Kalian suka mendaki dan menikmati petualangan? Taklukkan Puncak Papandayan dan nikmati keragaman lora dan fauna di sana! Papandayan adalah salah satu gunung api aktif jenis strato dengan ketinggian 2.662 mdpl.

Menurut klasiikasi Schmidt dan Ferguson, gunung ini memiliki curah hujan rata-rata 3.000 mm/tahun, kelembapan udara 70— 80% dan temperatur 10—250 C. Papandayan juga telah meletus beberapa kali, di antaranya pada 12 Agustus 1772, 11 Maret 1923, 15 Agustus 1942, dan terakhir pada tanggal 11 November 2002. Hal ini menyebabkan Taman Wisata Alam Gunung Papandayan memiliki ragam lora dan fauna yang 1 4 - Bahasa Indonesia - SMP Kelas VIIdaG(GmuGJyTiuynmpnjaanamnaieeuuuaikeannmymngtrrnndmntuuuaguggkitaagaamk,sutuaakpdnngaaridttntpa.na—aidaunemanetWtinnarnsGKannJlmadnaeberiaadaDnsiigktlunulflarakaaaieaeasudiRamakkdtkdsnlntnaapfirKm,iaaath1pladnaaAga5dKeri—gdmijutluln.amuaraii0nGcanpe.prmoelt0uuuuaminreaKadala0lnspedrrtaaeanbu,GaghaBa0.wltsatnwiukpa0ls)KaptaidW,inke.eina.anoahetAutriisaurjisrJgpnGnuleabtnrsatabiagagtnuaenegtklaasuanrarslddiahenuPin,rauaDankrdiataKjtakr—ppaeaPtiupiaeniea.snT,fCrabngintaJlegdmniuadu,kdsaruedkmihpamaaaenkSnnaaurajsjkanuiaguaailyrttniuirymnnaaanaaaestaaaggnnnnnnaana.li, tBLkuaearulnuiawdnnuidnPbigiaKsneajujcanranuamgsikaaanattaanBnugakTCnueditsraumunnriugenp—lafalCdnCia.kircaiajTahenergum,mlianldauil MfPPmpkfmFPTruakKmaaaeaaekdaaaaataeduurltrkdapppaeilaignrpnn,lifraaaa-eungayuadaalr.nnntakjeaisn,ietkddd7tk1bmyoatanaMeaaam0asa9annnianyyyn—sun2bgt,eaaaantag3kk3ggn8Punnnstra.laauu0aiut0spn1orlnra%npnj0amauau5rmudycT1e0tantrgadnaoaaae1AtgeadaglukmpnamagkpdnamNaahPdtutliaeenaineldtolsmaannnaiksseilafkvtapdkganiaamu/mWieihaa1iaytlugsmkaanpake2ndinasarhmhde1i.mbaaaasAnurak9dgeeSsnatiid?gney4alaraaletieai,utp2kumtliSsA2tnsanuia,ruca0tkilgdtcd1nasuhgne0gauma0mslmual2inrebln—aon!ae1.mieonGrduht2nn7abHerntubii57a2rekkhagnaa02mmr.ul6udddpak,ajoh1n6aapaaaaaiCpnittg1nn2nnnar.iiii (1) ktkpPtpmpGme5kBooeeaeeedouhiiauadlmmlenmmoeelsmaaldbtHtwaaapei,nm,oaenlneunkegakrntddpmteiie,tsaaaaeHadmKsSeannnrnmado,okdnapgg2naepetedalaaaaa4rMtmelankitnnwdmejnaaaaaaepGagntbtjahmhaikaaimaeas,na2ualrrn.srudkn4aywtu,rediHiantrajad,i,anaubdklsnheumgnatecue,mnahaworns2.gnl,idutagpor4aktetaemkaMhpaajkdamnga,aphuaaismeniaasttislbaairnaa.,inesddld2dna,rgteea0egl,tatoknnnen0somakdggrgguibslaaaaaaanemiasnnnnntngt,i, (2) (3) Gambar 1.4 Senja datang mentari pun redup semburat nya berwarna Wisata Papandayan I sangat kaya.

Selain lora dan fauna, tentu para pendaki dapat menikmati pemandangan lain. Kawah belerang, hutan mati, dan ladang edelweiss dapat kalian nikmati selama mendaki.

Jalur pendakian yang aman di gunung ini bahkan sesuai untuk pendaki pemula. Karena itu, gunung ini dapat dinikmati oleh siapa saja. Taman Wisata Alam Gunung Papandayan yang terletak di perbatasan DesaSirnaJayadanDesaKramat Wangi,KabupatenGarut inimudahdicapai dengan kendaraan umum. Kalian dapat pergi dari Jakarta menggunakan transportasi umum.

Gunakan bus Karunia Bakti atau Primajasa (jurusan Jakarta—Garut), turun di Terminal Guntur—Garut, lalu lanjutkan dengan angkutan elf jurusan Garut—Cikajang dengan tarif Rp15.000,00. Alternatif lainnya, kalian bisa naik angkutan elf dari Terminal Leuwi Panjang atau Terminal Cicaheum di Bandung jurusan Bandung—Cikajang, lalu turun di Bab I - Jelajah Nusantara - 15Kecamatan Cisurupan.

Atraksi Wisata: berkemah, eksplorasi kawah, fotograi, terapi air panas, jalur sepeda gunung, dan jalur lari. Fasilitas: cottage keluarga, ruang pertemuan, kolam terapi air panas, areal parkir, masjid dan kantor informasi, shelters, toilets, menara pandang, sekuriti 24 jam. Daya Tarik Wisata: (1)Kawah Gunung Papandayan yang aktif, berpindah-pindah, dan dapat dilihat dari dekat. (2)Hutan Mati yang menyuguhkan pemandangan eksotis sisa letusan pada tahun 2002. (3)Menyaksikan matahari terbit di Tebing Sunrise, Ghober Hoet atau Hutan Mati.

(4)Wisata air berupa danau, sungai yang unik, dan air terjun bertingkat. (5)Aneka lora seperti pohon suagi (Vaccinium valium), edelweiss (Anaphalis javanica), puspa (Schima walichii), saninten (Castanea argentea), jamuju (Podocarpus imbricatus), dan lain-lain. (6)Aneka fauna yaitu babi hutan (Sus vitatus), tenggiling (Manis javanicus), lutung (Trachypitecus auratus), elang jawa (Nisaetus bartelsi), ketilang (Pycononatus aurigaster), dan lain-lain.

Tempat Berkemah: (1)Bumi perkemahan dengan langsung ke pemandangan kawah, berlokasi 5 menit dari parkir, cottages, taman edelweiss, pemandian air panas, toilet, musala, dan keamanan 24 jam. (2)Ghober Hoet atau Hutan Mati dengan pemandangan kawah, pemandangan malam Kota Garut, matahari terbit, pemandangan jalur susu di angkasa, toilet, keamanan 24 jam.

(3)Pondok Saladah yang dekat dengan padang edelweiss, berlokasi 200 m ke Hutan Mati, dilengkapi dengan toilet, tempat berteduh, musala, dan keamanan 24 jam. 1 6 - Bahasa Indonesia - SMP Kelas VIIbteerrakpeimaairhp, anekassp, jlaolruarssi epkaedwaahg,unfuontogg, draain, jalur lari. cottage tdmeakrenaenplukaiaararangitraop,rapniarndunfaaoannrsmgg, ,aasspreiee,akrstluehrmepitlaituerak2rnis4r,, (1) wvlliadppu(aj((SKHMAWAauamPAVikrneaiuannutawitlgeiaynnitamidbusnweethlkineccaia.atfaanrrkkca,auyna,oiicpntgaacsdh(tbathsntaniNhaaeeniaMdke)(lfdoiaGa,th,)aTianisraosaunu,Gtlapiu)uruiirresanrsaamka,stiinhnannnaiebj)gaitcdaroau,ujyngdt2esanhavemdubtnsaigar0eynayvenkamsuegnahipp0uaalratlneripgjiib-eeiuj2nuaPunttptukaH.nuarlem.ritmnagsaictian(orcdgipo(biaPt)bh(endueCapaea,Mta)oean-atsinos,leanlbssrrdyahapaatdshditaiiueoisi,nt)uutoetnahunag,radiceis,lsn.y)urgskuuwnaars,paaatebkhsedrnjuataHenatapiulukaantinievdtulu(ssayanagd.tSaat(sas)nugnaaiSnc,lpnsiagTineuhiagcaiyelsintaMumnab-nsniaang)gt,gi.

senja datang mentari pun redup semburat nya berwarna

kolam (2) masjid (3) toilets, (4) (5) jam. (6) Gambar 1.5 Pamlet Wisata Papandayan II a. Amati gambar-gambar dan teks pada pamlet, lalu diskusikan pertanyaan ini dengan teman di sebelah kalian.

1. Siapa yang diharapkan membaca pamlet ini? 2. Apakah pamlet ini sudah memberikan semua informasi yang ingin diketahui oleh orang yang ingin mendaki gunung?

3. Bagaimana penggambaran lokasi dan tempat berkemah dalam pamlet? Apakah sudah cukup jelas dan menarik? 4. Sebutkan lokasi apa saja yang dapat dikunjungi para pendaki ketika menjelajahi Gunung Papandayan! 5. Informasi baru apa saja yang kamu dapatkan dari pamlet? 6. Apakah menurutmu orang akan tertarik mendaki gunung dengan membaca pamlet ini?

Mengapa? Tuliskan alasanmu! Bab I - Jelajah Nusantara - 177. Tulislah kalimat penjelasan yang menarik perhatianmu pada pamlet tersebut! Sekarang diskusikan jawaban-jawaban kalian atas pertanyaan tersebut dengan seorang teman. Kalian dapat menggunakan format tabel perbandingan di bawah ini. Tabel 1.4 Membaca Berpasangan Nama: Nama Teman: No Jawaban Saya Jawaban Teman Saya 1.

2. 3. 4. 5. 6. 7. Dengan menjawab pertanyaan di atas, kalian berlatih untuk menilai sajian visual dalam teks deskripsi dengan format pamflet. 1 8 - Bahasa Indonesia - SMP Kelas VIIKemudian, perhatikan kembali contoh lain pamlet wisata di bawah ini. Menyelami Keindahan Green Canyon WISATA Aktivitas Bahari • Snorkeling • Scuba Diving River Tubing • Goa Lanang • Green Santirah Body Rafting • Perahu Green Canyon • Body Rafting Green Valley GREEN CANYON ADVENTURE Gambar 1.6 Pamlet Wisata Green Canyon I GREEN CANYON ADVENTURE Sungai Santirah, Green Canyon Lokasi tepatnya berada Pangandaran adalah destinasi di dusun Giriharja, Desa yang bisa dikategorikan Selasari, Kecamatan Parigi, sebagai lanskap tropis yang Kabupaten Pangandaran, unik, di antara kedua dinding Jawa Barat.

Atau sekitar 18 ngarai yang berwarna hijau km dari Pangandaran dan karena ditumbuhi lumut ini dapat ditempuh dalam Anda bisa langsung melihat waktu sekitar 45 menit fenomena alam yang menarik. menggunakan kendaraan darat.

Gambar 1.7 Pamlet Wisata Green Canyon II b. Kedua pamlet di atas sama-sama menyajikan informasi tentang wisata alam. Namun, penyajian gambar, tata letak, dan warnanya tentu berbeda. Bandingkan kedua pamlet di atas dan bandingkan pendapatmu dengan teman. Bab I - Jelajah Nusantara - 19Tabel 1.5 Perbandingan Pamlet No. Elemen Pamflet Pamflet Pamflet Wisata Papandayan Green Canyon 1. Foto pada pamlet menggambarkan objek yang dijelaskan.

2. Kualitas foto cukup baik, jelas, dan objek diambil dari sudut pandang yang baik sehingga tampak menarik. 3. Warna pamlet cukup baik dan sesuai dengan warna huruf.

4 Huruf pada pamlet cukup jelas dan dapat dibaca. 2 0 - Bahasa Indonesia - SMP Kelas VIIKupas Teori Penulisan kata berawalan meN- yang dirangkai dengan kata yang diawali huruf k, p, t, s: (1)Fonem k, p, t, s LULUH jika setelah awalan meN- diikuti oleh kata dasar yang berawalan huruf k, p, t, s. Misalnya: memengaruhi (meN- + pengaruh), memesona (meN- + pesona), mengarantina (meN- + karantina), dan sebagainya.

(2)Fonem k, p, t, s TIDAK LULUH jika setelah awalan meN- diikuti oleh kata dasar yang diawali dengan kluster/konsonan rangkap. Misalnya: memprakarsai, mengkriminalkan, mengklasiikasi, dan sebagainya. (3)Fonem k, p, t, s TIDAK LULUH senja datang mentari pun redup semburat nya berwarna setelah awalan meN- diikuti oleh kata berimbuhan yang berawal dengan huruf k, p, t, s.

Misalnya: mempertaruhkan, memperluas, dan sebagainya. Tantangan Pilihlah kalimat dengan peluluhan yang benar! 1. Perajin memroduksi suvenir dalam kegiatan industri rumah tangga dengan senja datang mentari pun redup semburat nya berwarna kecil.

2. Kemampuan bahasa pemandu wisata itu sangat mengagumkan. Ia secara tangkas menterjemahkan paparannya dari bahasa Inggris ke bahasa Jerman kepada rombongan wisatawan mancanegara yang dipimpinnya.

3. Kilau sinar matahari yang menerpa permukaan danau itu sangat mengagumkan. 4. Pendaki gunung tidak memersoalkan kenaikan tarif selama fasilitas toilet dan keamanan tersedia di sepanjang jalur pendakian. 5. Paman memprediksi bahwa kami akan tiba di Pantan Terong tepat saat matahari terbit. Bab I - Jelajah Nusantara - 21D. Menganalisis Informasi Lisan Kegiatan 7: Membandingkan Informasi Lisan Membaca Adakalanya kalian juga harus menjelaskan benda atau situasi secara lisan.

Bacalah transkripsi penjelasan lisan tentang dua hal yang berbeda di bawah ini. Catat baik-baik perbedaannya, ya. Jelajah “Selamat siang, Kakak-kakak, Bapak/Ibu! Selamat datang di Desa Wae Rebo, Manggarai, Wae Rebo Nusa Tenggara Timur. Saat ini kita berada di ketinggian 1.200 meter di atas permukaan laut. 2 2 - Bahasa Indonesia - SMP Kelas VIIKarena itu, Desa Wae Rebo ini sering dijuluki ‘Desa di Atas Awan’.

Nah, hari ini Kakak-kakak, Bapak/Ibu akan merasakan pengalaman baru. Kakak dan Bapak/Ibu akan merasakan tidur di salah satu dari tujuh Mbaru Niang yang ada di desa ini.” “Nah, mungkin kakak, Bapak/Ibu bertanya-tanya, ‘Mbaru Niang itu apa, ya?’ Bapak/Ibu lihat rumah-rumah yang ada di depan kita ini? Ya. Ini adalah rumah tradisional khas Manggarai.

Mbaru artinya rumah, dan Niang artinya tinggi dan bulat. Coba, kita perhatikan. Di depan kita ini ada tujuh Mbaru Niang berbentuk kerucut dan tinggi yang hampir sama. Ada yang tahu mengapa jumlahnya tujuh? Ya! Angka tujuh menunjuk kepada tujuh arah gunung di sekitar desa yang dipercaya sebagai pelindung desa.

Ini menunjukkan bahwa masyarakat di sini sangat menghormati leluhur dengan melestarikan budaya. Mari kita lihat lebih dekat rumah-rumah ini, ya?” “Mari mendekat kemari, semuanya!” “Nah, seperti Kakak-kakak dan Bapak/Ibu bisa lihat, Mbaru Niang terbuat dari beberapa jenis rumput, lalu dilapisi ijuk atau serat pohon Bab I - Jelajah Nusantara - 23palem.

Bahan-bahan ini merupakan bahan pilihan agar Mbaru Niang kuat menahan serangan angin dan air hujan. Silakan Bapak/Ibu sentuh dinding rumah ini. Terasa kokoh, kan?” “Setiap Mbaru Niang memiliki 5 tingkat, Bapak/Ibu. Semua ditutupi atap dan setiap tingkatnya memiliki jendela kecil. Tingkat pertama disebut lutur atau tenda yaitu tempat tinggal para penghuninya.

Di sini, seperti Bapak/ ibu lihat, terdapat perapian dan dapur yang terletak di tengah rumah. Dapur ini berfungsi menahan serangan rayap dengan memanfaatkan asap yang dihasilkan ketika memasak. Sekarang mari kita ke tingkat dua.” Mbaru Niang “Tingkat kedua ini dinamakan lobo atau loteng, yaitu tempat menyimpan bahan makanan dan barang.

Kita lanjutkan ke tingkat tiga, ya.” 2 4 - Bahasa Indonesia - SMP Kelas VII“Kalau Kakak-kakak dan Bapak/Ibu perhatikan, tidak ada paku, besi, dan beton pada rumah tradisional khas Manggarai ini. Bangunan ini dibangun dengan cara ditanam, diikat, dan dipasak. Nah, inilah tingkat ketiga atau yang biasa disebut lentar, berfungsi menyimpan benih jagung dan tanaman untuk bercocok tanam lainnya.

Mari kita naik lagi!” “Ada yang tahu tempat apakah ini? Ya, benar sekali. Di sini adalah tempat menyimpan cadangan makanan ketika panen dirasa kurang berhasil.

Tingkat keempat ini disebut juga lempa rae. Kita akan naik sekali lagi menuju tingkat terakhir atau yang juga disebut sebagai hekang kode. Tingkat kelima ini merupakan tempat menyimpan sesajian untuk para leluhur.

Mari kita turun kembali. Perhatikan langkahnya ya, kakak-Kakak, Bapak/Ibu!” “Nah, bagaimana? Senja datang mentari pun redup semburat nya berwarna semua sudah tidak sabar ingin menginap, ya? Sampai hari ini Mbaru Niang masih digunakan untuk berkumpul, melakukan ritual, dan berdoa bersama setiap hari Minggu pagi.

Demikian, Kakak-kakak, Bapak/Ibu. Hingga di sini, ada pertanyaan?” Bab I - Jelajah Nusantara - 25Jelajah Rasa di Lampung Hai, Teman-teman! Kalian tahu, kali ini aku berada di mana?” “Ya, tepat sekali! Kali ini aku berada di sentra keripik pisang lampung, di Jalan Pagar Alam, Kota Bandar Lampung yang terkenal dengan sebutan Gang PU. Kalau kalian lihat nih, di sisi kiri kanan jalan ini, hingga dua kilometer ke depan, ada ratusan penjual keripik pisang aneka rasa.

Ada rasa cokelat, keju, stroberi, melon, cappuccino, sapi panggang, rumput laut, hmm . rasa apa lagi, ya? Daripada penasaran, ayo langsung kita coba!” “Nah, sekarang aku berada di salah satu kios keripik pisang.

Wuih, lihat … jejeran stoples plastik warna-warni ini menggoda sekali, kan? Namun, aku mau coba rasa keripik pisang yang paling jadi andalan dan paling dicari wisatawan, yaitu keripik pisang cokelat!” “Kalian bisa menebak mengapa keripik pisang cokelat ini paling laris? Wow, lihat! Keripik pisang ini betul-betul tertutup semua oleh bubuk cokelat lho! Kelihatannya enak sekali! Nggak heran keripik ini jadi favorit wisatawan! Sekarang kita coba, ya?” “Hmmm … waaah, enak sekali!

Keripiknya lebih tebal dari keripik-keripik pisang biasa. Keripik ini lebih 2 6 - Bahasa Indonesia - SMP Kelas VIIempuk juga, tetapi tetap renyah ketika digigit. Rasa cokelatnya .

wow, jangan ditanya. Mantap! Saat menggigit, kalian akan bisa merasakan rasa manis di ujung lidah, lalu setelah beberapa saat kalian akan merasakan sensasi sedikit rasa pahitnya. Pahit bercampur manis khas cokelat yang pekat! Pasti kalian penggemar cokelat akan suka.

senja datang mentari pun redup semburat nya berwarna

Lihat nih, bubuk cokelatnya sampai bertaburan di tangan.” “Untuk sebungkus keripik pisang cokelat ini, kalian bisa membelinya seharga 12.000 rupiah untuk sekantong keripik seberat seperempat kilogram.

Kalau kalian membeli sekilo, harganya 40.000 rupiah saja. Murah kan? Nah, kalau kalian main ke Lampung, sempatkan datang ke Surga Keripik Pisang di Gang Pagar Alam ini, ya! Sekarang aku mau coba rasa lain dahulu. Dadaaah!” Kalian telah membaca kedua wacana di atas. Sekarang bandingkan kedua wacana tersebut dengan mengisi tabel dan menjawab pertanyaan di bawah ini.

Setelah itu, diskusikan tabel kalian dengan teman, ya. Tabel 1.6 Perbandingan Informasi Lisan Jelajah Rasa di Lampung Jelajah Wae Rebo 1. Objek apa yang dideskripsikan? 2. Kepada siapa penutur teks deskripsi ini berbicara? 3. Apakah kata sapaan yang digunakan oleh penutur teks deskripsi tersebut? 4. Menurut kalian, apa tujuan penutur menjelaskan objek tersebut? 5. Tulislah dua kalimat deskripsi yang menarik menurut kalian.

Bab I - Jelajah Nusantara - 27Kegiatan 8: Membandingkan Ciri-ciri Objek Mengamati Teks \"Jelajah Wae Rebo\" dan \"Jelajah Rasa di Lampung\" mendeskripsikan dua objek yang berbeda. Sekarang bandingkan penggambaran ciri-ciri benda yang dituturkan dalam kedua teks tersebut. Tabel ini membantu kalian untuk membandingkan kalimat penjelasan pada kedua teks tersebut.

Kemudian, kalian dapat menuliskan kata konkret dan kalimat perinci pada setiap kalimat. Tabel 1.7 Membandingkan Ciri-Ciri Objek Jelajah Wae Rebo Jelajah Rasa di Lampung Mbaru Niang terbuat dari beberapa Keripiknya lebih tebal dari keripik- jenis rumput, lalu dilapisi ijuk atau keripik pisang biasa.

Keripik ini serat pohon palem. Bahan-bahan lebih empuk juga, tetapi tetap ini merupakan bahan pilihan renyah ketika digigit. Rasa agar Mbaru Niang kuat menahan cokelatnya . wow, jangan ditanya. serangan angin dan air hujan. Mantap! Saat menggigit, kalian Silakan Bapak/Ibu sentuh dinding akan bisa merasakan rasa senja datang mentari pun redup semburat nya berwarna di rumah ini.

Terasa kokoh, kan? ujung lidah, lalu setelah beberapa saat kalian akan merasakan Kalimat menjelaskan tekstur dan sensasi sedikit rasa pahitnya.

Pahit bahan. bercampur manis khas cokelat Kalimat bertujuan agar pembaca yang pekat! Pasti kalian penggemar seolah-olah ikut melihat dan cokelat akan suka. menyentuh. Kata konkret: Kalimat menjelaskan rasa. Kalimat perinci: Kalimat bertujuan agar pembaca seolah-olah ikut merasakan. Kata konkret: Kalimat perinci: Dengan membandingkan dua teks deskripsi di atas, kalian berlatih menganalisis informasi yang tersaji secara lisan. 2 8 - Bahasa Indonesia - SMP Kelas VIIE. Menyunting Teks Deskripsi Kegiatan 9: Mengenali Tanda Baca dalam Teks Deskripsi Kupas Teori 1.

Huruf kapital atau huruf besar dipakai sebagai huruf pertama kata pada awal senja datang mentari pun redup semburat nya berwarna.

Misalnya: a. Ardi menikmati kopi gayo. b. Papandayan adalah salah satu gunung api aktif jenis strato dengan ketinggian 2.662 mdpl. c. Perjalanan ditempuh dalam waktu satu jam. 2. Huruf kapital dipakai sebagai huruf pertama nama geograi. Misalnya: Jakarta, Jalan Dago, Kabupaten Garut, Sungai Musi, Gunung Papandayan. 3. Tanda Koma a. Tanda koma dipakai di antara unsur-unsur dalam suatu pemerincian atau pembilangan. Misalnya: Ia membeli kopi, kain, dan tas sebagai oleh-oleh untuk para sahabatnya.

b. Tanda koma dipakai sebelum kata penghubung seperti tetapi, melainkan, sementara dan sedangkan dalam kalimat majemuk setara. Misalnya: Lili mengambil foto, sementara Fajar memilih menikmati secangkir kopi. c. Tanda koma dipakai untuk memisahkan anak kalimat yang mendahului induk kalimatnya.

Misalnya: Kalau lulus ujian, ayah akan mengajak saya ke Pulau Bali. d. Tanda koma dipakai di belakang kata atau ungkapan penghubung antarkalimat, seperti oleh karena itu, jadi, dengan demikian, sehubungan dengan itu, dan meskipun demikian. Misalnya: Gunung Papandayan telah meletus beberapa kali. Meskipun demikian, kawah hasil letusan dan hutan mati menjadi daya tarik wisata ini.

e. Tanda koma dipakai sebelum dan/atau sesudah kata seru seperti o, ya, senja datang mentari pun redup semburat nya berwarna, aduh, hai. Tanda koma juga dipakai sebelum dan/atau sesudah kata sebagai sapaan, seperti Bu, Dik, atau Nak. Misalnya: Wah, indah sekali pemandangan di Pantan Terong!

Kamu setuju kan, Nak? Bab I - Jelajah Nusantara - 294.Kata depan, seperti di, ke, dan dari, ditulis terpisah dari kata yang mengikutinya.

Misalnya: a. Di mana Toko Kopi Djawa? b. Dia ikut berlibur ke Yogyakarta. c. Ia berasal dari Kota Musik. Sekarang kalian akan menyunting teks “Berkunjung ke Negeri di Atas Awan”.

Cermatilah penggunaan huruf kapital dan tanda koma, lalu lengkapi dengan kata depan, ya! Berkunjung ke Negeri di Atas Awan Selamat malam kakak-kakak selamat datang _____ desa denge. desa ini adalah desa terdekat _____ wae rebo. malam ini kalian akan menginap di sini, lalu besok pagi kita akan memulai perjalanan menuju wae rebo.

dalam perjalanan esok kita akan menempuh jarak yang cukup jauh dengan berjalan kaki. karena itu silakan kakak-kakak menyiapkan sebuah tas ransel yang berisi keperluan untuk menginap semalam.

kenakan juga pakaian yang nyaman dan menyerap keringat. karena sekarang sedang musim hujan sebaiknya kenakan celana training atau celana panjang untuk menghindari lintah. o ya jangan lupa juga untuk membawa jas hujan dan baju hangat karena malam ______ wae rebo pasti dingin.

Untuk persiapan perlengkapan ada yang mau ditanyakan dahulu kak? saya lanjutkan ke perjalanan kita esok ya. ______ denge kita akan naik mobil melewati jembatan yang melintasi sungai wae lomba.

setelah 3 0 - Bahasa Indonesia - SMP Kelas VIIitu kita akan berjalan kaki kira-kira 3 jam lamanya sebelum tiba ______ poco roko atau pos 2. di sini kita akan beristirahat sebentar. lalu kita akan melanjutkan perjalanan melintasi hutan lebat menuju pos terakhir. di sini saya akan memukul kentungan sebagai tanda bahwa ada tamu yang akan berkunjung. kita akan menunggu sampai terdengar kentungan jawaban ______ wae rebo. setibanya _____ gerbang desa kita tidak boleh mengambil gambar atau melakukan apa pun sebelum menghadap kepala adat.

maka kita akan langsung menuju _____ rumah gendang untuk mengikuti upacara adat waelu. upacara ini dipimpin oleh kepala adat sebagai ungkapan selamat datang kepada para wisatawan. selain penyambutan kita juga akan diberkati dengan doa-doa agar selamat aman dan tidak ada gangguan selama berkunjung ______ wae rebo. cukup jelas ya kak? kakak-kakak akan menginap semalam ______ mbaru niang.

kalian akan merasakan bagaimana kehidupan _______ wae rebo dengan bersosialisasi langsung dan mengikuti beberapa kegiatan khas wae rebo yaitu menanam dan mengolah biji kopi juga menenun songket. F. Menyajikan Teks Deskripsi Sederhana Kegiatan 10: Memaparkan Ciri Benda Kesukaan Menulis Tahukah kalian bahwa orang lain kadang mengenali senja datang mentari pun redup semburat nya berwarna dari benda-benda yang kita sukai? Sekarang fotolah benda-benda yang kalian sukai di kamar atau di rumah kalian.

Tentu kalian juga dapat menggambarnya. Sesuatu ini dapat berupa makanan, alat tulis, buku, tanaman, binatang piaraan, atau apa saja yang identik dengan diri kalian. Tuliskan ciri-ciri benda tersebut pada diagram ini. Setelah itu, tulis beberapa kalimat deskripsi tentang benda tersebut, lalu ceritakan benda ini kepada teman-teman kalian.

Gunakan kata sapaan yang akrab dan santun untuk menarik mereka. Ingat, kalian harus membuat teman-teman kalian dapat membayangkan, menyentuh, melihat langsung, meraba, membau, atau merasakan benda ini. Gunakan kata konkret dan kalimat perinci, ya.

Bab I - Jelajah Nusantara - 31Bentuk warna Tekstur Nama Aroma benda rasa Bau Gambar 1.8 Diagram Benda Kesukaan Dengan mengembangkan kerangka di atas menjadi tulisan, kalian berlatih menulis teks deskripsi sederhana.

3 2 - Bahasa Indonesia - SMP Kelas VIIKegiatan 11: Menyimak dan Menilai Paparan Teman Menyimak Dengarlah presentasi teman tentang benda kesukaannya. Saat menyimak, isilah lembar penilaian ini. Begini cara mengisinya: (1) Warnai salah satu emotikon pada poin pertanyaan nomor 1—3! (2) Kemudian, berikan catatan untuk memperbaiki presentasi itu pada poin nomor 4!

(3)Terakhir, jangan lupa memberikan kata-kata penyemangat kepada teman kalian pada poin nomor 5! Lembar Penilaian Presentasi Hari, Tanggal : Nama : Kelas : Benda Kesukaan : 1. Menurut saya, teman saya sudah menyapa pendengar dengan menarik. 2. Menurut saya, teman saya sudah menjelaskan alasan memilih benda kesukaannya dengan baik.

3. Menurut saya, kalimat-kalimat yang digunakan dalam presentasinya membuat saya dapat membayangkan benda kesukaannya itu. 4. Hal penting apa yang perlu diperbaiki dalam presentasi ini? 5. Kata-kata penyemangat: Bab I - Jelajah Nusantara - 33Jurnal Membaca Jurnal Membaca Nama Penulis: Judul Buku: Penerbit: Tahun: Teks deskripsi favorit pada buku ini: Hal yang kubayangkan saat membaca teks deskripsi ini: Catatan Kata Selain Jurnal Membaca, kalian juga akan mencari kosakata baru dalam Catatan Kata berikut.

Perhatikan caranya! 1. Dari buku-buku yang kalian baca, baik iksi maupun noniksi, temukan kata-kata yang jarang muncul atau kata baru. 2. Cari arti kata-kata tersebut dalam kamus dan tuliskan dalam kartu-kartu kata di bawah ini. 3 4 - Bahasa Indonesia - SMP Kelas VIIKata Baru: Arti dalam Kamus: Kata Baru: Arti dalam Kamus: Contoh dalam Kalimat: Contoh dalam Kalimat: Kata Baru: Arti dalam Kamus: Kata Baru: Arti dalam Kamus: Contoh dalam Kalimat: Contoh dalam Kalimat: Refleksi Selamat!

Kalian sudah mempelajari Bab I. Apa yang sudah kalian pelajari? Beri tanda centang pada apa yang sudah dapat kalian lakukan dan sudah kalian pahami di tabel ini, ya. Tabel 1.8 Releksi Masih Perlu Belajar Lagi No Pada Bab I Ini: Sudah Bisa 1. Saya mengidentiikasi beragam teks deskripsi, baik yang menggambarkan keindahan alam maupun benda. 2. Saya menemukan informasi dan membuat simpulan dari teks deskripsi tentang keindahan alam.

3. Saya mengidentiikasi gaya menyapa pembaca pada teks deskripsi di media sosial. 4. Saya mengidentiikasi manfaat teks deskripsi dalam komunikasi sehari-hari. 5. Saya mengidentiikasi kata konkret dan kalimat perinci dalam teks deskripsi. Bab I - Jelajah Nusantara - 356.

Saya mengidentiikasi majas personiikasi dalam teks deskripsi. 7. Saya menganalisis informasi dalam pamlet. 8. Saya membandingkan penyajian gambar dalam pamlet wisata. 9. Saya memahami kombinasi awalan dan kata dasar berawalan k, p, t, s. 10. Saya membandingkan dua teks deskripsi lisan untuk pendengar yang berbeda. 11. Saya dapat menyunting penulisan huruf kapital dan kata depan.

12. Saya dapat menulis teks deskripsi singkat tentang benda yang saya kenali. 13. Saya dapat menceritakan teks deskripsi tentang benda kepada teman dengan sapaan yang tepat.

14 Saya dapat memberikan penilaian terhadap teks deskripsi yang ditullis dan dituturkan oleh teman. Pengetahuan atau keterampilan yang sudah saya pelajari: 1. __________________________________________________________________________________________________ 2.

__________________________________________________________________________________________________ 3. __________________________________________________________________________________________________ Refleksi Proses Belajar 1.

Kegiatan yang paling sulit bagi saya pada bab ini: 2. Hal yang saya lakukan untuk memperbaiki hasil belajar saya: 3. Kepada siapa saya minta bantuan untuk memperbaiki hasil belajar saya: 4.

Pandangan saya terhadap usaha belajar yang telah saya lakukan: 12 3 4 5 Lingkari salah satu angka untuk menggambarkan: 1 = sangat tidak puas 4 = puas 2 = tidak puas 5 = sangat puas 3 = biasa saja 3 6 - Bahasa Indonesia - SMP Kelas VIIKEMENTERIAN PENDIDIKAN, KEBUDAYAAN, RISET, DAN TEKNOLOGI REPUBLIK INDONESIA, 2021 Bahasa Indonesia Buku Siswa SMP Kelas VII Penulis: Rakhma Subarna, Soie Dewayani, Cicilia Erni Setyowai ISBN: 978-602-244-299-8 BAB II Berkelana di Dunia Imajinasi Pertanyaan Pemantik: 1.

Apakah puisi rakyat itu? 2. Apakah ciri dan elemen puisi rakyat? 3. Senja datang mentari pun redup semburat nya berwarna cerita fantasi? 4. Apa saja ciri dan elemennya? 5. Bagaimana membuat puisi dan cerita fantasi yang menarik? Tujuan Pembelajaran Pada bab ini kalian akan diajak untuk menyelami dan menyimak keindahan kata-kata dalam puisi dan cerita fantasi tentang sosok-sosok pemberani.

Kalian juga akan mempelajari dan mendiskusikan elemen dan gaya bahasa dalam puisi dan cerita fantasi agar kalian dapat menyajikannya dengan baik dan menarik. Bab II - Berkelana di Dunia Imajinasi - 37 Siap-Siap Belajar Apakah kalian suka membaca karya iksi seperti puisi? Siapa saja penulis dan penyair Indonesia kesukaan kalian? Apakah Sapardi Djoko Damono, Aan Mansyur, atau yang lain? Membaca karya sastra memperluas wawasan kalian tentang budaya Indonesia.

Kita pun memiliki warisan turun-temurun berupa cerita rakyat dan puisi rakyat. Masyarakat Indonesia telah mengenal puisi sejak lama. Genre puisi lama ini disebut juga sebagai puisi rakyat.

Puisi rakyat merupakan sastra yang berkembang pada masa masyarakat tradisional. Seperti apakah puisi rakyat itu? Bagaimana cara menyusunnya? Ayo kita pelajari bersama pada bab ini. Kata Kunci Puisi rakyat, pantun, syair, gurindam, larik, sampiran, rima, cerita fantasi, tema, alur, tokoh, latar, pesan cerita, klimaks, resolusi, protagonis, dan antagonis.

3 8 - Bahasa Indonesia - SMP Kelas VII Page 2 Bacalah puisi rakyat di bawah ini! Tali buaya semambu tunggal Kurnia Tengku Sultan Berimbangan Berakit-rakit ke hulu Yang diam di Pagaruyung Berenang-renang ke tepian Rumah bertiang terus jelatang Bersakit-sakit dahulu Rumah berbendul bayang-bayang Bersenang-senang kemudian Bertaburkan batang purut-purut Intisari Sastra Indonesia, Yadi Mulyadi, dkk.

Janganlah engkau mungkir setia padaku Kurang pikir kurang siasat Matilah engkau ditimpa daulat empat Tentu dirimu kelak tersesat penjuru alam Kalau mulut tajam dan kasar Mati ditimpa malaikat yang empat Boleh ditimpa bahaya besar puluh empat Mati ditimpa tiang Ka’bah http://sastra-indonesia.com/2008/12/ Mati dipanah halilintar mengenal-gurindam/ Mati disambar kilat senja Assalamualaikum anak cucu hantu Dikutip dengan penyesuaian dari Pusat Bahasa pemburu Yang diam di rimba sekampung Departemen Pendidikan Nasional, 2008: 211 Yang duduk di ceruh banir Yang bersandar di pinang burung Yang berteduh di bawah tukas Bab II - Berkelana di Dunia Imajinasi - 39A.

Mengenal dan Mengidentifikasi Unsur Puisi Rakyat Kegiatan 1: Mengenal Jenis dan Unsur Puisi Rakyat Membaca Dalam kelompok kecil berjumlah 3 hingga 4 orang, diskusikan puisi rakyat tersebut. Kemudian, tulislah pendapatmu tentang setiap puisi dengan mengisi tabel di bawah ini.

Kalian akan mendiskusikan tabel ini dengan kelompok lain dengan dibimbing oleh guru. Tabel 2.1 Perbandingan Puisi Jumlah Jumlah Jumlah Suku Pola Jenis Pesan dalam Bait Baris dalam Kata Tiap Rima Puisi Puisi Setiap Bait Baris Puisi 1 Puisi 2 Puisi 3 Kalian telah membandingkan ketiga puisi rakyat di atas bersama- sama.

Apakah kalian telah menemukan jenis untuk setiap puisi tersebut? Jika belum, simak penjelasan lebih lanjut tentang puisi rakyat. Puisi rakyat adalah sastra lisan berupa puisi terikat yang berkembang pada masa masyarakat tradisional. Dikatakan terikat karena puisi jenis ini diatur oleh ketentuan-ketentuan tertentu, seperti jumlah suku kata, jumlah baris, jumlah bait, dan rima.

Puisi rakyat umumnya bersifat anonim (nama pengarangnya tidak diketahui), diwariskan secara turun-temurun dari mulut ke mulut, dan disebarkan dalam bentuk yang tetap dan tidak berubah. Puisi rakyat terikat aturan-aturan seperti jumlah kata dalam tiap baris, jumlah baris dalam tiap bait, dan juga pengulangan kata yang bisa 4 0 - Bahasa Indonesia - SMP Kelas VIIterdapat di awal maupun akhir sajak (rima).

Berikut ini adalah beberapa jenis puisi rakyat. 1. Pantun a.Satu bait terdiri atas empat baris. b.Setiap baris terdiri atas 8--12 suku kata.

c. Baris pertama dan kedua merupakan sampiran, baris ketiga dan keempat merupakan isi. d. Rima akhirnya berpola a-b-a-b. Artinya, bunyi akhir baris pertama sama dengan bunyi akhir baris ketiga dan bunyi akhir baris kedua sama dengan baris keempat.

2. Gurindam a. Setiap bait terdiri atas dua baris atau larik. b. Setiap larik terdiri atas 8--14 suku kata.

c. Larik pertama merupakan syarat, sedangkan larik kedua merupakan jawaban. d. Larik pertama dan kedua membentuk kalimat majemuk, umumnya merupakan hubungan sebab-akibat. e. Rima akhirnya berpola a-a. 3. Mantra a)Terdiri dari beberapa rangkaian kata yang memiliki irama b)Isinya berhubungan dengan kekuatan gaib, dibuat dan diucapkan untuk tujuan tertentu c)Mengandung rayuan dan perintah d)Merupakan satu bagian yang utuh dan tidak bisa dipahami melalui setiap bagiannya e)Mementingkan keindahan permainan bunyi Bab II - Berkelana di Dunia Imajinasi - 41Kegiatan 2: Mengidentifikasi Tujuan Puisi Rakyat Berdiskusi Tujuan puisi rakyat adalah untuk menghibur pembaca, memberikan nasihat mendidik anak, memberikan isyarat untuk memulai suatu permainan, mengajak, melarang untuk melakukan sesuatu, menggambarkan perenungan, serta untuk memprotes ketidakadilan yang terjadi di masyarakat.

Hal-hal yang disampaikan dalam puisi rakyat biasanya berupa nasihat, sindiran, atau humor. Bacalah kembali Tabel Perbandingan Puisi yang telah kalian isi, lalu diskusikan pertanyaan berikut dengan teman kalian. 1. Manakah di antara puisi 1, 2, dan 3 yang memberikan nasihat bagi pembaca? 2.Manakah di antara ketiga puisi tersebut yang menggambarkan perenungan diri? 3. Manakah di antara ketiga puisi tersebut yang berisi rayuan?

Kegiatan 3: Mengidentifikasi Isi dan Unsur Puisi Rakyat Menyimak Salah satu teman kalian akan membacakan puisi rakyat fantasi ini. Simaklah dengan baik, ya! 4 2 - Bahasa Indonesia - SMP Kelas VIITembang Kinanthi Kinanthi panglipur wuyung Artinya: Rerenggane prawan sunthi Dibarengi dengan penghibur cinta Durung pasah doyan nginang Hiasannya perawan kencur Tapih pinjung tur mantesi Belum bisa makan kinang Mendah gene yen diwasa Mengenakan kain panjang dan Bumi langit gonjang ganjing pantas Apalagi nanti kalau dewasa Anoman malumpat sampun, Bumi langit akan bergerak.

Prapteng witing nagasari, Mulat mangandhap katingal, Anoman sudah melompat, Wanodyayu kuru aking, Datang di pohon nagasari, Gelung rusak wor lankisma, Melihat ke bawah terlihat, Kangiga-iga kaeksi. Seorang wanita kurus kering, Gelungnya rusak campur tanah, Terlihat iganya yang kurus.

https://www.senibudayaku.com/2018/09/contoh-tembang- macapat-kinanthi.html Bab II - Berkelana di Dunia Imajinasi - 43Tembang Kinanthi di atas adalah jenis puisi rakyat yang termasuk dalam puisi tradisional Jawa. Setiap baitnya terdiri atas kalimat berjumlah sama. Jumlah kalimat dalam bait ini disebut gatra. Setiap gatra berisi jumlah suku kata yang sama pula. Jumlah suku kata ini disebut guru wilangan.

Sedanglan bunyi akhir pada setiap baris disebut guru lagu. Macapat juga biasanya dilagukan dengan irama tertentu.

Setelah menyimak, jawablah pertanyaan senja datang mentari pun redup semburat nya berwarna. 1. Apakah persamaan puisi tersebut dengan pantun, syair, gurindam yang telah kalian pelajari sebelumnya?

2. Apakah perbedaan puisi tersebut dengan ketiga puisi rakyat sebelumnya? Kegiatan 4a: Berkreasi dengan Puisi Rakyat Menulis Sampai saat ini puisi rakyat masih ada dan terus berkembang di masyarakat. Pernahkah kalian menghadiri sebuah acara pernikahan atau upacara adat dan orang-orang dewasa saling berbalas pantun?

Beberapa lirik lagu daerah juga memiliki syair yang berima. Bagaimana dengan lagu di daerah kalian? Apakah lagu itu juga memiliki syair yang berima? Bagaimana dengan lagu kesukaan kalian? Nah, kali ini kalian akan membuat sebuah pantun atau syair dengan mengikuti langkah-langkah membuat puisi rakyat berikut.

1. Menentukan tema Tema merupakan gagasan pokok yang diungkapkan d a l a m p u i s i senja datang mentari pun redup semburat nya berwarna. Te m a i n i biasanya memuat gagasan, perasaan, atau pesan yang ingin 4 4 - Bahasa Indonesia - SMP Kelas VIIdiungkapkan kepada pembaca atau pendengar puisi. Pilihlah salah satu dari ketiga tema di bawah ini: a. berbakti kepada orang tua, b.

persahabatan, atau c. pahlawan sejati atau seseorang yang telah berjasa kepada lingkungan atau masyarakatnya. Tema yang kupilih: 1. Menentukan pernyataan-pernyataan sesuai dengan tema Pernyataan-pernyataan adalah kalimat-kalimat yang dapat menjadi kerangka dalam menyusun larik.

Pernyataan-pernyataan ini harus sesuai dengan tema sehingga puisi kalian memuat gagasan atau pesan yang jelas. Misalnya, berdasarkan tema \"Pahlawan di Sekitar Kita\", pernyataan- pernyataan yang dapat kalian buat adalah sebagai berikut.

(1) Pahlawan itu suka menolong tanpa pandang bulu. (2) Pahlawan itu tak pernah mengharapkan imbalan. (3) Pahlawan itu disukai dan dicintai banyak orang. Pernyataan-pernyataanku: 1. Menentukan larik isi a.

Jika kalian akan menyusun puisi rakyat berupa pantun, kalian memerlukan dua sampiran dan dua isi, terdiri atas 8—12 suku kata, dan dengan pola rima a-b-a-b. Buah mangga buah mengkudu Buah stroberi dalam keranjang Pahlawan menolong tanpa pandang bulu Kelak disukai dan dicintai banyak orang Bab II - Berkelana di Dunia Imajinasi - 45Pantunku: a.

jika kalian ingin membuat mantra, kalian harus merangkai beberapa kata yang memiliki irama. sihir lontar pinang lontar terletak di ujung bumi setan buta jembalang buta aku sapa tidak berbunyi mantraku: 4. Membaca puisi teman a. Buatlah kelompok terdiri atas tiga orang dengan teman kalian. Tukarlah puisi kalian secara bergiliran.

b. Pada saat membaca puisi teman, amati puisi rakyat yang dibuat oleh teman sudah memenuhi ketentuan puisi rakyat atau belum. Gunakan tabel berikut ini untuk menuliskan pendapat kalian, ya. c. Masukan teman-teman dapat menjadi bahan untuk memperbaiki karya kalian. 4 6 - Bahasa Indonesia - SMP Kelas VIITabel senja datang mentari pun redup semburat nya berwarna Membaca Puisi Teman No Nama Jenis Jumlah Rima Pesan yang Komentar/ 1.

Puisi Baris Disampaikan Tanggapan 2. 3. Kegiatan 4b: Musikalisasi Puisi Kreativitas Mencoba Tantangan: Berpuisi 3 Menit Salah satu jenis musikalisasi puisi adalah membacakan puisi dengan diiringi lagu. Kalian telah menulis puisi, sekarang lakukan tugas berikut ini. 1. Pilih alat musik sederhana untuk mengiringi puisi kalian, misalnya gitar.

2. Pilih sebuah lagu yang sesuai dengan isi puisi kalian. 3. Kalian dapat melihat contoh musikalisasi puisi di kanal YouTube Badan Pengembangan dan Pembinaan Bahasa di laman h t t p s : // w w w.y o ut ub e.

c o m /c / B a d a n B a h a s a d a n P e r b u k u a n / search?query=musikalisasi%20puisi 4. Bacalah puisi kalian diiringi lagu tersebut dengan durasi 1--3 menit. 5. Unggah video tersebut di media sosial kalian (YouTube atau IGTV). Selamat berkarya! Bab II - Berkelana di Dunia Imajinasi - 47B. Mengidentifikasi Elemen dalam Teks Naratif Kegiatan 5: Mengidentifikasi Alur dalam Cerita Fantasi Membaca Bacalah kembali teks puisi “Tembang Kinanthi”. Puisi tersebut bergenre fantasi.

Apabila puisi tersebut dikembangkan menjadi sebuah cerita, kira- kira akan seperti apa ceritanya? Pertama-tama, kalian akan mengembangkan tokoh-tokoh dalam puisi tersebut, misalnya seperti berikut ini. 1. Apakah Anoman seorang manusia atau makhluk gaib?

senja datang mentari pun redup semburat nya berwarna

2. Apakah ia memiliki kekuatan gaib? 3. Apa yang sedang ia lakukan di atas pohon nagasari? Teks fantasi merupakan cerita yang bersifat khayalan atau imajinatif. dalam puisi di atas, anoman yang adalah kera berbulu putih dan dapat terbang adalah khayalan penulis. Untuk menarik pembaca, biasanya tokoh dalam cerita fantasi dapat memiliki keahlian atau kekuatan tertentu. Tokoh seperti dewa-dewi, raksaksa, makhluk ajaib, manusia dengan kesaktian adalah tokoh dalam cerita fantasi yang tidak ada dalam kehidupan nyata.

Cerita fantasi dapat berupa cerita yang mengkhayalkan kejadian pada masa depan. Cerita jenis ini disebut cerita futuristik. Selain cerita jenis ini, ada cerita fantasi tentang khayalan seseorang atau cerita tentang peri. Sekarang bacalah cerita fantasi berikut ini. 4 8 - Bahasa Indonesia - SMP Kelas VIIBola-Bola Waktu Oleh Rakhma Subarna Ivan menendang kerikil di jalan dengan kasar hingga terpelanting berhamburan.

Debu mengepul dari kerikil-kerikil itu. Lagi-lagi ia dijadikan bahan tertawaan! Ini semua gara-gara kue basah Ibu! Setiap hari Ivan harus bangun pukul setengah empat pagi dan membantu Ibu membuat aneka kue basah. Ivan juga harus pergi lebih pagi untuk mengantarkan kue-kue itu ke beberapa warung menuju sekolah. Hal yang paling memalukan, Ivan menitipkan kue itu senja datang mentari pun redup semburat nya berwarna di kantin sekolah!

Ketika Fiam, anak paling usil di kelasnya tahu, ia segera mengejek Ivan. Dan begitu Fiam memulai, julukan “tukang kue” untuknya pun langsung diikuti teman-teman sekelas.

Seolah belum cukup memalukan, bangun pagi dan rasa lelah bekerja sejak subuh membuat Ivan sering tertidur saat pelajaran. “Wah, tukang kue mau alih profesi jadi tukang tidur,” ejek Fiam yang memancing tawa sekelas.

Ivan masih menendang kerikil-kerikil itu. “Aku tidak mau lagi!” teriak Ivan dalam hatinya. “Aku tidak mau lagi berjualan kue.

Aku ingin menjadi anak SMP yang senja datang mentari pun redup semburat nya berwarna dan dikagumi oleh teman-temanku!” “Kau yakin?” Ivan menengok. Seorang pria berkerudung hitam memandangnya. Bibir pria itu tersenyum ramah. Di meja di hadapannya tergeletak aneka bola warna- warni. Ivan memandang pria itu sambil mengerutkan alisnya.

Apakah dia peramal? tanya Ivan dalam hati. Bab II - Berkelana di Dunia Imajinasi - 49“Kau ingin melihat apa yang terjadi apabila kau berhenti berjualan kue?” Ragu-ragu, Ivan mengangguk.

Ia lalu mengambil bola merah yang disodorkan pria itu. Seketika, tubuhnya terasa ringan, dunia di sekitarnya berputar. Ivan terkesiap. Ia terbangun di sebuah kamar yang terasa asing. Dengan heran, ia menatap Nina dan Danu, adiknya. Mengapa mereka tidur di sini? Ivan menatap sekeliling. Kamar itu sempit, pengap, dan terutama sangat berantakan! Barang-barang miliknya senja datang mentari pun redup semburat nya berwarna di mana saja, sementara tumpukan buku koleksi Nina dan mainan Danu memenuhi sudut-sudut kamar.

“Pukul 06.00? Aku terlambat untuk membuat kue!” Ivan segera berdiri dan keluar kamar. “Kamu sudah bangun, Van?” suara Ibu menyapanya. Mata Ivan membelalak lebar melihat kerut-kerut yang bertambah di wajah Ibu dan kelelahan yang tergambar jelas di sana. “Syukurlah. Ibu pergi dahulu, ya. Jangan lupa, antar adik-adikmu ke sekolah.” Ivan termangu.

Ia menatap sosok Ibu yang membawa kotak-kotak berisi aneka kue basah. Jadi, tampaknya mereka masih berjualan kue basah. Hanya, kali ini, Ibu tidak meminta bantuannya. Akhirnya, Ivan terbebas dari tugasnya! Lalu, di mana Ayah?

Biasanya Ayah yang mengantar Ibu untuk pergi berjualan. Ivan memandang ke sekeliling ruangan. Saat itulah Ivan menatap sebuah foto berbingkai hitam di dekat meja makan. Di dalamnya, wajah lelah ayahnya tersenyum ramah. *** “Van, nanti siang jangan lupa latihan basket, ya.

Minggu depan kita lawan SMP Bina Bangsa.” Ivan hanya mengangguk lesu. Sekarang ia tahu, ia berada di tahun 2022. Tidak ada lagi teman-teman sekelas yang mengejeknya. Malah bisa dikatakan, ia memiliki cukup banyak teman. Nilai-nilainya bukan yang terbaik, 5 0 - Bahasa Indonesia - SMP Kelas VIItetapi bukan pula yang paling jelek. Ia berhasil masuk tim basket selama dua tahun berturut-turut.

Semua tampak sempurna. Namun, mengapa Ivan menyesal berada di tahun ini? Tadi pagi ia mengetahui bahwa ayahnya tidak lagi bersama mereka. Ayah meninggal karena sakit. Kata Ibu, Ayah sering mengabaikan sakit yang dideritanya dan berkeras membantu Ibu. Ayah bahkan menolak tawaran Ibu untuk membayar seorang pekerja. Ayah ingin hasil penjualan kue ditabung untuk biaya kuliah Ivan nanti.

“Hai, Van! Apakah Ibumu sudah sembuh? Mamaku ingin pesan kue basah untuk arisan, tetapi Ibumu bilang ia sedang tidak enak badan.” Perkataan Hario menyadarkan Ivan lagi dari lamunannya. Ivan menunduk. Ia teringat wajah menua dan lelah ibunya tadi pagi, bahkan Ibunya tidak mengatakan kepadanya bahwa ia sedang sakit. Ivan menelengkupkan kepala di atas meja. Andai saja penyesalan bisa memutar kembali waktu, ia lebih memilih membantu kedua orang tuanya berjualan kue.

Matanya terasa panas. Kepalanya terasa berputar. Ivan mengerjap. “Van, kamu nggak apa-apa, Van?” suara Hario terdengar cemas dan makin jauh. Lalu segalanya gelap. *** Seseorang mengguncang tubuhnya lembut. “Ivan, bangun, Nak.” Ivan memicingkan mata. Ia mengenal suara tegas tetapi lembut itu. senja datang mentari pun redup semburat nya berwarna Syukurlah!” Ivan segera tersadar dan memeluk ayahnya erat.

“Wah, wah, wah …! Tadi kamu mimpi buruk, ya?” Pagi masih gelap saat Ivan melihat ke luar jendela. Ivan tahu ia harus bangun lebih pagi karena mereka mendapat pesanan kue untuk acara pernikahan dan rapat di kantor RW.

Memikirkan pesanan kue itu, Ivan melompat dari tempat tidur dengan penuh semangat. “Ayah, Ibu, tahu nggak? Kue-kue basah buatan Ibu ini banyak yang suka, loh!” cerita Ivan. Untuk sesaat, Ayah dan Ibu saling memandang dan menyimpan senyum geli. Mungkin mereka heran melihat Ivan yang tak lagi menggerutu dan malas-malasan saat membantu. “Eih, aku serius loh ini,” tambah Ivan lagi melihat reaksi kedua orang tuanya. Bab II - Berkelana di Dunia Imajinasi - 51Ayah tergelak.

Ia mengusap kepala Ivan dengan lembut, “Tentu saja kami tahu, ini kan resep warisan turun-temurun!” Tepat pukul 05.00, kue-kue basah nan cantik telah siap. Harum manis kue memenuhi rumah. Meski lelah, Ivan merasa bangga melihat kue-kue yang baru ditatanya. Rasanya ia makin mahir menata kue-kue ini. “Van, tolong masukkan setiap jenis ke dalam kotak untuk pesanan kawinan dan Pak RW, ya.

Biar Ayah yang menyiapkan untuk dibawa ke pasar. Ibu mau membuat sarapan dahulu sebelum adik-adikmu bangun,” kata Ibu. Ivan mengangguk. Saat memasukkan kue-kue ke dalam setiap kotak, sebuah ide melintas dalam benaknya.

Masih ada 30 menit sebelum ia harus bersiap ke sekolah. Ivan mengambil selembar kertas, lalu segera menggambar sebuah kotak berisi aneka kue cantik. “Camilan Cantik Akhir Minggu,” begitu Ivan memberi judul gambar tersebut.

Di bagian bawah gambar, Ivan menulis, “Untuk pemesanan, hubungi Ivan – kelas VII B.” Kemudian, jawablah pertanyaan di bawah ini! 1. Siapakah nama tokoh cerita Bola-Bola Waktu? 2. Apa yang diinginkannya di awal cerita?

3. Bagaimana ia memenuhi keinginannya itu? 4. Mengapa ia merasa sedih ketika akhirnya keinginannya itu tercapai? 5. Apa yang akhirnya ia lakukan?

6. Menurut kalian, bagaimana perasaannya di akhir cerita? 5 2 - Bahasa Indonesia - SMP Kelas VIIKupas Teori Teks naratif adalah cerita imajinatif berisi serangkaian kejadian berurutan yang menggambarkan alur awal, tengah, dan akhir.

Teks naratif biasanya menggambarkan seorang tokoh yang mengalami masalah. Masalah biasanya bermula saat tokoh tidak mendapatkan sesuatu yang diinginkannya. Alur cerita menggambarkan bagaimana ia berusaha untuk mendapatkan keinginannya tersebut. Pada bagian akhir ini, tokoh telah mendapatkan resolusi atau penyelesaian masalah. KLIMAKS resolusi mulai terjadi masalah Gambar 2.1 Alur Cerita Kegiatan 6: Menuliskan Ulang Alur Teks Naratif Menulis Sekarang tuliskan ulang bagian cerita \"Bola-bola Waktu\" dengan bahasa kalian sendiri.

Manakah kejadian atau adegan yang menurut kalian menggambarkan bagian awal, tengah, dan akhir cerita? Lengkapi tabel di bawah ini. Tabel 2.3 Menulis Ulang Alur Teks Naratif Bagian Kejadian/Adegan Awal Masalah apa yang dialami tokoh? Apa keinginannya? Tengah Apa saja rangkaian usaha yang ia lakukan atau kejadian yang Akhir ia alami untuk menyelesaikan masalahnya tersebut?

1. 2. 3. Apakah tokoh utama mendapatkan apa yang ia inginkan atau ia mengubah dirinya/keinginannya sendiri? Dengan menganalisis teks naratif di atas, kalian berlatih menjelaskan perubahan lebih terperinci tentang alur cerita pada teks naratif.

Bab II - Berkelana di Dunia Imajinasi - 53Kegiatan 7: Mengkaji Penokohan dalam Cerita Fantasi Membaca Sekarang bacalah cerita komik berikut ini.

Oleh: Rakhma Subarna Namaku Mao. Setelah Sudah satu bulan berusaha keras, sekolah berjalan, aku akhirnya aku diterima belum memiliki teman di sekolah Peri Juara. peri. Mao, apa yang kaulakukan? Kau pasti melupakan mantranya! Semua berawal dari kesulitanku mengikuti pelajaran. Maafkan aku Mulai sekarang, jangan dekati dia. Nanti kita ketularan bodohnya. Hii! Aw Dasar bodoh! Kau selalu membuat kekacauan! 5 4 - Bahasa Indonesia - SMP Kelas VIIMao tertunduk sedih di bangkunya.

Aku menyukai bolumu. Lembut sekali! Aku juga suka teh hijau beku di siang terik waktu itu! Coba baca ini, Pegang dengan Ayam bakar agar sihirmu mantap, putar memang paling tidak salah lagi. pas setelah lelah perlahan. belajar seharian! Aku memang peri bodoh. Sejak saat itu, Mao lebih sering belajar. Besok dalam ulangan Meski terkadang masih salah, tetapi… sihir, aku pasti gagal lagi.

Sempurna, Mao! Akhirnya, kau menguasai mantra ini. Tenanglah, Mao … kau hanya Apa kubilang, kau pasti bisa! perlu terus berusaha. Kau bisa Sayang, aku tidak mendapat jadi peri makanan yang unik, lho.

ayam bakar lagi. Bab II - Berkelana di Dunia Imajinasi - 55Siapa bilang? Ke mana Ini ayam bakar untukmu. Piru? Terima kasih sudah Hentikan! membantuku selalu.

Jangan ganggu Cling Wah, sekarang kau dia!! adalah peri makanan yang berbakat! Kau mau jadi sok jagoan, ya? Jauhi Mao atau kami semua akan menjauhimu! Wah, wah, peri bodoh bisa marah juga!

Bisakah kau Teman-teman, menciptakan lebih hentikan! banyak lagi? Kenapa kalian malah makan?! Hmm, ini cokelat kesukaanku. Stoberi, blueberi, hilangkan semua rasa Wah, enak sekali! marah dan benci! Tuh kan, benar. Kau bisa menjadi Dan sebagai ganti makanan-makanan yang peri makanan yang hebat!

disihir Mao untuk mereka. Sejak saat itu, Mao tidak .mereka semua membantu Mao belajar. pernah lagi sendiri. 5 6 - Bahasa Indonesia - SMP Kelas VIISekarang tuliskan jawaban atas pertanyaan-pertanyaan di bawah ini, lalu bandingkan dengan jawaban teman kalian.

Diskusikan apakah jawaban kalian sama atau berbeda, ya. Tabel 2.4 Mengkaji Tokoh Cerita Fantasi Pertanyaan Jawaban Saya Jawaban Teman 1. Siapa nama tokoh pada teks di atas?

2. Tempat imajinatif apa yang mereka tinggali? 3. Apa yang mereka pelajari di sekolah mereka? 4. Menurut kalian, bagaimana sifat Mao? 5. Menurut kalian, bagaimana sifat Piru? 6. Mengapa Piru mendapatkan perlakuan buruk dari Yari dan teman-temannya?

7. Bagaimana Piru dapat terhindar dari perlakuan tersebut? 8. Apakah kalian setuju dengan perbuatan Piru? 9. Dalam cerita ini, Yari menerima balasan atas perilaku buruknya. Apakah yang dialami Yari pada akhir cerita? 10. Apakah kalian pernah menemukan seseorang dengan perilaku seperti Yari dan teman-temannya dalam kehidupan sehari-hari? 11. Menurut kalian, apakah amanat cerita ini?

Apakah tujuan penulis menampilkan tokoh dengan karakter seperti Yari, Mao, dan Piru? Dengan menjawab pertanyaan di atas, kalian berlatih menyimpulkan sifat tokoh cerita dan amanat penulis dalam teks naratif komik tentang pergaulan remaja.

Bab II - Berkelana di Dunia Imajinasi - 57Kegiatan 8: Mengenali Majas Sarkasme dalam Cerita Fantasi Kupas Teori \"Kau mau jadi sok jagoan, ya? Jauhi Mao atau kami semua akan menjauhimu!\" Pernyataan di atas adalah contoh sarkasme. Majas sarkasme adalah majas yang berisi sindiran yang bertujuan untuk menyakiti perasaan seseorang. Majas sarkasme digunakan penulis untuk menggambarkan perilaku tokoh antagonis, yaitu tokoh yang memiliki perilaku buruk dalam cerita.

Majas sarkasme biasanya diucapkan secara langsung oleh tokoh cerita. Dalam cerita komik, pengungkapan langsung dapat dikenali dari penulisannya dalam balon kata. Bacalah ulang cerita \"Kue-Kue Mao\" dan tuliskan pengungkapan tokoh yang menggunakan majas sarkasme. Sebutkan pula nama tokoh yang mengucapkannya.

Jangan lupa menuliskan tanda baca yang tepat untuk ungkapan langsung tersebut. Kalian dapat mengikuti contoh di bawah ini. 1. \"Dasar bodoh! Kau selalu membuat kekacauan!\" kata Yari. 2. 3. 4. 5. Kegiatan 9: Membandingkan Penokohan dalam Cerita Komik Berdiskusi Pada bagian awal bab ini terdapat sedikit penjelasan tentang cerita rakyat. Cerita rakyat adalah cerita yang dituturkan secara turun-temurun. Biasanya, cerita rakyat memiliki beberapa versi. Sekarang kalian akan mengkaji struktur komik \"Keberanian Emas\" yang diadaptasi dari cerita rakyat \"Timun Mas\" ini.

Bacalah dengan cermat, ya. 5 8 - Bahasa Indonesia - SMP Kelas VIIKeberanian Oleh: Rakhma Subarna Emas Emas tumbuh makin besar, tetapi ia selalu sendirian. Semua takut kepadanya karena mengetahui Emas adalah milik Raksasa. Suatu hari Raksasa akan menangkap dan memakannya. Tentu saja Emas merasa sedih. Namun, ia paling sedih setiap kali pulang ke rumah dan menemui ibunya.

Aku pulang! Ibu pun meminta bantuan kepada seorang pertapa. Aku mengenal Jangan sedih terus, Bu. Kita pasti bisa kebaikan dan menemukan cara untuk mengalahkan raksasa itu. Aku tidak mau menjadi santapannya. Aku kecerdasan Emas. Gunakanlah keempat ingin terus tinggal bersama Ibu. benda ini untuk mengalahkan raksasa. Tapi ingat, Emas harus percaya dan memiliki keberanian. Kau memang Terima kasih, anakku yang Tuan Pertapa!

paling berani. Emas merasa heran ketika menerima empat kantong itu. Aku pasti Tidak semudah itu! akan kembali, Bu. Emas, di manakah kamu? Kemarilah, aku akan memakanmu! Namun, ia bertekad untuk percaya. Dengan penuh keberanian, ia bermaksud untuk mengalahkan raksasa.

Bab II - Berkelana di Dunia Imajinasi - 59Argh! Anak bodoh, kemarilah! Percuma Apa ini? saja kau berlari, aku akan memakanmu! Coba saja, aku tidak takut! Dasar bebal! Berani-beraninya kau melukaiku! Akan kutangkap dan kumakan habis kau, gadis bodoh! Huahaha, jangan coba-coba lari lagi. Kemarilah, aku tak sabar untuk memakanmu! 6 0 - Bahasa Indonesia - SMP Kelas VIIHiyaaa! Gawat! Mengapa Aku pasti bisa! Aku ia belum menyerah berjanji bahwa aku juga?

pasti kembali. Bab II - Berkelana di Dunia Imajinasi - 61Hahaha, Hiyaaa! sudah cukup, gadis bodoh? Emas pun hidup damai dan bahagia Kemarilah, bersama ibunya. Namun, tak hanya itu, waktunya aku kabar keberhasilan Emas tersebar ke memakanmu! seluruh desa. Argh, Ibu aku berhasil! Aku kembali! Aku Teman-teman Emas merasa kagum dan pulang!

bangga. Kini Emas tak pernah sendirian lagi. Ia memiliki banyak teman. Protagonis: Tokoh utama dalam cerita iksi. Antagonis: Tokoh lawan atau tokoh dalam cerita iksi yang menentang tokoh utama. Kalian telah membaca dua cerita komik, yaitu \"Kue-Kue Mao\" dan \"Keberanian Emas\". Keduanya sama-sama menampilkan tokoh cerita yang berusaha untuk mengatasi permasalahannya.

Dua cerita fantasi tersebut tentunya memiliki perbedaan pula. Salah satu perbedaan yang 6 2 - Bahasa Indonesia - SMP Kelas VIIdapat kalian amati adalah terkait penokohan. Diskusikan pertanyaan ini dengan teman kalian. 1. Siapakah protagonis dalam cerita \"Kue-Kue Mao\"? 2. Siapakah protagonis dalam cerita \"Keberanian Emas\"?

3. Siapakah antagonis dalam cerita \"Kue-Kue Mao\"? 4. Siapakah antagonis dalam cerita \"Keberanian Emas?\" 5. Bandingkan protagonis dalam cerita \"Kue-Kue Mao\" dan \"Keberanian Emas\"! a. Apakah permasalahan yang dihadapi oleh setiap protagonis? b. Bagaimana perbandingan sifat dan perilaku setiap protagonis? c. Bagaimana setiap protagonis menyelesaikan masalahnya? d. Adakah pihak lain yang membantu setiap protagonis dalam menyelesaikan masalahnya? Kegiatan 10: Menilai Alur dalam Cerita Fantasi Membaca Sekarang kajilah cerita \"Keberanian Emas\" dengan diagram alur teks naratif ini.

Isilah kotak-kotak ini dengan apa yang kalian pahami terhadap perbuatan tokoh atau adegan dalam cerita. Awal: Akhir: Latar tempat: Hal yang dialami tokoh utama: Latar keluarga tokoh utama: Hal yang dialami antagonis: Petunjuk permasalahan Amanat atau tujuan penulis: yang dihadapi tokoh utama: Klimaks: Adegan aksi yang paling menegangkan: Gambar 2.2 Diagram Alur Teks Naratif Dengan mengkaji diagram di atas, kalian berlatih untuk mengkaji atau menilai alur pada teks naratif.

Bab II - Berkelana di Dunia Imajinasi - 63Kegiatan 11: Kalimat Langsung dan Tak Langsung dalam Teks Fantasi Kupas Teori Selain sarkasme yang telah kita pelajari, kalimat langsung dan tak langsung pun umum ditemui dalam bacaan fantasi. Kalimat langsung adalah kalimat kutipan perkataan seseorang secara langsung. Kalimat tak langsung adalah kalimat yang menyatakan kembali ucapan seseorang.

Kalimat Langsung Raksasa berseru, \"Dasar bebal! Berani-beraninya kau melukaiku! Akan kutangkap dan kumakan habis kau, gadis bodoh!\" Kalimat Tak Langsung Raksasa tak menyangka Emas berani melukainya. Ia mengancam akan menangkap dan memakan Emas. Kalimat Langsung Ibu berkata, \"Terima kasih, Tuan Pertapa!\" Kalimat Tak Langsung Ibu mengatakan terima kasih kepada pertapa.

Ciri-ciri kalimat langsung adalah menggunakan tanda petik buka (\") pada bagian awal kalimat dan tanda petik tutup (\") pada akhir kalimat. Sekarang ubah kalimat-kalimat langsung berikut menjadi kalimat tidak langsung. 1. Emas berkata, \"Jangan sedih terus, Bu. Kita pasti bisa menemukan cara 6 4 - Bahasa Indonesia - SMP Kelas VIIuntuk mengalahkan raksasa itu.\" 2. Raksasa berteriak, \"Kemarilah, aku tak sabar untuk memakanmu!\" 3.

Emas menjawab, \"Coba saja, aku tidak takut!\" 4. Teman Emas bertanya, \"Emas, kau mau ikut memetik bunga di ladang nanti?\" 5. Pertapa berpesan, \"Gunakanlah keempat benda ini untuk mengalahkan raksasa. Tapi ingat, Emas harus percaya dan memiliki keberanian.\" C. Berkreasi dengan Teks Naratif Kegiatan 12: Menulis Cerita Fantasi Sederhana Menulis Sampai saat ini cerita fantasi masih digemari oleh berbagai kalangan usia.

Cobalah menuliskan cerita fantasi kalian sendiri. Upayakan untuk menciptakan tokoh yang memikat dengan cara mengatasi permasalahan yang menarik. Kalian dapat membuatnya dalam format cerita mini seperti \"Bola-Bola Waktu\" atau format komik seperti \"Kue-Kue Mao\" dan \"Keberanian Emas\". Ikuti langkah-langkah menyusun cerita fantasi berikut.

(1) Apa tema yang akan diangkat dalam cerita fantasi kalian? (2) Siapa tokoh dalam cerita kalian? (3) Di mana latar terjadinya cerita kalian? (4) Gambarlah kerangka alur cerita kalian dalam diagram alur. Gunakan diagram alur teks naratif di atas untuk membantu kalian! (5) Kembangkan cerita fantasi kalian!

(6) Terakhir, berilah judul yang menarik untuk hasil karya kalian! Dengan mengembangkan kerangka di atas menjadi teks naratif, kalian berlatih untuk menulis cerita fantasi sederhana untuk menyampaikan amanat tertentu. Bab II - Berkelana di Dunia Imajinasi - 65Jurnal Membaca Ayo luangkan waktu untuk membaca setidaknya 15 hingga 30 menit sehari.

Bacalah buku-buku bertema fantasi. Temukan tokoh favorit dari buku-buku yang telah kalian baca, lalu tuliskan alasan mengapa kalian menyukainya.

Judul Buku Pengarang Buku ini : Rekomendasi Buku Kalian dapat melihat judul lain pada lampiran Buku Siswa ini. Kalian juga dapat mengetahui lebih dalam tentang puisi rakyat dengan mengunjungi buku Yatim Nestapa karya Putri Minerva Mutiara dan diterbitkan oleh Kemendikbud pada laman http://repositori.kemdikbud. go.id/3688/1/Syair%20Yatim%20 Nestapa.pdf. 6 6 - Bahasa Indonesia - SMP Kelas VIICatatan Kata Selain Jurnal Membaca, kalian juga mengisi Catatan Kata.

Perhatikan cara mengisinya. Carilah kata-kata yang jarang muncul atau kata baru dari cerita fantasi yang kalian baca. Setelah itu, carilah arti kata-kata tersebut pada kamus. Kata Baru: Arti dalam Kamus: Kata Baru: Arti dalam Kamus: Contoh dalam Kalimat: Contoh dalam Kalimat: Kata Baru: Arti dalam Kamus: Kata Baru: Arti dalam Kamus: Contoh dalam Kalimat: Contoh dalam Kalimat: Kata Baru: Arti dalam Kamus: Kata Baru: Arti dalam Kamus: Contoh dalam Kalimat: Contoh dalam Kalimat: Refleksi Selamat!

Kalian sudah mempelajari Bab II. Tentu banyak hal sudah kalian pelajari. Tandai kegiatan yang sudah kalian lakukan atau pengetahuan yang kalian pahami dengan tanda centang, ya. Bab II - Berkelana di Dunia Imajinasi - 67Tabel 2.5 Releksi No Pada Bab II ini: Sudah Bisa Masih Perlu Belajar Lagi 1.

Saya dapat menyebutkan beberapa jenis puisi rakyat. 2. Saya dapat menjelaskan unsur puisi rakyat. 3. Saya dapat mengidentiikasi tujuan dan pesan dalam puisi rakyat. 4. Saya dapat membuat puisi rakyat sederhana. 5. Saya dapat menjelaskan alur sebuah cerita fantasi.

6. Saya dapat menganalisis penokohan dalam sebuah cerita fantasi. 7. Saya dapat mengidentiikasi majas sarkasme dalam cerita fantasi. 8. Saya dapat membandingkan penokohan dalam dua cerita fantasi yang berbeda.

9. Saya dapat menganalisis alur dalam cerita fantasi. 10. Saya dapat mengubah kalimat langsung menjadi kalimat tak langsung. 11. Saya dapat menulis cerita fantasi sederhana. Pengetahuan atau keterampilan yang sudah saya pelajari: 1. 2. Refleksi Proses Belajar 1.

Kegiatan yang paling sulit bagi saya pada bab ini: 2. Hal yang saya lakukan untuk memperbaiki hasil belajar saya: 3. Kepada siapa saya minta bantuan untuk memperbaiki hasil belajar saya: 4.

Pandangan saya terhadap usaha belajar yang telah saya lakukan: 12 3 4 5 Lingkari salah satu angka untuk menggambarkan: 1 = sangat tidak puas 4 = puas 2 = tidak puas 5 = sangat puas 3 = biasa saja 6 8 - Bahasa Indonesia - SMP Kelas VIIKEMENTERIAN PENDIDIKAN, KEBUDAYAAN, RISET, DAN TEKNOLOGI REPUBLIK INDONESIA, 2021 Bahasa Indonesia Buku Siswa SMP Kelas VII Penulis: Rakhma Subarna, Soie Dewayani, Cicilia Erni Setyowai Senja datang mentari pun redup semburat nya berwarna 978-602-244-299-8 BAB III Hal yang Baik bagi Tubuh Pertanyaan Pemantik: 1.

Apakah teks prosedur itu? Bagaimana contohnya dalam keseharian? 2. Apakah ciri-ciri teks prosedur? 3. Bagaimana membuat teks prosedur yang baik dan menarik? Pada bab ini kalian akan mempelajari anjuran, ajakan, dan imbauan untuk memperhatikan pola makan dan menata hidup kalian melalui teks prosedur.

Kalian diajak mengenali ciri kalimat serta unsur dalam teks prosedur, menyimak paparan prosedur lisan, serta berlatih menyajikan teks prosedur secara lisan dan tertulis dengan runtut dan menarik. Kata Kunci Teks prosedur, infografik, poster, kalimat ajakan, kalimat larangan, adverbia, dan inversi.

Bab III - Hal yang Baik bagi Tubuh - 69Siap-Siap Belajar Setelah mempelajari teks deskriptif dan teks naratif, senja datang mentari pun redup semburat nya berwarna bab ini kalian akan mengeksplorasi contoh teks lain yang sering kalian senja datang mentari pun redup semburat nya berwarna dalam kehidupan sehari-hari, yaitu teks prosedur. Kalian akan menelusuri beragam bacaan tentang cara hidup sehat dan seimbang.

Sebelum belajar, kalian akan mereleksi kegiatan yang telah kalian lakukan bagi tubuh dan makanan sehat yang telah kalian konsumsi. Dengan berpikir tentang topik pada bab ini, kalian dapat memahami bacaan dengan lebih baik. Tabel 3.1 Curah Gagasan Kegiatan baik bagi 1.

tubuh yang telah 2. 3. saya lakukan. 4. 5. 6 Makanan sehat 1. yang sering saya 2. 3. konsumsi. 4. 5. 6. Kalian telah menuliskan kebiasaan baik yang telah kalian lakukan. Selama membaca, kalian dapat menandai hal-hal yang telah kalian lakukan dan hal-hal yang baru kalian ketahui.

Tentu kalian juga dapat menggarisbawahi atau menandai kalimat, frasa, atau kata-kata yang belum kalian ketahui. Catatlah kalimat, frasa, atau kata sulit itu dalam buku tulis kalian. 7 0 - Bahasa Indonesia - SMP Kelas VIIA. Mengidentifikasi Karakteristik Teks Prosedur Kegiatan 1: Memahami Isi Teks Prosedur Membaca Makanan Buah- buahan Pokok Sayuran Lauk- pauk Gambar 3.1 Isi Piringku Sehat dan Bugar pada Masa Remaja Tahukah kalian bahwa total kebutuhan gizi pada masa remaja paling tinggi apabila dibandingkan dengan tahapan usia lainnya.

Banyak perubahan yang terjadi pada masa remaja. Tubuh kalian bertumbuh pesat dan kalian pun mengeksplorasi lingkaran pertemanan yang lebih luas. Perubahan isik, mental, dan meluasnya lingkungan sosial ini mendorong kalian untuk beraktivitas dengan lebih sering. Pada masa ini kalian mendapatkan tanggung jawab sebagaimana orang dewasa, misalnya mengatur jadwal kalian sendiri, belajar secara mandiri, maupun aktif dalam organisasi remaja. Karena itu, tak salah apabila orang mengatakan bahwa masa remaja merupakan masa transisi sebelum kalian menjadi dewasa seutuhnya.

Bab III - Hal yang Baik bagi Tubuh - 71Kebutuhan energi dan gizi yang cukup dan seimbang akan mendukung tumbuh kembang kalian pada masa ini. Kalori dari makanan dan minuman akan memberikan energi dan gizi yang kalian butuhkan untuk berpikir, beraktivitas, dan bertumbuh dengan baik. Sebaiknya kalian mulai memperhatikan susunan menu makan kalian. Makanan yang kalian makan sebaiknya tidak hanya mengenyangkan, senja datang mentari pun redup semburat nya berwarna juga memenuhi kebutuhan nutrisi dan menjaga kesehatan tubuh.

Perhatikan cara mengatur pola makan yang sehat bagi tubuh kalian berikut ini. (1) Makanlah makanan utama sebanyak tiga kali sehari pada pagi, siang, dan malam hari. Dalam makanan utama ini, sebaiknya selalu ada sayuran hijau daun, seperti bayam, kangkung, sawi, dan pokcoy.

(2)Selain sayur, pastikan makanan utamamu mengandung lauk-pauk sumber protein hewani dan nabati. Sumber protein hewani kalian dapatkan dari ayam, ikan, hati ayam, hati sapi, juga telur. Protein nabati kalian dapatkan dari tempe, tahu, dan kacang-kacangan. (3)Kalian juga harus mengonsumsi buah yang kaya akan vitamin, minimal sekali sehari. Pilihlah buah yang berwarna merah atau oranye, seperti pepaya, mangga, jeruk, apel, dan lain-lain.

(4)Terakhir, konsumsilah produk olahan susu yang mengandung vitamin dan mineral minimal tiga kali dalam seminggu. Kalian dapat minum susu di antara waktu makan sebagai kudapan. Apabila lambungmu terasa kurang nyaman, gantilah susu dengan susu fermentasi seperti yoghurt atau keju.

Untuk mendapat hasil yang maksimal, batasi konsumsi makanan cepat saji, jajanan, dan makanan yang terlalu manis, asin, atau berlemak. Selain itu, jangan malas minum air putih. Usahakan tubuh kalian tetap terhidrasi dengan minum cairan 8 gelas sehari dan rutin melakukan aktivitas isik setidaknya 30 menit sehari. Tidak sulit, bukan? Salam sehat! 7 2 - Bahasa Indonesia - SMP Kelas VIISetelah membaca bacaan ini, lihatlah kembali tabel curah gagasan kalian.

Adakah kegiatan yang belum kalian lakukan? Adakah makanan sehat yang sudah biasa kalian konsumsi? Kemudian, diskusikan pertanyaan ini dengan teman-teman dalam kelompok.

1. Siapa pembaca sasaran bacaan ini? 2. Apa pesan yang disampaikan dalam bacaan ini? 3. Mengapa kalian harus memperhatikan makanan yang kalian makan? 4. Bagaimana cara mengatur pola makan yang sehat bagi tubuh? 5. Kegiatan sehat apa saja yang masih sulit kalian lakukan? Mengapa? 6. Perhatikan gambar \"Isi Piringku\" pada bacaan di atas. Adakah informasi pada gambar yang belum dibahas pada bacaan? Informasi apakah itu? Dengan menjawab pertanyaan di atas, kalian berlatih mengakses informasi dan membuat simpulan terhadap tujuan penulisan sebuah teks informasi.

Kegiatan 2: Mengidentifikasi Teks Prosedur Grafis dan Menganalisis Kualitas Penyajian Informasi dalam Infografik Berdiskusi Teks prosedur adalah teks yang memberikan petunjuk, panduan, atau instruksi untuk melakukan sesuatu. Teks ini membantu kita untuk memahami dan mengerjakan sesuatu dengan tahapan-tahapan yang benar. Apa perbedaan antara teks prosedur dan tip? Tip merupakan saran-saran praktis tanpa urutan tertentu agar orang berhasil melakukan sesuatu.

Teks prosedur dapat disajikan dalam bentuk gambar atau grais. Informasi yang tersaji dalam bentuk gambar disebut dengan Infograik. Kalian akan mendiskusikan dua contoh Infograik tentang pola makan sehat. Namun, hanya satu Infograik yang menyajikan teks prosedur. Gunakan deinisi teks prosedur dan tip yang telah kalian pahami untuk menentukan mana infograik yang berisi teks prosedur?

Mana yang merupakan tip? Bab III - Hal yang Baik bagi Tubuh - 73WMaakkatun Ideal Makan Pagi Makan Siang Makan Malam 7.00 -- 8.00 Pagi 12.30 -- 14.00 Siang 18.00 -- 21.00 Malam waktu ideal untuk makan pagi waktu ideal untuk makan siang waktu ideal untuk makan malam Makan 30 MENIT setelah Jarak ideal makan pagi Jarak ideal makan malam bangun tidur hal ini akan dan makan siang adalah hingga waktu tidur adalah membantu kerja pencernaan 4 JAM 3 JAM Jangan lebih dari jam Jangan lebih dari jam Jangan lebih dari jam 10.00 Pagi 16.00 Sore 22.00 Malam Gambar 3.2 Tip Waktu Makan Ideal Hemat pangkal gaya.

Uang Sehat jajan bisa ditabung untuk membeli barang-barang Membawa bekal yang kalian butuhkan. menjauhkan kalian dari ancaman boraks, formalin, Lebih dan zat berbahaya lainnya.

Baik Kalian mengurangi Bawa peluang masuk berita Bekal sebagai korban keracunan makanan. Keren Berbagi Bawalah bekal makanan Kalian bisa bercerita ke berlebih untuk dibagi kepada teman kalian bahwa kalian teman-teman kalian. Dengan menyiapkan bekal makan begitu, kalian akan mendapatkan siang kalian sendiri. banyak teman.

Gambar 3.3 Lebih Baik Bawa Bekal 7 4 - Bahasa Indonesia - SMP Kelas VIIKalian telah mengamati dua contoh Infograik \"Tip Waktu Makan Ideal\" dan \"Lebih Baik Bawa Bekal\" tersebut. Sekarang diskusikan dengan teman kalian dengan panduan pertanyaan berikut! 1. Mana Infograik yang berisi perintah dan ajakan? 2. Tuliskan kalimat yang menguatkan alasan pemilihanmu tersebut!

3. Jelaskan mengapa kalimat tersebut merupakan ciri teks prosedur! Kedua Infograik tersebut memiliki sajian visual yang berbeda. Kalian dapat mengamati warna, gambar, dan peletakan gambar-gambar tersebut. Tuliskan pengamatan kalian pada tabel di bawah ini.

Tabel 3.2 Perbandingan Infograik Nama:___________________________ Kelas :___________________________ No Judul Infografik: Infografik Infografik “Tip Waktu Makan “Lebih Baik Bawa Ideal” Bekal” 1. Pesan apakah yang ingin diberikan oleh pembuat Infograik ini? 2. Jenis informasi apakah yang digunakan pembuat Infograik untuk mencapai pesan tersebut? 3. Apakah gambar pada Infograik mendukung informasi tersebut?

4. Apakah pemilihan bentuk dan ukuran huruf telah mendukung kejelasan informasi pada Infograik? 5. Apakah informasi telah disampaikan dengan kalimat yang jelas dan dapat menyampaikan pesan pembuat Infograik? 6. Menurut saya, Infograik yang menyampaikan pesan melalui gambar dan teks dengan lebih jelas adalah . Dengan menyampaikan pendapat terhadap Infografik, kalian berlatih memaparkan analisis senja datang mentari pun redup semburat nya berwarna kejelasan isi teks yang tersaji dalam bentuk tulis dan visual.

Bab III - Hal yang Baik bagi Tubuh - 75Kegiatan 3: Mengidentifikasi Kata-Kata Fokus Jelajah Kata Pada teks dan Infograik di atas kalian menemukan kata transisi, produk pengolahan susu, kudapan, boraks, serta formalin. Mungkin kalian mengenal kata-kata tersebut dalam bahasa daerah kalian atau istilah lain. Berikut adalah makna kelima kata tersebut menurut Kamus Besar Bahasa Indonesia.

Transisi: Peralihan dari keadaan (tempat, tindakan, dan sebagainya) pada yang lain. Misalnya: Masa remaja adalah transisi dari masa kanak-kanak ke masa dewasa. Produk olahan susu adalah makanan atau minuman yang diolah dari susu sapi. Contoh produk olahan susu adalah keju, es krim, dan yoghurt. Yoghurt dihasilkan dari fermentasi susu sapi. Pada proses fermentasi ini, bakteri baik, yaitu bakteri asam laktat, ditambahkan ke dalam susu dan dibiarkan selama beberapa hari hingga menjadi yoghurt.

Kudapan adalah makanan yang dimakan di luar waktu makan. Boraks adalah bahan pembersih (antiseptik; zat pembantu melelehkan zat padat) yang berupa hablur kristal berwarna kuning atau serbuk berwarna cokelat. 7 6 - Bahasa Indonesia - SMP Kelas VIIFormalin adalah larutan bening berbau menyengat, mengandung sedikit metanol untuk bahan pengawet dan pembunuh kuman.

Sekarang latihlah pengetahuan kalian tentang kata tersebut dengan memilih jawaban yang tepat untuk pertanyaan berikut ini. 1. Tandai kalimat yang tidak menggunakan kata 'transisi' dengan tepat.

a. Transisi musim kemarau ke musim penghujan diperkirakan akan terjadi pada bulan Oktober. b. Ketika mengirim pesan, seseorang sebaiknya mengemasnya dengan baik agar tidak terjadi gangguan dalam proses transisi pesan tersebut.

c. Masa prasekolah adalah sebutan untuk masa yang dialami oleh anak berusia 3-5 tahun untuk menandai transisinya dari bayi ke masa kanak-kanak. 2. Tandai kalimat yang tidak menggunakan kata 'kudapan' dengan tepat. a. Kudapan tradisional Indonesia dapat terbuat dari makanan pokok seperti beras atau beras ketan yang dikemas dalam porsi kecil dan memiliki rasa manis atau gurih. b. Bahan-bahan dan cara pengolahan kudapan tradisional dapat mencerminkan budaya dan kebiasaan suatu daerah. c. Kudapan biasanya memberikan gizi dasar, karena itu perlu dimakan dengan lauk-pauk untuk mencapai gizi seimbang.

3. Tandai kalimat yang tidak menggunakan kata 'boraks' dengan tepat. a. Pemerintah Indonesia melarang penggunaan boraks sebagai pengawet makanan karena dapat merusak organ-organ tubuh. b. Banyak pedagang yang menambahkan boraks secara sembunyi- sembunyi agar makanan yang dijualnya bertekstur kenyal dan renyah. c. Pemanggul barang itu mendorong koper yang dibawanya hingga mencapai boraks kereta.

4. Tandai kalimat yang menggunakan kata 'formalin' dengan tepat. a. Suasana menjelang pidato kenegaraan itu sangat formalin. b. Menjelang Hari Raya Idulitri, pemerintah aktif memeriksa kemungkinan makanan yang mengandung formalin dan zat berbahaya lainnya.

c. Penentuan identitas seorang mayat hanya bisa ditentukan oleh tim formalin. Dengan memahami kosakata baru di atas, kalian memahami kata fokus dan penggunaannya dalam konteks kalimat yang berbeda. Bab III - Hal yang Baik bagi Tubuh - 77B. Mengidentifikasi Tujuan Ragam Teks Prosedur Kegiatan 4: Menyimpulkan Isi Teks Prosedur Membaca Kalian telah membaca informasi tentang makanan yang baik senja datang mentari pun redup semburat nya berwarna menjaga kesehatan dan kebugaran tubuh kalian.

Selain makanan, kegiatan isik juga baik untuk melatih kelenturan dan stamina tubuh. Bacalah dan amati gambar di bawah ini, ya. Tetap Rileks Saat di Kelas Materi pelajaran baru, tumpukan tugas, dan ulangan kini mengisi hari- hari kalian.

Jam demi jam pelajaran kalian habiskan dengan duduk memperhatikan, mencatat, bahkan mengerjakan soal ulangan. Mungkin kalian merasa jenuh dan lelah hanya dengan duduk di kelas. Tenang, jangan menyerah dulu. Ingatlah untuk selalu melakukan peregangan agar tubuh kalian tidak kaku, kembali ringan, dan lentur. Melakukan peregangan itu mudah. Perhatikan caranya berikut ini.

Duduklah dengan posisi tegak di kursi. Pegang pinggiran kursi, kemudian angkatlah bahu. Tahan bahu selama 5--8 detik, lalu turunkan. Lakukan gerakan ini berulang- ulang. 7 8 - Bahasa Indonesia - SMP Kelas VIIMasih dalam posisi duduk, ambillah dua buah buku pelajaran atau buku tulis milik kalian.

Angkatlah buku dengan kedua tangan menyatu di atas kepala, lalu rentangkan ke belakang. Gerakan ini sangat baik untuk menghilangkan lelah. Berikutnya, berdirilah di samping bangku kalian.

Rentangkan kedua tangan ke atas kepala, lalu miringkan tubuh ke kanan dan ke kiri selama 5--10 detik. Terakhir, ambil kembali kedua buku kalian, pegang dengan masing- masing tangan. Kemudian, bungkukkan badan ke depan hingga tubuh kalian membentuk huruf L. Lemparkan kedua tangan jauh ke belakang selama 5--8 detik, lalu turunkan lagi. Gambar 3.4 Tetap Rileks Saat di Kelas Bagaimana? Sekarang tubuh kalian terasa lebih ringan dan segar, kan?

Selamat beraktivitas kembali! (Diadaptasi dari dari Chwe Dong In, 2012: 95) Bab III - Hal yang Baik bagi Tubuh - 79Setelah membaca bacaan \"Tetap Rileks di Kelas\" di atas, diskusikan pertanyaan-pertanyaan ini dengan teman kalian. Sebelum berdiskusi, catat dahulu jawaban kalian pada buku tulis, ya. Catat pula jawaban teman pada tabel yang kalian buat mengikuti format di bawah ini.

1. Mengapa penulis menganjurkan pembaca untuk melakukan peregangan? 2. Ada berapa gerakan peregangan yang dianjurkan penulis? Tuliskan kembali dengan bahasa kalian sendiri. 3. Lakukan gerakan-gerakan peregangan itu dengan teman.

Dapatkah kalian melakukan semua gerakan yang dianjurkan oleh penulis? Gerakan mana yang paling mudah dan paling sulit dilakukan? 4. Menurut kalian, apakah penulis telah menuliskan langkah-langkah peregangan dengan baik dan jelas? Penjelasan gerakan mana yang paling sulit dipahami? 5. Apakah kalian telah sepakat dengan bacaan tersebut bahwa peregangan dapat membuat tubuh terasa ringan? Tabel 3.3 Lembar Membaca Berpasangan Nama: Nama Teman: No Jawaban Saya Jawaban Teman Saya 1.

2. 3. 4. 5. Dengan menjawab pertanyaan-pertanyaan di atas, kalian berlatih untuk mengakses informasi dan mengembangkan koneksi antara pengalaman kalian dengan bacaan. 8 0 - Bahasa Indonesia - SMP Kelas VIIKegiatan 5: Mengenali Tujuan Teks Prosedur Mengamati Teks prosedur adalah teks yang memberikan petunjuk, panduan, atau instruksi agar seseorang dapat melakukan suatu pekerjaan secara tepat.

Teks prosedur dapat berisi ajakan, perintah, atau larangan. Bacalah kembali teks \"Tip Sehat dan Bugar pada Masa Remaja\" dan \"Tetap Rileks Saat di Kelas\" di atas. Setelah itu, jawablah pertanyaan berikut ini!

1. Menurut kalian, mengapa setiap penulis membuat senja datang mentari pun redup semburat nya berwarna teks tersebut? 2. Apakah tujuan penulisan kedua teks tersebut sama? 3. Tuliskan tujuan penulisan setiap teks dalam tabel di bawah ini!

Tabel 3.4 Mengenali Tujuan Senja datang mentari pun redup semburat nya berwarna Prosedur Tujuan Wacana “Tip Sehat dan Tujuan Wacana “Tetap Rileks Bugar pada Masa Remaja” Saat di Kelas” Bab III - Hal yang Baik bagi Tubuh - 81C. Mengenali Unsur Kebahasaan dalam Teks Prosedur Kegiatan 6: Menelaah Kalimat Pelesapan pada Teks Prosedur Kupas Teori Pada teks prosedur, langkah-langkah panduan dapat dihubungkan dengan kata penghubung seperti kemudian, berikutnya, dan setelah ini.

Terkadang penulis menggunakan kata-kata tersebut terlalu sering sehingga diperlukan pelesapan. Pelesapan adalah penghilangan bagian tertentu yang sama dan sudah disebutkan pada kalimat sebelumnya.

Umumnya, pelesapan ini terjadi pada kalimat majemuk rapatan, yaitu gabungan beberapa kalimat tunggal yang memiliki subjek atau predikat atau objek yang sama. Perhatikan beberapa contoh pelesapan dalam prosedur memb uat puding di bawah ini. (1) Masukkan sebungkus agar-agar, jeli, dan susu cair sebanyak 500 ml, kemudian aduk (agar-agar, jeli, dan susu) sampai larut dalam air. (2) Masak (campuran agar-agar, jeli, dan susu) di atas api.

(3) Tambahkan gula, kemudian aduk terus (campuran yang sedang dimasak ini) selama 30 menit. (4) Setelah mendidih, matikan api, kemudian aduk lagi selama 1 menit. Pudingmu sudah jadi! (5) Tuang puding dalam cetakan. Berikutnya, setelah (puding) agak dingin, simpan dalam lemari es. Perhatikan bagian bercetak tebal yang tidak disebutkan atau dilesapkan dalam teks prosedur di atas. Senja datang mentari pun redup semburat nya berwarna lebih memahami tentang pelesapan, mari kita berlatih melalui Tabel Pelesapan.

Perbaikilah kalimat yang belum dilesapkan dari kolom kiri ke kolom kanan! 8 2 - Bahasa Indonesia - SMP Kelas VIITabel 3.5 Pelesapan Kurang Tepat Perbaikan dengan Pelesapan 1. Setelah dicuci bersih, olesi jagung dengan mentega dan kecap manis pedas. Setelah jagung dibumbui, bakar jagung di atas api. 2. Campurkan lem cair dengan pewarna makanan dalam piring sampai merata. Setelah campuran merata, tambahkan sedikit demi sedikit sabun cuci piring sehingga campuran membentuk gel dan tidak lengket di piring.

3. Pilih menu “shut down”, lalu pilih “OK”. Tunggu sampai komputer mati. Berikutnya, setelah komputer mati, matikan stabilizer dengan cara menekan tombol power sesaat setelah komputer mati. Kemudian, kalian harus mencabut kabel listrik agar arus terputus. 4. Potong botol bekas menjadi dua bagian menggunakan pisau, ambil potongan botol bekas bagian bawah. Kemudian, lubangi bagian bawah botol tersebut. Setelah itu, hias botol bekas sesuai selera menggunakan manik-manik dan lem.

Pot bunga dari botol bekas siap digunakan! 5. Ambil nomor antrean di loket. Setelah mendapat nomor antrean, duduk di area ruang tunggu dokter yang ingin ditemui. Bab III - Hal yang Baik bagi Tubuh - 83Kegiatan 7: Mengenali Kalimat Ajakan dan Larangan dalam Teks Prosedur Berdiskusi Kalimat-kalimat di bawah ini lazim terdapat pada teks prosedur. 1. Makanlah makanan utama 1. Hindari makanan cepat saji! sebanyak tiga kali sehari! 2. Tenang, jangan menyerah 2.

Duduklah dengan tegak di kursi! dahulu! Diskusikan pertanyaan ini dengan teman. Apakah perbedaan kalimat pada kolom kiri dan kolom kanan? Dapatkah kalian menemukan kalimat-kalimat ajakan, perintah, juga larangan pada kedua wacana di atas? Tuliskan kalimat-kalimat tersebut pada tabel di bawah ini.

Tabel 3.6 Mengenali Ragam Kalimat dalam Teks Prosedur Kalimat Ajakan atau Perintah Kalimat Larangan 8 4 - Bahasa Indonesia - SMP Kelas VIIKegiatan 8: Mengenali Kalimat Inversi dalam Teks Prosedur Menyimak Kalimat ajakan atau perintah ditandai dengan: 1.

akhir kalimat dapat diakhiri dengan partikel lah atau kan; 2. kalimat perintah dapat berpola inversi yaitu kalimat diawali dengan predikat (P), lalu subjek (S), seperti: a. Peganglah (P) + pinggiran kursi (S)! b. Ambillah (P) + dua buku pelajaran (S)! c. Perhatikan (P) + makanan kalian (S)! Sekarang coba kalian temukan dan tuliskan ulang kalimat dengan pola inversi pada kedua wacana di atas. 1. 2. 3. 4. Kegiatan 9a: Mengenali Ragam Kalimat dalam Teks Prosedur Menyimak Pernahkah kalian mendengar atau menyaksikan video tutorial?

Video tutorial adalah tayangan video yang menunjukkan cara melakukan sesuatu. Kalian dapat menyaksikan banyak sekali tayangan video tutorial di laman rumahbelajar kemendikbud atau laman YouTube. Bab III - Hal yang Baik bagi Tubuh - 85Salah seorang teman kalian sedang menyiapkan membuat video tutorial. Ia menyiapkan sebuah skrip atau naskah untuk video itu.

Dengarlah teman kalian membacakan skrip atau naskah ini. Catatlah informasi menarik selama menyimak paparan teman itu dalam buku catatan kalian. Setelah itu, kalian dapat menyampaikan pendapat kalian tentang naskah ini. Membuat Sorbet Buah Gampang dan Enak Hai, teman-teman, apa kabar? Kuharap kalian sehat-sehat waktu nonton video ini, meski akhir-akhir senja datang mentari pun redup semburat nya berwarna hujan jarang turun. Hmm . di cuaca panas begini, kalian jadi ingin makan yang seger- seger, kan?

Nah, hari ini aku mau mengajak kalian membuat kudapan manis segar yang namanya sorbet buah. Sorbet buah ini sekilas mirip dengan es krim. Namun, pastinya makanan yang satu ini lebih segar dan menyehatkan karena dibuat dari buah asli. Ingin tahu cara membuatnya? Kita lihat dahulu bahan-bahannya, ya?

Di sini aku sudah menyiapkan 2 pak stroberi, 2 bungkus susu kental manis, 3 sendok makan susu bubuk, dan 100 ml air. Buah stroberi bisa kalian ganti dengan 2 mangkuk mangga, pisang, melon, atau buah lain yang ada di rumah kalian. Kalau kalian suka 8 6 - Bahasa Indonesia - SMP Kelas VIImanis, kalian dapat menambahkan 1--3 sendok teh gula putih.

Namun, karena kita menggunakan buah asli, kita sudah mendapatkan rasa manis yang alami. Cara membuatnya mudah sekali!

Kita mulai sekarang saja, ya? Pertama-tama, cuci stroberi atau buah- buahan lain yang kalian punya sampai bersih, lalu buang daun dan tangkainya. Kalau kalian menggunakan mangga atau senja datang mentari pun redup semburat nya berwarna, tentu kalian harus mengupasnya dahulu. Setelah itu, potong- potong buah bentuk dadu, kira-kira sebesar ujung kelingking kalian. Sisakan sedikit buah potong ini ke dalam satu mangkuk kecil, lalu sisihkan.

Nanti, buah di mangkuk ini akan digunakan sebagai campuran. Berikutnya, kita campur dan hancurkan semua bahan, mulai dari buah potong, susu kental manis, susu bubuk, gula putih, dan air sampai halus dengan blender atau mesin penghancur. Kalau tidak ada blender atau mesin penghancur di rumah, kalian bisa menumbuk semua bahan itu dengan sendok atau garpu hingga hancur dan tercampur rata. Selanjutnya, masukkan adonan sorbet ke dalam wadah tertutup.

Kalian bisa menggunakan gelas atau kotak makanan. Terakhir, simpanlah dalam freezer atau lemari pembeku minimal selama satu jam. Seandainya kalian tidak punya lemari pembeku, kalian bisa meletakkan mangkok sorbet di atas es batu yang ditaburi garam. Setelah dingin dan beku, sajikan dengan taburan buah cincang yang sudah disisihkan tadi, kismis, atau taburan lain sesuai selera kalian.

Nah, bagaimana? Mudah sekali, kan? Rasanya? Hmm … jangan ditanya, manis dan segar! Tentunya sorbet buah ini sangat pas dinikmati pada siang hari saat cuaca terik seperti sekarang. Ayo kalian coba di rumah, ya! Sekian resep praktisku untuk episode kali ini. Semoga kalian suka. Kalau kalian suka, klik like-nya, ya. Kalian juga boleh tinggalkan komentar di bawah ini. Tuliskan kesan kalian untuk resep yang satu ini. Kalian juga boleh beri tahu aku setelah kalian mencoba membuatnya.

Oh ya, tuliskan juga apabila kalian punya usulan resep mudah praktis enak yang sebaiknya kita coba di episode berikutnya. Aku tunggu, ya! Ikuti terus saluran videoku untuk resep-resep lainnya. Sampai jumpa lagi, daah! Bab III - Hal yang Baik bagi Tubuh - 87 Periksa catatan yang kalian buat selama menyimak, lalu diskusikan jawaban pertanyaan berikut ini! 1. Apa judul teks yang sudah kalian simak?

2. Menurut kalian, apakah tujuan penutur teks tersebut? 3. Apakah teks tersebut mengajak kalian melakukan sesuatu, memberikan perintah, atau melarang kalian untuk melakukan sesuatu? 4. Dapatkah kalian mengingat dan menyebutkan kembali informasi yang kalian simak dalam bahasa kalian sendiri? 5. Bagian mana yang mudah kalian ingat dalam wacana yang kalian simak? Bagian mana yang sulit kalian ingat?

Dengan menjawab pertanyaan-pertanyaan di atas, kalian berlatih untuk menyimak dan memahami ide sebuah paparan dan instruksi yang lebih kompleks. Kegiatan 9b: Berkreasi dengan Paparan Prosedur Lisan Kreativitas Mencoba Tantangan: Menjadi Youtubers Kalian telah menyimak salah satu paparan prosedur lisan, sekarang giliran kalian membuatnya sendiri!

1. Pilih satu paparan prosedur yang paling kalian sukai dan kuasai. Misalnya, cara membuat makanan, minuman, kerajinan tangan, atau prosedur lainnya. 2. Pilih tujuan senja datang mentari pun redup semburat nya berwarna kalian, apakah mengajak melakukan sesuatu, melarang, atau memberi perintah. 3. Tuliskan transkrip prosedur kalian. Gunakan kalimat ajakan, perintah, atau larangan. Kalian juga dapat menggunakan kalimat inversi dan pelesapan. 4. Baca dan rekamlah transkrip tersebut dengan durasi 3--5 menit.

5. Unggah video kalian di media sosial (YouTube atau IGTV). Selamat berkarya! 8 8 - Bahasa Indonesia - SMP Kelas VII
• Tebar Hikmah Ramadan • Life Hack • Ekonomi • Ekonomi • Bisnis • Finansial • Fiksiana • Fiksiana • Cerpen • Novel • Puisi • Gaya Hidup • Gaya Hidup • Fesyen • Hobi • Karir • Kesehatan • Hiburan • Hiburan • Film • Humor • Media • Musik • Humaniora • Humaniora • Bahasa • Edukasi • Filsafat • Sosbud • Kotak Suara • Analisis • Kandidat • Lyfe • Lyfe • Diary • Entrepreneur • Foodie • Love • Viral • Worklife • Olahraga • Olahraga • Atletik • Balap • Bola • Bulutangkis • E-Sport • Politik • Politik • Birokrasi • Hukum • Keamanan • Pemerintahan • Ruang Kelas • Ruang Kelas • Ilmu Alam & Teknologi • Ilmu Sosbud & Agama • Teknologi • Teknologi • Digital • Lingkungan • Otomotif • Transportasi • Video • Wisata • Wisata • Kuliner • Travel • Pulih Bersama • Pulih Bersama • Indonesia Hi-Tech • Indonesia Lestari • Indonesia Sehat • New World • New World • Cryptocurrency • Metaverse • NFT • Halo Lokal • Halo Lokal • Bandung • Joglosemar • Makassar • Medan • Palembang • Surabaya • SEMUA RUBRIK • TERPOPULER • TERBARU • PILIHAN EDITOR • TOPIK PILIHAN • K-REWARDS • KLASMITING NEW • EVENT Disini … Di Baitullah Oleh Wildan Bercermin Diri Semburat senja masih berwarna jingga.

Cahayanya seakan-akan perlahan redup. Bola mentari segera ingin mematuhi titah Tuhan untuk kembali mencium bumi dan segera memberikan kesempatan untuk malam dan bulan tampil seketika. Anak-anak pengajian sore masih bercanda-canda penuh tawa. Ibu-ibu pengajian juga mulai ramai memasuki Mushala. Mereka sibuk menunggu pengajian dimulai.

“Stttt, lihat tuh ! si Indah ikut pengajian juga … jujur kalau bukan karena Ustadzah Sasa yang ngisi pengajian saya sudah ingin pergi dari pengajian ini.” Kata seorang Ibu-Ibu bermukena hijau. “Ihhh … iya ya Bu, tumben si Indah mau pergi ke Masjid. Ke samber petir kali ya?” sahut Ibu-ibu yang lain. Indah, wanita yang terlihat masih muda dan cantik itu melempar senyum ketika mendengar dirinya dibicarakan.

Ia lalu diam. Dengan diam tidak meladeni kata-kata jama’ah ia rasa ia sudah melakukan satu hal awal untuk berubah. Untuk bertaubat dan menyerahkan seluruh hidup ini untuk Allah. Untuk apa menggosip? Setidaknya ia berharap mampu sedikit menjaga lisannya. Sudah lama ia sesak dengan limpangan dosa.

senja datang mentari pun redup semburat nya berwarna

Walaupun uang mengalir bagai air. Tetap hatinya tidak nyaman. Tidak menemukan ketenangan. Pengajian dimulai. Ustadzah Sasa menyampaikan materi yang kali ini menggugah jiwa. Materi yang membuat Indah menangis. Tentang … dosa. Benar, ia memang sangat banyak dosa. Ya Allah, bantu hamba-Mu ini untuk bertaubat. Selepas pengajian Indah menghampiri Ustadzah Sasa yang terkenal di Kampung. Bu Ustadzah melempar senyum dan sekaligus kaget. Seperti jarum di tumpukan jerami.

Sangat aneh. “MasyaAllah Indah, ada apa Nak?” Tanya Ustadzah Indah yang merasakan bahagia. Setidaknya sekarang Indah sudah mau ke Masjid dan memakai Mukena. “Ustadzah, maksud saya ingin menyampaikan maksud dan tujuan saya. Saya ingin berhaji.

Saya ingin bertaubat. Saya ingin berdo’a sepuas-puasnya disana. Agar lebih dekat dengan Allah. Sudah lama hati ini tidak tenang dan selalu terancam. Kemegahan tidak menjadikan hidup saya bahagia. Lumuran dosa malah menjadikan saya terhina.” “Subhanallah, itu awal yang bagus, Indah.” “Apakah saya akan diampuni Ustadzah, sedangkan dosa saya sudah sangat banyak.” “Jangan bersedih Nak Indah. Allah selalu membuka pintu taubat kapan saja dan dimana saja.

Sungguh Allah Maha Pengampun lagi Maha Penyayang.” “Sungguh Ustadzah?” “Iya Indah,” ketika itu peluk hangat nan lembut Indah rasakan. Pelukan Ustadzah Sasa membawanya ke alam kelembutan dan kasih sayang. Ini pertama kalinya hatinya begitu … tentram. “Kapan kamu berhaji?” Tanya ustadzah Sasa. “InsyaAllah tahun ini Ustadzah.” Diujung sana … “Ngapain si Indah itu senja datang mentari pun redup semburat nya berwarna perhatian sama Ustadzah?” Semburat cahaya matahari kini menaiki langit.

Bumi cerah nan indah. Burung-burung kini berterbangan melingkar diangkasa. Menari-nari. Hari yang membuatnya selalu menangis semalaman.

Seharian. Berbulan-bulan setiap malam ia menangis. Akhirnya saat ini juga impiannya tercapai. Pergi haji pertamanya. Dan kisah hidup pertamanya dalam lembar kertas putih baru.

Kertas itu ia harap dapat dituliskan kebaikan-kebaikan yang indah. Seperti namanya, Indah. Ia terbang dengan perasaan yang masih bercokol dalam dirinya. Ya Allah, sejenak hamba penuh dosa ini sangat berharap ampunan-Mu di tahan suci nanti … akankah engkau membuka jalan jannah-Mu untukku?

Coklat, butiran pasir Tanah Suci nan Indah terbentang. Pertama kalinya ia menapakkan kaki ditanah suci ia pingsan. Seakan-akan tanah yang coklat nan gersang terbentang luas itu adalah dosa-dosanya kepada orang-orang dan terutama kepada … Allah. Ditanah Suci itu harapannya ia bisa berdo’a dan sedekat-dekatnya dengan Allah. Bisa mencurahkan segala kejahatan dan dosanya selama ini di Tanah Suci ini. Tentu juga ia ditemani suaminya. Suaminya tersenyum berbinar. Di sampingnya kini Indah sudah berubah.

Jujur menurut suaminya … indah sangat anggun senja datang mentari pun redup semburat nya berwarna jilbab yang panjang dan lebar. “Ayo Dik, kita shalat dahulu,” suara yang sangat lembut. Kamu memang selalu membuat hati ini melunak. Ya Allah mengapa dari dulu ia belum menyadarinya? Apakah hati ini telah buta. “Iya Mas.” Kali ini dua insan yang saling mencintai itu shalat berdua di sebuah hotel tempat mereka menyewa untuk pelaksanaan hajinya.

Langit kemerahan menghiasi angkasa. Mereka larut dalam keindahan ciptaan Tuhan. Dua hari lagi pelaksaan haji akan dimulai. Dua insan itu mempersiapkan semuanya. Tidak ada yang lebih indah daripada mendekat kepada Allah … itu saja. Hari pertama… Allah memperlihatkan kekuasaan-Nya. Indah terus menangis. “Ya Rabb apakah egkau tidak sudi dengan diri ini mengkotori Tanah Suci-Mu ini? Ya rabb, izinkan aku untuk berubah menjdi lebih baik. Menjadi lebih cinta kepada-Mu.

Lebih mendekat kepada-Mu.” Air keran untuk berwudhu yang ia ingin gunakan tidak keluar airnya. Suaminya mencoba membantunya. Suaminya bisa. Air keluar dari keran yang dibuka oleh suaminya. Namun ketika Indah membuka kerannya … air tidak keluar. Ya Allah … apa salahku? Saat itu Indah bertayamum. Suaminya mengajarkannya. “Terimasih Mas, aku belum tahu kalau boleh mengganti air dengan menggunakan debu.” “Sama-sama Dik.” Suaminya hanya tersenyum ia melihat wahjah istrinya bercahaya.

Inilah yang ia rindukan sejak dulu. Ya Allah … terimaksih telah membawa cahaya di kehidupanku. Hari kedua… Berjuta-juta manusia bersatu padu mengelilingi ka’bah. Berduyun-duyun mengucapkan kalimat talbiah.

Terik matahari menerangi membawa cahaya. Siapa yang tahu bahwa diatasnya banyak berjuta-juta malaikat yang sedang memperhatikan. Allah kembali memperlihatkan kekuasaan-Nya.

Indah terpisah dengan suaminya. Sesak. Jutaan manusia berduyun-duyun mengelilingi ka’bah. Ia terhimpit dalam lautan manusia. “Ya Allah … aku bersimpuh dihadapan-Mu, dirumah-Mu.

Ya Allah izinkan aku menyentuh hajar aswad, izinkan aku dengan sepenuh cinta mendekat kepada-Mu.” Lirihnya. Namun Indah tidak mampu menjangkau dan menerobos kumpulan orang-orang.

Indah tersesak di tengah-tengah jutaan manusia. Nafasnya sesak. Tubuh kecilnya tak mampu menahan dorongan. Ia rasa nyawanya ingin terangkat. Ia tidak kuat lagi. “Ya … rabb, izinkan aku … izinkan aku.” Indah melirih.

Setelah tujuh kali ia mengelilingi ka’bah. Ia pingsan. Semuanya gelap. Sunyi. Tak ada nada. Hanya gelap. Langit senja berwarna jingga menghias angkasa raya. Angin lembut menyisir Tanah Suci. Indah masih pingsan. Indah tertersadar dari tidurnya. Tiba-tiba ia telah berada di hotel. Ia tertidur pulas selama tiga jam. Ia senja datang mentari pun redup semburat nya berwarna.

Ia memanggil-manggil suaminya. Namun tak kunjung datang. Kenapa disini sepi? Lirihnya. Bel pintu berbunyi. Mungkin itu suaminya. Pikirnya. Bukan … entah siapa orang yang berbaju putih yang datang. “Siapa kamu?” Tanya Indah penasaran. Ia berdiri kaku sambil bergetar seluruh tubuhnya. “Aku yang ingin selalu dekat denganmu?” apa? Tidak mungkin orang ini ingin dekat denganku?

Siapa dia? Siapa pun dia sungguh aku … tidak mengenalinya. “Maukah menemaniku?” Tanya orang itu. “Jalan-jalan disekitar ka’bah, bukankah kamu selalu rindu dengan ka’bah?” lanjut orang tidak dikenal itu. Sosok perempuan yang cantik jelita. Matanya Indah. Bibirnya menyunging senyum yang tulus. Indah menurut. Memang itu yang aku harapkan. Bosan jika terus di kamar. “Mari kita berwudhu dahulu sebelum ke ka’bah.

Katanya. Indah hanya menurut. “Bisa tolong saya?

senja datang mentari pun redup semburat nya berwarna

Airnya tidak keluar.” Pinta wanita berjubah putih itu. Indah mencoba membantunya. Ia sendiri takut kejadian kemarin menimpa dirinya. Bukankah kemarin aku tidak bisa membuat keran air mengalir? WUSHHH …. Air keluar sangat lancar. Indah tidak mengira ia bisa melakukannya. Mengapa aku bisa melakukannya sedangkan kemarin tidak? Wanita itu hanya tersenyum mengembang.

Indah menatap nanar kejadian itu. Aneh. Tapi ia senang telah berhasil. Ada kebahagiaan yang bersemayam dihatinya. “Kita kesana ya !” kata wanita itu lagi. “Kita ke ka’bah dan mendekatinya.” Lanjutnya. “Bukankah kamu sangat ingin menyentuh hajar aswad itu?” iya benar. Kamu benar. Tapi darimana kamu tahu? Siapa kamu sebenarnya? Lirihnya. Tiba-tiba orang-orang berdatangan.

Berduyun-duyun. “Ayo Indah cepat !” katanya. Dari mana kamu tahu namaku? Indah menurut. Orang-orang memberikan sebuah jalan kepadanya. Indah bebas melewati dan mendekat dengan hajar aswad. Lho ko mereka mempersilahkan aku berjalan dengan mudah?  Padahal kemarin saja tidak seperti ini suasananya. Padahal disini banyak orang? Ahh … tidak peduli. Yang penting aku bisa menangis dan bertaubat disini lebih dekat dengan Allah.

Pikir Indah. Indah berdo’a sepuas-puasnya. Mendekat lebih dekat lagi kepada Allah. Air matanya mengalir. Matanya sembab. Orang-orang memperhatikannya. Mereka tersenyum. Indah membalas dengan senyum juga. “Sudah sore, ayo kita pulang !” kata wanita itu lagi.

Indah sungguh bahagia bisa melakukan hal yang sebelumnya tidak bisa ia lakukan. Tidak terkira rasanya. “Oya … boleh aku bertanya kepadamu?” Tanya Indah. Wanita itu tersenyum. Iya. “Tadi pagi saya memutar keran, namun airnya tidak kunjung keluar.

Yang kedua, tadi pagi aku sulit sekali mendekat ke hajar aswad, tapi sekarang mudah, bahkan orang-orang mempersilahkan kita. Apa yang terjadi?” tanyanya lagi meneruskan. Wanita itu hanya tersenyum. “Berbahagialah Indah.” Tuh … Kan. Ko kamu tahu namaku? Siapa kamu sebenarnya? “Aku adalah dirimu.” Apa? Aku? “Sebelumnya kamu datang menghadap Allah dengan berlumuran dosa, itu sebabnya air tidak keluar dan engkau hampir mati ketika berkeliling ka’bah.” “Tetapi kerinduanmu terhadap tanah Baitullah ini.

Tekadmu yang untuk bertaubat telah mengetuk pintu langit dan membuka seluruh jalan agar do’amu tersampaikan.” “Berbahagialah Indah, kesungguhanmu untuk bertaubat telah meluluhkanku. Sungguh Allah menyayangimu. Allah menyukai orang-orang yang bertaubat apalagi …” “Apalagi kamu begitu merindukan Baitullah …” Semuanya senyap.

Indah kaku terdiam. Matanya berka c a-kaca. Langit seolah runtuh kepadanya. Ia telah diberi cahaya. Ia seperti merasakan devaju. Diri yang penuh dosa ini? “ALLAH … ALLAHHH … ALLAHHHHHHH.” “Ada apa Dik?” suaminya menyadarkanya. Matanya masih sembab. Suaminya bertanya-tanya. Indah jatuh dalam pelukan suaminya. Indah menangis sejadi-jadinya.

“Mas … maafkan Indah. Indah mencintai Mas. Mas …  ajarkan Indah Islam. Ajarkan Indah kebaikan. Ajarkan Indah berhaji yang benar. Ajarkan Indah … menggapai ridho Allah Mas, disini. Ditanah suci ini … di Baitullah.” Suaminya tersenyum mengiyakan. Langit senja mengucapkan salam kepada mereka. Seluruh makhluk di langit mengucapkan salam.

Salam penghormatan bagi mereka yang selalu rindu mendekat kepada Allah. Yang rindu kepada Baitullah. *** Bandung, 30 Agustus 2013 Kulihat banyak orang berlari dan bersembunyi Dibalik kegelapan mencari pembenaran atas diri Setiap langkah begitu nista tanpa nurani menyertai Terperosok diantara lumpur penuh noda melekat didiri Lalu apa sesungguhnya yg dicari Kala cinta tak lagi mampu memperlihatkan jati diri Segalanya seakan terlepas dari norma yg harus dipatuhi Dunia memang telah membusuk Aromanya kian menyengat membuatku mual Pembenaran yang selalu memihak pada ego Membuatku seperti orang bodoh Kekecewaan akhirnya hinggap dan lekat dihati Tanpa mampu ungkapkan yg sesungguhnya terjadi Terdesak hingga membuatku sesak Sudahlah,biarlah,abaikan saja Karena aku pun telah teramat lelah Aku hanya menengok rinduku kembali Menafaskanmu lagi senja datang mentari pun redup semburat nya berwarna desahanku Menuturkanmu menjadi wacana tak berbatas Lalu memahat senyummu di langit hatiku Agar tiap kutengadahkan rupaku ke atas Nampak senyummu menepis rinduku Namun, jika kelak kutak dapat menarasikanmu lagi Maka akan kuprasastikan saja dicadas rinduku Yang tak akan menepi dan mengikis Berlaksar waktu Aku di belantara duka Berteman rimbunan pepohon Yang menunduk sayu Simpati pada nasibku.

Mengapa Takdir harus kutempuh Dugaan apa yang melanda Jika setiap perjalananku Berteman genangan airmata. Aku sudah penat Senja datang mentari pun redup semburat nya berwarna di jejak-jejak luka Menahan pedih Diseksa sengsara Setiap langkah Berpijak serpihan kaca.

Oh! siang malamku meratap hiba Bila ada sebuah hati Yang berpelangi Itulah hatiku Yang telah diguyur gerimis Hingga bermekaran aneka bunga Lengkap dengan warna mejikuhibiniu Senja yang basah Terasa begitu indah Saat kau rebah Di bahu, pasrah Sayang, Aku tak menjanjika apapun pada mu Tetapi, aku akan tetap menjaga pelangi Hingga suatu saat nanti Seorang pangeran datang menjemputku Itulah dirimu Yang akan membawaku ke negeri di awan Lembayung bersenandung Aku menari di atas lembar awan Senja yang merindu ajari tentang sahabat Riak sungai mengajari tentang arti sahabat Dalam deru mendesu siang dan malam Terus mengembara di teras beranda Di setiap nikmatnya sisa sisa waktu Di helaan nafas-nafas tepian senja Mencium wajah senja biru samudra Mencium langit senja yang membiru Mencium sajjadah senja yang membumi Sahabat.

Terimalah untaian aksaraku tanpa prahara Dalam senyum sesimpul persahabatan Tudung senja merah saga Kalungkan bias jingga Dikanvas cakar langit maya pada Riuh pikuk camar menari Lantunkan ayat-ayat cinta laduniawi Lena netra Dibuai keindahan rona senja Merdu syahdu kicauan elang Digendang telinga Dari titik terang Kian meniti tamaram Posos dunia tetaplah membumi Bibir lirih bergumam Atas semua asmaMU Indah ciptaan dan karuniaMU Kupuji dan selalu ku syukuri penuh Hidup ini Adalah keindahan Dialah yang memberimu luka Dialah yang memberimu kemegahan Tersenyumlah sedikit untuk lukamu Karena disitulah keindahan Yang membuat kemegahan Dihati dan jiwa Senyumlah Teruslah tersenyum Sampai senyumanmu Akan menjadi air mata Mari Balut luka Dengan sedikit senyum kita Mari Tumpahkan air mata Diatas gelas yang tersedia Mari Bersulang kasih diatas meja Hidup ini, Penuh senja datang mentari pun redup semburat nya berwarna cinta Lihatlah Cinta telah tampak dikedai rasa Tuang dikit lagi Inilah keindahan kita Cakar aksara tunduk tertampar sabda ilalang sungguh sayang Kanda Kupuja patahan aksara Lentik jemari syurga Kini tiada Terpa ilalang menyapa Kau imaji sastra sufi Kudapati sebongkah janji Tirakat bakul munajat Disisa jamuan akhirat Sayang.

Biduri menanti Pada sepi tetes janji Di akil rasa di awal cinta Harap sapa Jangan tarik tabir diriku Karena engkau akan buat aku tak berdaya Basuhlah rasaku dari ceceran liur sekujur diri Karena penat yang kini merejam-rejam kalbu Dengus nafasmu menata hasrat Lenguh jiwamu membuatku melayang Lupakanlah asa siang usai menjelang Engkau gumuli aku dengan pesona yang mendesah Sudah cukup tolonglah hentikan Karena ulahmu menghantarkan aku pada surgawi Tapi aku tak ingin semua cepat berakhir Walau sedari tadi engkau memula aku yang mahir Biarlah aku tetap dalam dekap yang menggelitik Menatap diri pada palung gelora yang manasik Menutup mata tetap terjaga agar melata Menanti dalam pasungan degap-degup karma bercinta Terima kasih purnama terangi asmara Dendang lirih menahan rintih yang membahana Rajut kasih singgasana mahkota kekasih Berharap jadi perwujudan hati buah cinta terkasih Angin, jawablah Tanyaku malam begini Bagaimanakah dengan esok hari Biar kucontek Barang sekedip jawabannya Semoga angkasa Membuka warta kehidupan Diantara gemuruh kilau kilat yang menyambar Kutak bisa meraba Apa yang ada dalam kisahku Sudikan engkau jatuhkan Setitik hujan airmata langitmu Biarkan jiwa hati menangkup Percikan anindha nan suci Semoga sebutir titah Illahi Datang, merasuk dalam qolbu Dan ketika pagi beranjak Meriap wajah bumi Kutiitipkan pintaku Kepada mentari Jatuhkan sekilas Sinar lembutnya Ketika suhu badanku Sedang meninggi Atau saat raga selaraskan Arah tuk berdiri Mengikuti nyanyian alam penuh misteri Hening itu tak membuatmu terlelap Hening itu tak membuatmu bermain dengan mimpi mimpi bisu Hening itu menarikmu dalam bait bait bahasa yang ranum Hening itu menarikmu sejenak menuangkan kalimat kalimat sahaja tak bertuan?

HMm . sejuta makna hening ketika kau mampu terdiam Sejuta tutur kata hatimu menguasai seluruh pandanganmu Hingga kau terdiam dan terpaku menatap kekosongan Hingga kau bermain diantara hayal hayal fikiranmu Dan hening menghanyutkanmu Ke dalam dunia yang berbeda Ke dalam dunia yang membisu Ke dalam buntu yang akhirnya membukakan jalan Dan hening mengubahmu Ke dalam sisi hidup yang merenungi Ke dalam sisi bahasa yang hanya kau tahu Ke dalam sisi hatimu yang sejujurnya Dan Hening memanggilmu untuk tersadar Diantara kelelahan tapak tapak alam bawah sadarmu berlari Diantara ide ide yang membuyarkan kepenatan itu Diantara kebosanan yang kau habiskan seharian Dan biarlah Hening menghampirimu Hingga kau temukan arti pencarianmu Hingga kau temukan arti tulisan tulisan yang tersirat Hingga kau temukan kedamaian disana Manakala raga masih terjaga Diantara gulandahku yang mendera Malam ini kucoba rebahkan asa Dalam peluk kehangatanmu kasih Menelaah dan mencoba Memaknai dari kekurangan diri Dimana selalu saja ada onak dan duri Yang mencabik-cabik masing-masing pribadi Dalam hitam putih suaraku menyapa Menyela ditepi malam yang kian pekat ini Kian mengharu biru rindu ini padamu Rentangkan doa gurat hindar hasutan iblis Lentik kau kian kemilau intan Selaksa bintang diperaduan malamnya Dalam hati ini hanya ada satu Guratan cinta yang terlukis indah Yakni hanya kidung cintamu Hatiku terlena akan gita dan melodi cintamu Maafkanlah Kala jiwa dijamahi murka Hanya jiwa bungkamlah yang kupunya Untuk rebahkan letih dari selaksa prasangka Setitik air mengalir diatas gersang Tetes mengalir melalui arus Dalam sungai pipi Segumpal asa menjadi rasa Derai kian tak henti Menyentuh pori sungai hati Ku tawar kan sebilah minuman Dengan genggaman harapan Akan membasahi rongga Namun kilas tak mampu ku teguk Karna takut akan kepahitan Tawar bukan lah pahit Tapi rasa mendorong rongga Untuk enggan menyentuh nya Duh indah ku tatap penuh keraguan Pandangan kosong akan kesesatan Hilang seakan tenet memilukan Adakah reda dikala hujan ?

Reda dengan tabur terang Memahat pelangi Indah kala bersinar kini Namun tak dapat ku nikmati Hanya sekilas indah aku rasakan kini Akan ku tulis kerinduan di keningmu Seperti kerontangnya tujuh musim Wajah pagi hilang bentuk Keluh kesah bergetar Di ujung kepedihan Saat kapan mala-petaka Mencaci dunia Dari jaman ke jaman Mengapa ini jadi beledru Seperti sulaman permadani koyak Jaman Daud ini terjadi?

Sampai saat semuanya berakhir Matahari dan bulan bersentuhan Kasih Adalah malam berselimut kelam Betapa bayang panjang Kian membentang Bicaralah di hatimu Tentang cerlang langit tujuh Di sana aku juga sedang berbincang Tentang asa bersilang gemilang.

Awan tersenyum manis Terbentang di cakrawala Putih laksana kapas Mentari duduk di singahsananya Menebarkan aroma rindu Pada persada Burung burung berlarian Melayang di angkasa Kupu kupu menari Di hamparan taman Mawar yang merekah Daun daun bercengkrama mesra dengan embun Melambai lambai di tiup sepoy angin yang lembut.

Secangkir teh panas terhidang Aroma yang begitu khas menemani senja Senyum manis menebar pada indahnya semesta Awan menyendawan di langit Mengumpulkan gemintang di galaksi Meramu cahaya dalam bilangan masa Memberi terang pd bumi nan gelap Angin berhembus dari tengah samudera Menandakan pagi telah tiba Sapa lembut sang surya Pada malam yang berpamitan Masih termaktub Di bibir prasasti Tentang momen sabtu kelabu Hasrat jiwa petik sukma Melati buyar saat kau lantunkan Sajak-sajak cinta nan berbisa Sempat terhitung langkah qu Serta detak jantung qu Desahkan nostalgia Dibalik tirai kenangan Sunggingkan senyum Kencani duka Langkah Sikap qu Digantung tinggi Dibuang jauh Oleh luahan hatimu Kau sodorkan satu kasturi Beralaskan duri Menusuk kalbu Rembulan.

Kini kumelihat kau Bersinar ditemani sang bintang Dan aku ikut bahagia untukmu Biarlah. Biarkan saja aku Ikut bahagia karenamu Sambil memeluk warna Yang pernah menjadi milik ku Berbahagialah. Dan biarkan aku Berjalan bersama sisa waktu Yang masih kumiliki Biarlah. Meski ku tahu Semua tak akan pernah sama lagi Karna semuanya telah berubah Kini diantara hening malam Saat angin berhembus dingin Kunikmati derak ranting patah Bersama daun kering Yang terus berguguran Tanpa tahu Kapan akhirnya Bumi yang mengeja matahari Mendadak diam Seperti langit runtuh Dan rembulan Menangis diujung rasi Layaknya rebahan Yang tak bertubuh Jangan berkata janji Yang digenggam mati Kala debaran mengikat Asa bernoktah Lantas untuk apa Kibarkan asmara hati Jika berpilar naungan Gaung seribu rapuh Beri aku satu kematian Karena kehidupan Hanya sandiwara Yang kelak menuai lelaku Yang tak berjiwa Hingga ada dan tiada Menepi dalam ratapan Jangan nantikan Dari awal mula Yang telah pun Tiada akan akhirnya Berpulanglah kembali Sebelum terulang Karena janjiku Bukan sepuhan Tapi bertulang Aku terdiam dalam bungkam Saat jarum-jarum prasangka Hunusi pori-pori sukmaku Begitu runcing menikam Hingga kedasar ruang nuraniku Tak bisakah sekejap saja Kau berdamai tanpa prasangka Aku memohon dengan kerendahan hati Tolong rahimkanlah sejenak Riuhnya gemuruh prasangka Yang memekakkan gendang runguku Pusarakanlah ragumu Benamkan pula egomu Agar kita bisa merasakan Betapa indah'nya rasa yang kita miliki Tingkah nakal sang bayu Masih tak henti menggodaku Di antara sejuk'nya rinai embun Yang masih setia memeluk pagi Tak pula aku beranjak Dari dingin yg mendekap Meski gigil telah kuyupkan aku Dalam kebekuan yang meralung Entah mengapa Aku tak pernah jengah Berdiri disini Mengeja perjalanan malam Hingga pagi datang menjelang Netraku yg nanar Tak pernah redup menalari pekat Demi mengharap sosok bayang'mu Hadir menjamah rasa'ku Meski hanya terhitung Dalam kejapan mata Jiwa yang sendiri ini Yang selalu terjaga dari lenanya netra Saat gulita menyapa malam Dan para insan asyik mengeja mimpi-mimpi mereka Aku justru di sini dengan tatapan nanar Berdiri di perigi malam Dengan nafas yang jauh dari pembaringan jeda Sendiri di hamparan gulita'nya malam Dalam lembutnya belaian sang bayu Aku bercumbu dengan sunyi Memeluk pekat di kaki langit Berbaur dengan debu dan roda-roda jalanan Dengan selaksa asa dalam tengadah Mengaharap embun merinai Dipelataran pijak'ku Tak jarang letihku merengek manja Bahkan jengah kerap hinggapi ruang nuraniku Namun aku tetap bertahan Demi sebuah hidup yang lebih bermakna Dan aku percaya akan karunia'NYA ALLAH tak akan meninggalkan aku Dalam keterpurukan Siang masih menyisakan terik Ketika senja merangkak temaram Mengikis sisa-sisa peluh yang terbakar Dari sengatan terik mentari Harapku letih kan sirna di pembaringan jeda Ketika gontai langkahku memasuki huma Telah ku rejam netra agar kantuk menghiba Namun anganku justru sibuk mengembara Lalu singgah pada bait-bait aksara Yang masih melekat pada ingatan Masih terngiyang di runguku Canda-canda binal gadis pujangga Menggodamu dengan untaian aksara Mengetuk pintu cintamu dengan jemari genit Meski enggan kau berbalas aksara Tak urung kau pun tergoda Ach.

Cinta memang penuh dengan dilema Misteri rasa siapa yang bisa menerka Kecuali SANG pemilik semua rasa YA ILLAHI RABBY. Malam belum lagi usai merinaikan pekat Ketika angan'ku mengembara Dibentangan belantara sunyi Terukir kembali larik-larik kenangan Pada lembaran kanvas gulita Merinai kembali air mata rindu Basahi semak-semak nurani Yang telah lama kerontang Gundah'ku kian bingar Meriuh diantara lenguh nafas Mengusik detak jantung Ku teriak'kan kerinduan'ku Pada hembusan sang bayu Agar sayap-sayap kegelisahan'ku berpendar Dibentangan cakrawala Meski ragu nurani Apakah gendang rungu'mu Akan mendengar teriakanku Apakah pijar mata indah'mu Akan menatap kepak sayap'ku Yang telah rapuh Dan apakah rasa'mu Akan menjadi kembaran rasaku Entahlah Aku hanya mampu simpuh dalam pasrah Karna memang hanya ini yang bisa ku lakukan Menyampaikan pesan-pesan kegelisahan Pada hembusan sang bayu Yang mungkin hembusan'nya Bisa saja datang terlambat Remang cahaya malam Berpendar dibentangan sunyi Sementara guratan pekat Kian merepih menyunting pagi Tergugah sang embun Dari lelap'nya mengeja mimpi Beranjak meninggalkan peraduan Di rinaikan tangis kerinduan'nya Pada reranting dan dedahan Diantara lenguh nafas sang bayu Embun tak henti bercumbu Hingga kilau lentik jemari timur merekah Dan memapah'nya pada peraduan Esok hari embun akan kembali Dengan kerinduan yang sama Untuk menepati janji Pada penghuni pagi Yang tak pernah jengah menanti Palung sukmaku menjerit Saat malam memapahku Ke dalam dekapan sunyi Tanpa meninggalkan pesan Entah apa yang tersirat Pada fikiran sang bintang Saat pijar'nya mengerling Menyaksikan kesendirian'ku Karna angan ku Sibuk mengembara Pada selaksa kenangan Yang pernah terajut Tanpa kusadari Butiran-butiran kristal Jatuh bersimbah Membsahi sudut-sdut bibir'ku Gundahpun kian meralung Meriuh di kedalaman rasa Berkerumun Diantara lenguh nafasku Sesak dadaku dihimpit pilu Kehadiran'mu Yang tak kenal musim Meliuk di jajaran waktu Yang berpendar Saat ramah menyapa Kau berbagi tak kenal rupa Gemulai tarian'mu Menyeruak di bentangan kaki langit Membelai helaian dahan Berhembus disetiap desah nafas Godamu tanpa aksara Menyilak helaian rambut'ku Aku hanya terdiam Menikmati liukan nakal jemari'mu Walau terkadang Kau tampar pias wajah'ku Dengan aroma dingin Kau hunusi pori-poriku Hingga tergigil tubuh'ku dalam beku Namun aku tak pernah jengah Bersahabat dengan'mu Aku bahkan menempatkan'mu Pada persemayanan yang senyap Dan kerinduan'ku Membuncah pada'mu Saat gerah membakar peluh'ku Engkaulah sang bayu Sahabat tanpa wujud Dan tiada berbentuk Aku selalu berharap Guratan awan akan beranjak pergi Di iringi dengan rinai hujan rindu Yang jatuh dihamparan pijak'ku Dan menjadi butiran-butiran kasih Yang selalu terbingkai Di dinding rasa Tapi mengapa Prasangka baik yang ada di senja datang mentari pun redup semburat nya berwarna nurani Tak seindah dengan nyata Karena yang datang justru amukan badai Di iringi dengan hujan prasangka Yang tak henti menghunusi serambi jiwa Nanar netramu memandangku sebelah mata Garang-mu seakan ingin melumatkan-ku Dari lantai kebersamaan Yang selama ini terbina dengan indah Tutur-ku selalu kau anggap dusta Tiada pernah terlihat Bias kepercayaan di rona wajah-mu Kecuali guratan curiga Seakan diri ini tiada berharga Aku hanya terbungkam Ketika belati prasangka Menghunusi palung sukma Aku pun tak tau Apa yang harus kulakukan Untuk meyakinkanmu Jika diri ini tak pernah bisa Berpaling ke lain hati Dan seharus-nya kau tau Langkah-ku gontai tanpa kau iringi Hatiku berselimut resah Tanpa sapa manismu Selayak-nya kau tau itu Agar tiada lagi Kau halau guratan awan Dengan merinaikan hujan prasangka Inilah kerinduan ku pd mu syang Meski pilu terasa Diri kan selalu tertawa Agar dirimu tak pernah menduga Apa yang kini melanda raga Dalam phitnya pilihan dunia Inilah kasih sayang-ku Hadir sekedar menyapa Meski hanya sekedar tanya Tak ingin di hati terbesit kecewa Ketika derita ku menerpa palung sukma Hingga di balik kabut malam Penuh dengan tangis prasangka Biarlah,,biar Aku sendiri yang menanggung semua siksa Walau aku tahu pasti hati-mu akan terluka Karena sudah cukup air mata tertumpah Basahi ruas rongga jilbab mu Izinkan dlm diam ku berpikir Langkah mana yang akan ku ukir Bersama-mu selamanya Atau menuju takdir akhir usia ketika alam mengubah terang menjadi gelap pekat ada lentera yang menerangi ketika hati menjadi sunyi dan sepi menjadi gelap tanpa warna engkau datang menjelma menjadi lentera yang terang itulah yang ku rasakan ketika malam kembali datang kau sinari hatiku dengan senyum ceriamu dengan canda tawamu dan hangat kasih sayangmu dalam sujud ku berdo'a dalam tengadah ku meminta untuk menjaga lentera itu agar tak lelah menyinari hatiku Sebait kata cinta ku tuliskan didinding malam desah nada jiwa tentang rindu yang mendalam merajut aksara kasih dalam gelap ku menyulam berbenangkan tinta hitam saat waktu kian mengelam Melantun nada indah saat bayang mu menyapa ku goreskan puisi cinta pada setiap bait aksara terselipkan kerinduan dalam semua rangkaian kata melantunlah sebuah irama dalam setiap alunannya Bergemuruh nafas malam saat rindu ku membuncah menjeritlah desir angin meratapi kesah jiwa tersampaikan pada langit dikisahkan di semesta terdiamlah kegelapan dalam pesona sebuah cinta Ketika rindu ku membuncah dikedalaman hati bersenandunglah gelisah ku mengalun bagai melodi menancapkan satu nama yang selalu menghiasi merayap ke jiwa ku dan menikam dalam sepi Berdesirlah darah ku terbuai bayang mu kasih menjamah malam di pekat nya kesah hati setiap saat mendatangi ku lewat mimpi terbungkamlah pagi ku terseret lamunan sepi Berdetak waktu melagukan nyanyian rintih tersentaklah angan di sapa kidung sunyi berdendang siang lewat dawai matahari membakar rindu ku bagai kan dilumat api beberapa masa yang lalu kita bertemu beberapa masa yang lalu kita berpisah tetapi.

. setiap waktu aku memikirkanmu di sela nafasku hembuskan nafasmu di setiap denyut nadiku berdetak jantungmu kau hidup dalam diriku ku rasakan apa yang kau rasakan ku rasakan saat kau menangis dan tertawa walau raga terpisah jauh tanpa ikatan noktah tak akan bisa pisahkan cintaku yang tak pernah sirna, untukmu Aduhai engkau kekasih hati Dendang malam ketika hati di sapu rindu Telah mengurai bait-bait cinta menyebutkan nama mu Dan tersentak aksara ku dari sebuah lamunan bisu Wahai kekasih hati Purnama telah menangis dalam ratap malam ku Ketika ku pecahkan dinding langit menanyakan tentang kamu Saat cinta mu berbisik di kedalaman jiwa ku Lihatlah wahai kekasih hati Membentang lautan di hadapan netra kita Merintih asa di jiwa merindukan raga Agar engkau dan aku dapat berjumpa Memadu kasih kita di tepian sunyi samudera Dengarlah wahai kekasih hati Sejuta bintang pun akan enggan berpijaran bila malam tak menghadir kan senyum rembulan Dan mentari pun akan berlalu dalam senja yang temaram meninggalkan banyak cerita untuk kelak kita kisahkan Celoteh rindu ku merobek dinding malam Pecahlah tangis bulan saat ujar ku menikam Terhenyak bintang-bintang saat tutur ku menghujam Tersentak dari lelapnya di kala waktu kian kusam Terbangun dedaunan dalam gelisah rintih dahan Ketika ranting-ranting di sapu angin berdesir Menangis tawa langit dikala bumi mengoceh awan Bersabda kepada hujan agar hapuskan kekeringan Merintih kidung rindu di sapa kemarau kesunyian Meratap setiap bait dalam dendang asa Bergemuruh buih ombak memecah pantai kehidupan Berteriak kepada camar agar gemakan perjuangan Terhenti tembang malam kala fajar menggantikan Memucatlah wajah bulan saat mentari terbit Indah ku tatap nanar sang rembulan Sangat anggun memecah awan hitam Tersorot oleh mata sayu dari lorong waktu Yang menjadi saksi setiap kerinduanku Purnama nampak sempurna Anggun dengan rajutan sutera putih Menyinari kepingan rindu sebatang kara ini Setelah senja beranjak terusir gelap malam Andaikan cintaku sesempurna purnama itu Alangkah indahnya kisah bersanding bintang-bintang Sangat sunyi tanpa ada celoteh sinis di telingaku Mungkin ini ujianku menuju sempurna Akulah bintang yang mendekam di jantung malam Terpanah ratapan bulan ketika terbungkus kelam Seperti dendang taman dalam kisah musim gugur Daun-daun berjatuhan sampai akhirnya terkubur Akulah rindu yang gelisah menanti fajar Melewati malam hari dalam sepi tanpa sinar Seperti senandung ladang saat musim kekeringan Menengadah kepada langit bermohon turun hujan Akulah cinta yang merintih di tirai siang Terbakar ditungku hari dan rindu ku pun meradang Seperti nyanyian ombak yang bergulung ketepian Berkisah tentang nakhoda yang terdampar di lautan Di saat malam mulai diam Di saat dingin kuat menghujam Saat itulah rinduku bertaut Mencari dermaga cinta yang karam Berderai air mataku Jika teringat kenangan lalu Masa-masa indah bersamamu Yang kini menjadi puing-puing bisu Aku coba menggapai bayangmu Yang menghias lamunan rinduku Aku coba memetik senyummu Yang kau lempar kepadaku Namun semua sia-sia Karena yang ku jumpai hanya Bayangan semu dirimu Yang bisu dan selamanya bisu Begitu banyak kenangan yang terlewati Diantara tangis dan tawa yang menemani Kini aku disini sendiri menanggung sepi Bersama serpihan-serpihan cinta yang tersisa Aku tak akan pernah pergi Selama ada cinta Yang bersemayam di hati Satu cinta yang pernah ada Dalam lubuk hatimu Yaitu cinta dari hatimu Yang mampu meluluhkanku sadar diri aku hanyalah ranting rapuh Yang tak patut mendapatkan cintamu Namun di ruang terdalamku selalu berharap jika masih ada cinta tulusmu untukku Akan ku abdikan sisa hidup ini Hanya untukmu seorang Hingga mata ini tak lagi mampu Menatap teduh'nya pandanganmu Lihatlah senja yang begitu indah Sihir jingganya indahkan mata Hingga mengalihkan matamu Untuk tetap menatapnya Walau kau sadari diriku Ada tepat di depan matamu Aku coba redam cemburu ini Karena senja itu keindahan-Nya Aku coba mengertikan hatimu Jika kau memang selalu ingin keindahan Maka.

Jadikanlah aku bagian dari rona jingga itu Agar kau senantiasa bahagia didekatku Walau ku tau aku tak seindah rona jingga itu Yang selalu menyapa senja Semoga dengan ketulusan hatiku Hatimu mampu melihat keindahan hatiku Hujan berjatuhan ke pucuk-pucuk malam berdendang riuh di jantung alam gemuruh rindu datang menghujam dalam diam hening mendekam Malam meratap di tirai awan Irama rindu bagai nyanyian Wajah kekasih usik lamunan Gelisah datang di kesendirian Aroma melati di tepian hati Wangi cinta taburan kasih Putik rindu mekarlah kini Resah bergayut di tangkai sunyi Bunga merekah tersiram hujan Kuncup mengembang di kesunyian Malam berlalu dalam impian Cinta bergema di kedalaman Teruntuk dirimu Selaksa aksara berhias bibir Walau bening menyerta di bola mata Tiada pernah bisa menyentuh Sejauh langkah ku tempuh Langkah lunglai bersimbah merah Menggapai asa tak terjawab Tergolek dalam nestapa jiwa Entah cara apa kudapat Menggugah jiwa hening membeku Membalut rasa beribu rindu Menggapai dan merengkuh dirimu Adakah kau tahu Jerit dan tangis diri ini Terjerat rindu memuncak Akan dekap mesra hadirmu Lidahku kelu Hatiku membatu Tanpa dirimu di sisiku Jika peluh yang meniti pagi Bergeming tanpa makna Malam mewarnai hari yang semakin kelabu Bila makna berlalu bersama buih Yang begitu perih Biarkanlah hadir ku Menjadi pengobat jiwamu Kumerinduimu Lewat tangisan sujud Dipekatnya malam Lewat untaian doa Yang begitu syahdu Lewat seutas makna yang tersimpan dijiwaku Tanpa perlu terungkap Lewat deburan aksara Sampai tak ada satu katapun Yang mampu mewakilinya Jejak sang merdu tak lagi senyap Bayangan bulan tampak disisinya Irama kasih mengalun begitu indah Tebarkan asmara di hatinya Ia kini berkuasa Jalan ini miliknya Dibaringkannya mutiara Yang dimilikinya dengan kasih Ditempatkanya di tempat Yang hangat di hatinya Berselimut beludru putih Ia menggendongnya dengan cinta Tak dihiraukan berapa banyak Beban yang terbawa Ia tetap tersenyum Bersinar penuh kehormatan Tak ada lagi alunan kesedihan di hati Tak ada lagi cerita kerinduan untuk diratapi Semuanya terlihat indah Mutiara yang hilang kini sudah ditemukan Akan dijaganya agar tak lagi hilang Tersenyum aku melihatmu dengan kebahagiaan Sesering kau memintaku untuk berpacu Dengan garis takdir, Ingin kugenapi tanpa harus merasakan sakit.

Taukah arti menggenapi Mencintai dengan segala daya Dengan kekuatan Tanpa takut pada kenyataan yang memang Tuhan sajikan Sebagai takdir. Sesering itu kau bertanya Kau tidak mencatat Mengingat Menatap mataku Ketika aku menjawab Seberapa kali rasa Harus teryakini dengan ucapan Selongsong hati Kemudian senyap sedemikiannya Merasakan guratan hati Yang lagi-lagi tercabik, Kali ini. Tidak perlu kau obati luka Aku ingin mendekap angin Sebagai rekanan paling setia Menyayangi tanpa keraguan apapun Menangis Ya,lalu apalagi Langkah ini lunglai Pada persimpangan Gontai ini wujudkan peluh kisi-kisi Yang terhampar Pada titian hari yang kian berganti Dalam yang terpapar Menatap nanar rasa menjulang pada asa yang pernah terhimpun Oh hari.

Demi hari merajut nyata dalam sunyi Kala rindu yang membiru Menjadikan hening ditengah ramai Membuat sesak kalbu Dalam perseteruan semu Dengan hardikan masa Tanpa suara yang bertalu Dalam lembaran kosong nan sendu Ku ukir kerinduan Yang tiada bertuan dihati yang rindu Pada dinding angin malam ini yang berselimutkan gemintang Yang beratapkan awan yang berarak Berkejaran tiada berpantang Dan ku katakan bahwa aku Menantimu walau bernada pilu Masih ku ingat jelas Kala jemari masih bertaut Dalam iringan doa cintamu Ukiran rona indahmu melekat Dalam sanubari membekas Kerling binar siratkan segala hasrat jiwamu Dalam rengkuhan asmara suasana haru Impian ini terus bersandar pada naluri Tak ingin ku lepas Walau sejenak walau berduri Agar dapat hantarkan lena ku Dalam keabadian asa Tapi karena titah berbunda Semua menjadi igauan semata Dan semua jatuh berguguran Sebelum masanya Sayang.

Jika persandingan kita Hanyalah dalam batas impian berbayang Aku tidak ingin Dapat segera sadar dari lenaku Karena jiwa ini belum cukup puas Mencumbui indah bayangmu Dan hanya disini Tempat kita dapat bertemu Kala rindu mula bertamu Tapi sayang. Kicau dendang mentari Mulai berdendang Paksakan aku untuk kembali Dalam realita nyata buka semu Dan merampas semua mimpiku Bersamamu yang aku rindu Hingga sisakan termangu Ku keseorangan dibibir gagu Biarlah hujan itu turun Dengan sendrinya Dan bersenandung Menjadi hikayat cinta kita Meskipun itu .

Hanya sebatas rinai Di khayalan malam sepi Yang tiada bersenandung Lihatlah tiap tetesan hujan Ada rona wajahku disana Mengumbar senyum terindah Untuk menemanimu Saat-saat bicara tentang rindu Pada angin yang berhembus Dan pada hujan yang merinai Di altar sunyi Aku titpkan segenap rasa rinduku Padamu yang disana Bahwa diriku yang disini Juga merinduimu Dan menyatakan asa Pada hujan Aku berharap Semua menjadi nyata Di hujung tepian waktu Kadang aku ingin menulis kata Menulis tentang sekuntum mawar Dengan tangkai berduri Aku memulai alinea pertama Dengan pena dirahim jemari Penaku menari di lantai kanvas Dengan irama kata hatiku Pada alenia ke dua Tarian penaku masih gemulai Irama hatikupun masih mengalun indah Dengan senandung asmarandana Namun.

Di alenia ketiga Tarian penaku mulai tak lagi gemulai Jemarikupun tak lagi kuat menggenggam pena Hingga terkulai penaku dilantai kanvas Irama kata hatikupun terhenti Pada koma yang tak bersambung Dan tak sampai pada ada titik Yang seharusnya menjadi penghujung tarian pena Entah mengapa. Aku kehilangan temaku Bukanlah alasan yang tak berasal Bukan akal yang tak berakal Dan bukan tidak tahu menjadi sebab Namun .

Kata ku yang mulai buram Terkikiskan oleh pena yang tak bertinta. Karena kadang pula aku lupa Apa yang hendak ku rangkai dan ku eja Ku lukis namamu Dirimbunan ranting aru Kala senja Membiaskan warna ungu Bayangmu larut Dalam gurat-gurat awan senja Yang biasnya indah kunikmati Adalah deretan kenangan Yang kau sisakan. Dan kau berlalu dalam bimbangku Untuk menuai asa Dan harapan kosong Ku lukis ulang namamu Di pasir lembab Lalu ku tatap sesaat Ombak datang perlahan Menghapusnya Seiring sisa cintaku Yang tertinggal disini Telah pula ku lepas bebas Bersama angin Ku kirim salam getir kepadanya Esok.

Jika masih ada sisa waktumu Singgah di pantai ini Tapak kenangan itu Telah menjadi dermaga Dan kenangan itu Telah tertimbun Dalam perut musim yang berganti Tersimpan abadi selamanya Masih saja jarum lentik menyulam ayu Di hilir muara di tepian telaga kolbu Jenjang sikut menyikut kabut Di patilasan ruhku tempo lalu Di hamparan belukar manjaku Lantas dimana desah rindu Ku muntahkan pada akar melilit genitmu Ku usapkan pada teriakan sayangmu Permata langit tak sesejuk kecupmu Selimut kabut tak sehangat pelukmu Seumpama tirai cinta Telah membelenggu jiwa Dendang rayuan jaman Guyon khas ragu padamu Kelana kata sabda dewa Tetap tertawa manja Ragaku ku jual waktu Hati tetap bergemu Diperjuangan pana meminta Aku meminang semu pada nyata Rindang malam kini Tengah asyik Dalam buaian mimpi kasmaran Nafas-nafas cinta kini Tengah berpengantin ria Saat itulah.

Camar malam pun Sedang asyik meminang cinta Entah,, Mengapa saat hening, Hati masih melanglang buana Mencari arti irama dendang cinta Namun hanyalah kedengar kecapi merana Serunai malam Kini tak bisa Mengindahkan sepinya malam Adakah cintaku bertepuk sebelah hati Hingga kinipun dirimu Tak berkunjung dalam mimpi Wahai pekat malam Cepatlah berlalu Dari tatapanku Aku tak mampu Bersimbah rindu Hanyalah kuingin Pagiku cepat datang Kuingin Di rindangnya pagi Kutemui kerinduan Dia bercerita Tentang salju putih Yang menapaki udara Dengan sayapnya Yang terkoyak panah ksatria Dia bercerita tentang tanah Yang memerah Dengan tubuhnya Mengejawantah dunia Menembus batas-bataslogika Dia melukis langit Dengan warna Tanpa menunggu Hujan turun Yang menjadikan pelangi itu ada Dia berceita tentang samudera Dengan puisi-puisi Tanpa bisa dimengerti maknanya Yang menjadikan pasir bicara Dia mendekap lara dengan belati Menancap di pundaknya Hujan sore ini Adalah hujan dengan angka-angka Yang memekakkan telinga Berputar menyusuri jalanan kesepian Mencari pohon oak Pada musim gugur Yang tak berkesudahan, Menyairkan ribuan lara Yang menerpa Atau hanya gundah Yang membara Siangku menantang Raja mentari kian mengerang Menyinari panasnya pas garis vertikal Peluh meluruh ditubuh Butiran kristal pengais rejeki Kiranya letih baru ku tau kini Dan akupun hanya bisa hela nafas penyesalan Ayah.

Kini ku tlah bisa mengais rizki sendiri Belum sempat dik0u merasakannya Mengapa . Sang ilahi membawamu pergi Dari jiwaku yang kerap sunyi Walau semua tlah lama berlalu Tapi luka ini masih tetap ngilu Tak bahagiakan dirimu disana Melihat keberhasilanku saat ini Hanya sembah sujud Dan sejumput d0'a untukmu Semoga engkau bahagia dialam surga sana .Aamin. Letihnya. Perjuanganku mengejarmu Sakitnya langkah kaki ini Yang berpijak Di kerasnya doktrinmu Sungguh lelah aku Menjalani arus jalanmu Karang yang terjal Badai yang mengaung Melempar daku dalam kefhuturan Suara hati ibarat senyum kecil Yang merapat dalam jiwa Tak akan ada lagi Yang akan menghiasi hati Dikala jiwa pudar dan rapuh Menanti engkau dibatas waktu Kuakhiri rasa mahabbah ini Dengan senyum simpul Dalam peraduan cinta Yang penuh dengan ketenangan Lapar dan dahaga Menggantung menjadi satu Membaur lebar Menjadi meluas raya Menggapai satu titik Peraduan peristirahatan Yang ada hanyalah Senja datang mentari pun redup semburat nya berwarna dari Mu ya robb Aku mengukir luka darimu Dibalik awan Agar dapat tersapu hujan Kala mendung bertamu pada hari Karena aku tidak ingin Siapa ada yang tahu Tentang adanya haru dalam hati Biar saja Karena akan ku kemas Dalam senyum Yang mencoba menawan Aku akan membatik baikmu Dalam alunan bayu Yang mendayu Agar dapat kembalikan Ingatanku tentangmu kala jemu menderu Dari segala penjuru Karena aku tidak ingin Kisah ini dinodai Dengan dendam prasangka Memburu cederakan hati Biar saja aku nikmati sendiri Sebagai kajian temukan jati diri Aku berdiri tidak lebih tinggi Dari ilalang yang menjulang Aku merebah lebih dalam Dari debu yang beterbangan Dengan mengeja bintik-bintik asa Sebagai jembatan jurang Untuk aku berusaha tetap bertahan Hingga akhirnya tiada tertahan Wahai kaum adam Jika kau mencintai wanita Setidaknya kau nyatakan Bukan dengan manis katamu Tapi tunjukkan ketulusanmu Jika kau menyayanginya Beri pengertian untuk kebaikan Selami jiwa dan keinginannya Rangkul dalam kehangatan cintamu Aku wanita Berperasaan halus nan lembut Ingin dicinta dan mencinta Tulus dan apa adanya Aku Tak ingin disakiti dan menyakiti Tak mau berbohong dan dibohongi Tak mau terluka karena cinta Ketika pijakan tak lagi datar Langkah pun mulai terhenti Bukan alasan yg tak beralas Bukan akal yg tak berakal Hanya saja tanah yang mulai terkikis Bebatuan timbul dipermukaan Sudahlah Memang wacana tak ada yg rata Namun karakter diri tetap menjadi tumpuan Kala persepsi menjadi debat Tiada berkesudahan Aku pusing Keluh kesah akhirnya menuding Satu ungkapan melenggang Diantara kerumunan Menggunungnya kata Berhiaskan cinta Aku heran Melihat detilnya yang abstrak membuatku gila Tak ada makna hanya ujung lidah Yang mengukir indah Tapi akhirnya aku pun tersadar Semua itu tiada guna untukku Makna yang samar Dalam pengungkapan yg berbeda Alur yg selalu memuat kebijakan semu Terpaparkan oleh pena tanpa tinta Kosong melompong sepertinya ompong Seekor kupukupu Tercerca dibebatuan Sayapnya patah layu merunduk Indahnya buram tak lagi biru Kepaknya tak seimbang Hingga senja datang mentari pun redup semburat nya berwarna tak bisa terbang Merayap diantara debu Menjerit tangis memilu Jauh ia dari bunga Jauh ia dari perdu Tempat bermain mengepak sayap Sahabat cinta dalam sapa biru maya Kupukupu tercerca diantara batu Duduk diam tak lagi riang Merenung meratap kejadian Tak sempurna memang hati Tak sempurna memang jiwa Selalu saja tak bisa mng'ikhlas nyata Kupukupu tercerca diantara batu Kini hanya mnulis sajak Pena usang sahabt cita Kertas buram luahan rasa Biru maya karib stia Sebiru langit pagiku Sederet untaian kata membatu Beku dan beku Dingin mnyungging Namun seulas senyum Tetap kuukir Ulasan kuas ILLAHI Memadu warna dalam sketsa Dibiru gunung Kabut memeluk perdu Membungkus ilusi Memenjarakan imaji Kerdil.

Membuat kata mngecil Bagai liliput didongeng usang Lembaran diary kubuka Helaiannya basah disaput embun Sehingga tinta meruah Yang hitam semakin pudar Yang biru berubah nila Sehingga puisi makin menghiba. Air tentu akan mengalir Menuju lautNya Namun setidaknya Sampan terdayung Searah dengan keinginan Penyesalan yang muncul Seperti menggenangi samudera Tidak mau diam Walau sejenak dalam saku Agar berhenti air mata Beberapa wajah Yang dulu silih berganti mengisi, Begitu sulit untuk dikikis Karena tanpa disadari Semua telah menggurat Kuat di dinding jantung Semua hilang lenyap Tanpa bekas Ketika dirimu menari Mengikuti jantung Yang terus bernyanyi Dengan bahagia Cintai dirimu Layaknya senja datang mentari pun redup semburat nya berwarna Yang duduk setia di pundak.

Dengan senyum penantian Layaknya ulat yang sabar berubah Menjadi kupu-kupu. Terbang diantara kepak masa lalu, Menyusurinya jauh Ke dalam lorong-lorongnya. Seperti siang malam yang sekepak elang. Tak mudah mengungkap rasa Yang hadiri, hingga perih di jiwa Cinta. telah menjadi asa Dan hati bertanya tentang apa adanya Bila menepis waktu Menjadi sebuah rindu Dan hati menjadi galau Yang menanti kehadirannya Cinta.

jangan buat jadi pilu Rindu yang menjadi perih di jiwa Sambut hari slalu bahagia Dan itu. Hanya untuk menunggu yang terbaik untukmu.

Berdiri dalam dekapan bisu Yang membeku Menggantungkan impian Dalam asa yang tak pasti Menyepi tanpa tahu Sampai kemana akan memuncak Berkeluh mengejar paradigma kosong Yang tak berarti Masihkah Menginginkannya dalam sepi Masihkah Terdiam dikala luluh dan acuh Dan tak tahu Apakah ini kasih yang diberikan sang pengasih Ataukah bisikan semu fana dunia Masihkah menunggu Meski tak di hampiri Masihkah mengenangnya Meski tak terbayang Apalah jadinya Jika samudera terdiam Tak lagi mendebur ombak Tak pula memecah karang Burung-burung akan sepi Para nelayan akan mati Angin akan menampar dirinya sendiri Senja pun akan enggan Tenggelam menutup hari Apalah artinya Jika samudera terbata Tak lagi membiru indah Tak jua membius mata Kabut tak kan menari di atas bukit Telaga menyulam pahit Dalam bilik jiwa terasa terhimpit Semakin sendu mengikis waktu Di perasingan langkah Merantai tangan Dengan duri Keindahan mawar Yang tak terjamah Lalu memenjarakan jiwa Dalam gelora kerinduan Yang bersenandung Adakah yang rela bersenandung Untuk rinduku yang mendung.

Seakan tak lagi ada Belenggu penjara Nurani berkabung Andai saja keindahanmu Bersajak Di barisan bait hayalku Menghayutkan aku Merasa itu nyata Padahal …. Itu hanya pikiran pada renungku Itu hanya hayal imajinasiku Itu hanya gerak bahasa jiwaku Dan merubahnya jadi harapku. Ajari aku Mengitung angin Menyemat kerinduan Di daun kering Ajari aku Membaca jejak syair air mata Sungai-sungai kesepian Tanpa muara Ajari aku Mengingat bayangan Merangkai bentuk asing Merampungkan segala hilang Ajari aku keikhlasan atas kesendirian Tanpa kebersamaan Tanpa air mata Ajari aku Mengerti untuk menunggu Meski hari berganti minggu Minggu berganti bulan Ajari aku Menjadi tegar Meski raga terbalut luka Meski hati bersenandung pilu Ajari aku Menjawabmu dengan lembut Tanpa secuil amarah Tanpa tutur yang salah Ajari aku Memuja jingga Saat senja mulai temaram Saat malam mulai menjelma Ajari aku Tertawa di dalam tangis Atas perih yang masih menoreh Ajari aku Kerendahan hati yang syahdu Ketika ego merajai sukma Ajari aku wahai guru di atas guru Terka pikir lambung imaji menguji Sekat pintu tertutup di banjiri iri Dihempaskan pula putih berlumur noda Direngkuhku pada balutan putih suci abadi Terputuslah sorot pandang dunia Tiada dendang nurani menghakimi Tiada puja puji menggema Hanya tanya tanya tanya Disebrang hujatan itu Saat kaki terkaku mulut membisu Aku diam menanti tanpa hati Menunggu senja datang mentari pun redup semburat nya berwarna pasti putusan ijati Tela'ah asmara semalaman Dibalik bulang sepasi Mengintip asa bintang Untuk kian ikuti hati Lanjut ke peraduan Menyulam netra Sulaman asmara Mendaki dakian Keagungan sastra cinta Tutur sabda dewa tiada terucap Kala sang lirih menyapa Gentar lemah terpikat Sukma entah kemana Hasrat merekah Eja arum samodra rasa Aku terbelai senandung Hingga lanjut waktu berkata Tutur rindu mencumbu netra Aku terjaga sampai surya menyapa Kiranya pedoman galur terpendam Semalam telah berkobar Luluh lantahkan durja Dikebiri cinta Terpikat senandung asmarandana Ganyang Sukma menggangga Di tapak patilasan Di sudut perjanjian Di buaran indra Tiada terpejam Hak-mu lantang lisan Ruh-mu tunduk beralasan Sedari puji Lantun dendang nurani Seroja berseri Tatap imaji menguji Lanjut kau petik dia melengik Wahai kumbang pemburu taman Lantang serunai Arif menuai hujatan Bergantian di sudut jalan Ditepian penjajakan Biarlah-biarlah Kau cumbui aroma Dan indah kau rasa Perapian dalam hangat usapan sejuk Lekuk gulita menyemai Menyantuni serpihan bulan Ada gelak pelita menyendawa Senarai hembus palapa Masih tergolek menyandar Mengumandang lelehan magma Tutur bisik menyapa Senandung jagad membuai mimpi Tabir gemintang pudar Menelisik redup nya kelabu Lantang jeritan hitam Menjelajah pesona ilusi Dimensi menyanggah lelap Menyelimuti kepingan imaji khayal Dan aksara memangku tahta Lalu bergeming Dalam palung singgasana berlian Pergilah kepunahan Lelah ini akan berbaring Di antara putih berbalut kabut Tembangkan segala butiran embun Dalam tatanan alam semesta Biar dingin menyeruak kilau Jelaga tidak meluntur Hadap bayang symphoni alirkan diri Untuk dapat menyambut pagi Bernuansa sahara seroja merekah Lalu bangkitkan daku Dalam temaram syahdu membelenggu Senja Tenggelam Di akhir Silam Yang menentang Hati Mencoba melepas engkau yang ku sayangi Dimata merah kau tumpah marah Alirkan pedihmu Tumpahkan isak derai hatimu Dalam pelukku Kasih.

Di dingin hujan ragamu Ku lepas dan kutinggalkan Walau gemetar rasa Hapuskan mimpi yang pudar bersama dirimu Kasihh Kini di hujung senja ini aku berdiri sendiri Menatap langit hitammu Yang curahkan selaksa rindu Sepenuh dadaku Jiwa ragaku bagai berjelaga Menatap pekat hitamnya karma Yang tercipta disuratan cinta kita berdua Kasiihh Di dingin hujan kini ragaku aku biarkan Mandikan hati dari khadam cintamu Yg masih melekat ini Sungguh kuingin bayangmu Pergi Dan musnahkan semua, Sejuta kenangan yang ada didalam dada Kasiihh.sungguh tak mampu lagi diriku merindu Indahnya bayangan cinta semanis dirimu Resap meluruh Dingin menyangga.

Pada ranting jiwa yang kian retak. Telah ku coba memungut Kepingan asa yang tlah berserak Pada malam yang menenggelamkan Syahdu nyanyian hati. Yang telah mendendangkan Butir bening ketulusan rasa Yang menggenang dalam telaga hati. Duhai angin malam Selimuti jiwa ku dari bara murka.

Yang membinasakan Rendah hati Pada santun ucap Duhay tetes embun malam Basahi relung jiwa ku Dalam gundah merajai Tak mampu rasa di jiwa Dikala pilu menghanyut kan Rona indah bahagia ku. Ku tak sanggu meredam lara nestapa Duhai rembulan malam Terangi untaian kelana jiwa Dalam tapakan kasih Tak mampu ku menapak Dalam pekat yang menyelimuti Hadir kan sebercik sirna mu Menembus netra pijar indra ku Menyelusup menembus impian hati.

Agar ku mampu Menatap indah Merekah mentari Di pelupuk mata bumi Mawar mengecup sore jingga Membebat raga ini Dengan seledang lara Mungkin. ALLAH sedang mencintaiku Mengasihiku tanpa sisa Di senja yang merona Seolah nafas hendak lepas dari jiwa Bias senja menarik rasaku Untuk terbang ke angkasa raya Pejamkan mata Nikmati indah-nya dunia Jangan berhenti memuji Hingga malam membawa keheningan Ya RABB Rengkuh aku dalam belaian kasih-MU Bersama-MU dalam nikmat tak terbatas Hingga aku luruh penuh Dalam samodra cinta-MU Tak ada lagi lara di ragaku Kecuali nikmat kasih-MU Duhai kekasihku pemilik cinta abadi Jangan pernah kau lepaskan cinta-MU Dalam laraku Engkau pemberi ketenangan jiwa Indah bersama-MU tiada bertepi Ku ingin larung bersama-MU Dalam laraku Indah hari-hariku Jika kau selalu taburi dengan cinta-MU Dalam riuh tapa Masih saja jamas rindumu Menenun laku Dalam ritme langit Berpeluh rindu Masih kah engkau titipkan Asa di putik embun Bertasbih dalam beku lalu Serah dalam mandah Disirat takdir Masihkah engkau kasih Siangkan air kesejatian Dalam keselarasan abdi Ketika paes durga peponi bidadari Sedang selendang malam Masih saja ku pujakan Berpita surga sahaja Gelap.

Hanya tersisa hitam Dan secercah sinar bulan Yang kian redup Tertunduk menanti Surya Yang sedang terlelap Menepuk bahuku yang mulai lelah Dan kelopak mataku yang gelisah Taak bisa kuterjaga di dekatmu Tapi tanganku Masih menggenggam erat potretmu Yang kelak kubawa bermimpi Inginku di sampingmu menyelimutimu Dengan kedamaian Dan kehangatan malam Bukan karena kakiku Tak mampu menapaki Jalan ke sampingmu Tapi karena malam tak izinkan kita bersua Malam memang selalu gelap Tapi malam ini kubawakan cahaya Dari ruang kalbuku Mungkin tak sebenderang mentari Tapi tak akan redup karena malam Jangan kau menangis karena sepi Karena senyummu Yang kan membawaku Pada mimpimu Dan senyumku di sini Akan menemani malammu Malam Nyanyian kelukaan Setiap datang gulita malam Syairku melantunkannya Mengiring bait Yang menyayat hati Yang luluh terlukai Mungkin hanya sang pujangga Yang pergi menjerit dalam hatinya Merasakan kepedihan Yang menusuk sukma Luka yang tergores karena cinta Yang begitu menyesakan dada Wahai malam Tuntunlah penaku menulis syairku Syair yang tertulis berdasarkan kisahku Yang selalu terlukai Atas cinta yang membelenggu Mungkinkah hari esok akan ada bahagia Ataukah hanya goresan luka Yang slalu menganga.

Dalam jiwa yang hampa Mungkin hanya sang pujangga Yang pergi menjerit dalam hatinya Bersama udara dingin Membar malam berganti Seiring kelukaannya Bunyi hujan gemericik Di pelataran sunyi. Bernyanyi riang menimang gamang Akan rindu yang tiba-tiba hilang Ditelan hujan. Hanya sisa rasa yang hampa Diterpa bayu senja datang mentari pun redup semburat nya berwarna.

Dan aku hanya mampu menatap pilu. Membiarkan arus hujan Menghapus senja datang mentari pun redup semburat nya berwarna Hingga hilang tanpa bayang. T ermangu gagu Samarlah rindu Terguyur hujan sesaat lalu Tanah kuyup Tinggalkan sisa jejak Kenangan lalu Insomnia melanda, Mata cemerlang, hati terbang Pandang terus., terus memandang Jarak batas perspektif akal semakin runcing Disana, gambar nyata bisikkan suatu maksud Engkau, Menjelma dalam beratus rasa Senja datang mentari pun redup semburat nya berwarna dalam bayang Menyebar tatanan puzzle hati Bersinggungan tepat di pemberhentian kalimat akhir Seperti rembulan yang menggantung di kepekatan malam Aku, Menangkup rahasia sisa seberkas asa Terulur-ulur dalam gambar Kalikan ribuan rasa milikmu, menjelma menjadi tanya Merananya malam bersarang dalam jiwa Dengan takzim, setabah rasa tersampaikan padaMu Ya Allah.indahkanlah saja benak hatiku malam ini Aku-lah karang Yang tak akan lekang Di hantam ombok yang menjulang Desir angin pantai ku hirup Kala samudra mulai bosan ku pandang Tiupan sang badaipun datang Tunjukan amarah Berlantun pedih dalam tembang Kitapun berlabuh Menuju pagi yang indah membentang karena yang kita coretkan Hanya cerita mimpi di tepi j elah Sempat kukecap segala lezat nikmat Yang mungkin dan kini terhadap dunia yang ini, Kehilangan ingin secuil pun tak memberi puas Kutinggal bagai ampas.

Biarlah tersisa bagi mereka Yang terus merasa miskin. Kupilih buku sajak Lalu membaca hingga terlelap pulas Di bawah guguran bunga flamboyan Yang makin menderas. Fajar aku terbangun Mimpi telah sempurna Kudawaikan lagu rindu Nyanyian penantian Penantian rindu Yang tiada tepian Merindu saat bersamamu Rindu ingin bertemu Ku rangkaikan ribuan detik Di detak jantungku Untukku selalu sabar menantimu Resahku bila ku tau Tiada kabar tentangmu Sepiku rasa tiada canda tawamu Muram hatiku Bilaku tak melihat senyummu Bila kumampu Ku ingin sebrangi samudra Di hadapanku ini.

Hanya ingin ku temui dirimu Kau yang disana Apakah merasa Kala aku selalu merindumu Aku yang menanti Menanti datangmu Untukku semai rindu Rindu saat saat bersama Untukku semai rindu Rindu yang tiada berujung Dalam aksara bahasa sajak-ku Puisi yang kugoreskan Pada dinding-dinding bisu Kuhiba Kuharap Kumohon Bagai kuntum-kuntum mekar Pada kisah tentang sang bunga Kelopaknya ranum memerah rona Segar basah berlumur buliran embun Itu harapku disenja ini.

Saat malam menyapa Mengecupi dawaidawai kerinduan Yang senantiasa bergetar Seirama harpa ksunyian. Atau laksana biola Gesekannya mengalun indah Memecah hening malam Biarlah senja membungkus diri Sisakan cerita tetang bangau-bangau pulang Tentang sang camar Yang menjerit lalu hinggap diburitan Seiring jingga merona Seiring selubung warna tembaga Dan mentari separuh mengintip buana lalu hilang entah kemana Ini ceritaku tanpa belahan jiwa Yang tenggelam disamudra hari-hari.

Rindu ini smakin berpita. Menguntai bagai bulir prmata Menjadi kado manis Yang akan kubuka di mimpi nanti Senandung rindu ini takan pernah sumbang Meski terdengar diantara riuh angin malam Tetap bermelody pada janji Yang sudah terpahat dipilar hati Terukir bukan dihamparan pasir pantai Yang pasti hilang saat ombak mengecupi Terukir indah disini dipalung hati Bersemayam kokoh menancap kuat dijiwa Kebisuan kadang mncabik Hingga terburai rindu Yang selalu kurangkai lagi Kadang saat dera hari merungkup kita Aku tetap menanti Hingga batas sEnja bErganti malam Kau begitu brmakna Kau begitu istimewa Kau begitu baik Kau bgitu mnyayangiku Biarlah dingin menjadi bagian malam Tapi pelitahatiku tetap memberi hangat Hingga disudut-sudut ruang terdalam Biarlah embun menjadi cerita pagi Dan keindahnnya selalu mnjadi goresan puisi Tapi mentari tetaplah menghangati Meski kadang kabut tipis mnghalangi Biarlah smua brjalan ssuai roda khidupan Kuharap cintaku tetap indah hingga pertemuan Sendiri dilibas rindu Dalam imaji kata tak menentu Aku brdiri terpaku Diantara desiran angin Membisik lirih mengguris hati Menyayat angan meengiris rasa Hingga mnjadi serpihan-serpihan indah Mematung menatap senja Menyaksi bestari pulang Semoga tak mnggores kehampaan Kupadukan janjimu dibingkai rinduku Kulukis disapuan lembut kuas hatiku Memadu warna merah menyala Menjaadi bentuk sekumtum bunga Saat jemari tak berhenti Menata pualam rasa Memilih kata mnyusun aksara Memberi arti akan kesabaran cinta Aku diambang senja Masih berdiri dengan puisi Mengharap yang memang selalu kunanti Meski hanya sosok bayangmu Membawakan aku cahaya cinta untuk kau kalungkan didadaku Hingga ku tiada dalam gelap Tapi Benderang bersama cintamu Seraut wajah dalam dingin sunyi Menhan rindu yang mendayu Bagai getar hentak melody Tertawan waktu terkurung diri Dalam jarak rentangnya hari Taburan bintang-bintang malam Rembulan yang sembunyi dibalik awan Sahabatmu dalam tatapan merenda malam mengendap hening Dalam kesunyian Kau Merindu peri kecilmu Kau Merindu pujaan hatimu Kau Merindu tanah kelahiran Saat ini kau berada diperantauan Tembang puja kunyanyikan Kidung cinta kulantunkan Syair rindu kugoreskan Kupersembahkan untukmu sayang Walau disini Aku juga merasakan seprti yang kau rasakan Seprti hari-hariku Dalam senja yang berlalu Adalah permulaan siksa Saat malam aku menghiba Kapankah kita bertatap Melihat bayanganku dibola matamu Kapankah kita berdua Duduk manis diberanda Bersenda mengurai canda Bermanja di gelayut mesra Aku harap rindumu selalu ada Bagaikan hujan yang masih mrinai duluar sana Meski tebarkan dingin Tapi hangat selalu kudekap lewat bayangmu yang selalu melintas Membuat aku merasa dalam manja tilam sutra Dibelai lmbut dewi cantik bidari syurga Kuharap rindumu selalu mekar Bagai bunga mawar Diuntai gerimis senja Atau seprti ranumnya dipagi hari Dimanja embun-embun sebning hati Kini malam Kian menabur lembaran hitam Aku trcabik rindu Kuharap kau datang Hadirlah dalam mmpiku Patahan kata dalam bisu Menjelaga di altar sukma Rangkaian kata Cerminan hati dalam aksara Dingin bersama angin Hening bersama pekat Aku tak bisa Menjawab yang kau tanya Terlalu dini Terlalu pagi Setelah kau porak porandakan hati Lukaku masing mengangga Darahpun masih mnetes Rasanya kau tak bisa lagi Merajut asaku Apalagi kau renda Karna benangnya telah lah rapuh Merambah sepi Dihening malam Rantau jiwaku melalang Digulita kelam Jerit lirih Dari sanubari Mendesah gundah Laraku diam Membekap gelisah Dipematang sunyi Kusaapa rembulan Tampak temaram Atau pijar gemintang Bersenda diatas sana dgn riang berkejaran Ah .andai aku seperti mereka Malam beranjak menuju pagi Buliran embun Mengkristalkan hatiku Mulai samar lesap kabut Mentirai rasaku Kira-nya aku terjerembab Di rahim kesendirian Merenungku dalam diam Geliat hati Yang lelap merebah Angan melalang Menyusup diantara lesap Kabut samar menghilang Kurengkuh sejuk Yang tereduh Dari semilir angin Terkesiap dan terjaga Pagiku menjelang Dalam bingkai fana Kumulai langkah Menggapai asa yang tertunda Di ujung langit Bias rona menyembul jingga Bias mewarnai buana Memanjakan netra Pagi yang indah Suatu berkah Aku masih bisa menikmatinya Terimah kasih untukNYA Melarung elegi cinta Dalam bingkai suasana hati Menyusuri kilau kemilau Diujung langit sepi Kulukis sunyi Diwajah mentari Biasnya menyusup Direlung hati Jerit tak lagi bermelodi Lirih.

Menggema dalam sukma Berjibaku resah Gelisah tak berdaya Terpasung dibilik hampa Elegi cinta Tak juga terurai dengan indah Meresah. Di setiap lenguh nafas Kulihat bias Merona diujung langit Teratap jenggala Merintik dilengkung pelangi Pantulan aneka warna Pada bening lautku Indah tatapku Enggan berkedip Kutunggu kelebat rautmu Melintas diantara jingga Yang berbinar cahaya Melabur cakrawala Elok lautku berseri Sementara Dibentang cakrawala Pelangi masih terbingkai Berwarna warni Ada merah kuning hijau Mempesonaku Tak jua beranjak kumengintaimu Dibalik jendela biliku Indah pagiku Lepas tiada terlipat netra di gaung malam Terjagaku di hening bising lucuti jentikan kusam Ada saja noda Beraroma kebusukan Lantas harus bagaimana Sementara Tabuh syahdu di gapura rasa Lesat menuju sentuhan patwa paduka Rajam menikam tiada diam Si dia terus berkoar Biarlah Dirimbun lembah tiada beban sedang guyon sang camar tiada aku hiraukan Sepenggal malam Yang tersisa hari ini Ingin rasa-nya Kuurai kerinduan ini Sepi sebentar lagi menghadang Sebelum larut di senyapnya dini Bolehkah sebuah kata Ku ucapkan padamu Agar esok Apa yang terlintas dalam benak Tak sirna terbakar mentari Tak lenyap terhembus angin Hanya sebuah kata Kan ku titip Di sela jiwamu Di bilah hatimu Di rongga sukmamu Hanya sepatah kata Pengewajatahan dari siksa kerinduan Yang tersimpan lama dalam khayalku Pedih kian menyayat Saat dinding qolbu dicabik prasangka Tiada ada pembela rasa Tiada ada pula pembela tutur Meski lisan tak henti mengecap kebenaran Meski air mata tak henti bersimbah Namun semua itu tak jua mampu menyentuh rasa Yang telah terinjeksi virus prasangka Nanar netra-mu menatap Laksa raja singa mengincar santap Panas bara amarah-mu Seperti terik mentari Membakar peluh-peluh letih Rintih kian meralung Ketika tutur mencibir rasa Mengguratkan luka Pada dinding qolbu Memihak tapi kau tak tau siapa yang kau pihak Mencibir kau pun tak tau siapa yang kau cibir Hanya mendengar kebenaran dari sebelah pihak Hanya menerka tanpa timbang alasan Laksa hakim menjatuhkan vonis Ketuk palu tanpa telisik Keputusan penguasa tak bisa digugat Berujung jeruji besi Terpenjara hak asasi Torehkanlah senandungmu pada syahduku Atau pada pengeja aksara kolbumu Agar kidoeng cinta tetap berseru Dilapisan singgasana yang padu Seiring tanyaku diperaduan hitamku Di altar prasasti kelamku Dikuil agamaku tetaplah akan berseru Menjamu setiap tamu Mengayom para laskar jiwa tiada jemu Sedang lirihku tetap pada jamuan utamaku Walau senandungmu tiada lagi ku temukan titik temu Raab.

Demi asmamu Lebam mata saksi diri Aku mengharap kasihmu Tiada sudi legam hitam Kupapar kembali untukmu Tiada sudi aku hilang jati diri Untuk sekian kali atas ujianmu Bulir permata di awal surya menyapa Lebih cukup dari sebuah umpama kasihku Demi engkau. Pemilik rasa semesta qolbu Janganlah engkau tumbuhkan rasa baru Pedang lisan kirimanmu Cabik aku yg tiada pernah berpaling darimu Raab. Bulir permata bagai laut merah kuasamu Sanjungku di puncak peradaban hasratku Sudi kau pintal pada lembaran kitab doaku Lembar sastra satria terpinang sembilu Rabb.

Durjaku titik temu manak geni lebur sunyi Ratas menjulang nurani tersungging imaji Hanyut luluh lantah bagai sampah di ulu hati Rabb. Injit kecil terlalu genit Masih saja mencubit Lantas ku menjerit di naungan langit malamu Seketika melilit sukma nerakamu KetiKa rasa terbuncah Dan rindu kian membara Banyak hal ingin terucap Banyak hal ingin terungkap Begitu banyak rasa Yang bersembunyi Ingin segera tertumpah Harus kuakui Ketika ingin mengabarkan hasrat hati Tak ada tempat selain sahabat Namun ketika waktu berjalan tanpa koma Kuberfikir lagi Sahabat kian jenuh Mengenal letihnya diri ini Tak ada lagi yang harus terurai Sedang semu dan ilusi Masih saja mengikuti Adakah selain sahabat Tentunya ada Selembar kertas putih Dan tintah berwarna Hamparan duka atau suka Mampu tertuang Dan airmata Dapat kusembunyikan Ada yang bilang Pujangga itu munafik Ach.kurasa benar Namun kemana lagi Mesti kujabarkan Rasa yang terindah ini Hingga rentapun Tak sanggup berlama lama lagi Bahkan waktu Tetap saja meninggalkan Kekasihku Aku mencintaimu Dan beribu cara kulalui Meski duri tak luput terinjak Dan menepikan tangis dalam sepi Alam kebisuan malam Sendiri aku duduk terpaku Menatap gelap dan pekatnya malam Semilir angin berhembus mnghantar Dinginnya terasa menusuk tulangku Dalam kebisuanku diam tanpa kata Seribu tanya ingin ku ungkap Meniti kesunyian Dalam relung hatiku Entahlah Aku merasa sunyi Aku merasa sepi Sendiri menatap bintang dan bulan Yang enggan pula,menyapaku Malam semakin larut dan hening Tapi aku juga belum beranjak Ku rasakan kalbuku kian pekat Nyaris terasa kesendirian di hati Hampa dan kosong Ingin rasanya aku pergi berlalu Menghempaskan ragaku Agar sepi,sunyi,hampa Dan kelamnya hatiku Hilang dari hidupku Tapi aku.

aku semakin tak mampu Hanya bisa diam membisu Mendamba diantara getir Dan perih di jiwaku Yang sunyi dan kelam Senja berlabuh Suram alam maya Hening keheningan Kuning kemerahan Bening di kaki langit-NYA Berwarna jinga Berselang hiba membahang resah Di jiwa senja Damainya suasana remang senja Tenang seketika ketika surya membenamkan diri Menghilang cahaya Bersama malam yang menjelma Di ufuk timur hatiku terarah Merisik damai dambaan jiwa Damaikah aku?

Sedangkan hatiku Tercambuk resah Bernanar noda Tercucuk selumbar Hatiku terbakar Merah menyala Bak bara asmara terluka Menghiris pilu Kalbuku sengsara Jiwaku hampa Sulit untuk aku gambarkan kepedihan hati Kelayuan jiwa yang aku rasakan Titis noda Bersulam rona dendam yang membara Menyulam rindu hangatnya asmara Jiwaku hampa Umpama gelora samudera Dibadai tsunami senja yang menggila Tercambuk libasan kata Nista kian bernoda Berbirat merah berparut luka Kalbuku kian terasa Seumpama langit berbirat rona Berbalam kelam, di remangnya Semerah mentari berbirat jinga Di kaki ufuk senja Tiada seri walau bergema Sayatan perindu Harap lalu menjelma Kian meratap malam Yang hantar temaram Sang bunga hanya terbentang Harap dekap siang Malam terlalu kelam Lirih menyuat kerinduan Dendang buruan taman Suasana sepi merasuk Di dalam dinding kalbu Namun kian kelam Karena semua telah tertinggal Tak ada suara maupun tawa Penuh kesunyian Yang hampa mencengkam jiwa Meski Kaki seakan tertusux duri Karena harapan telah hilang dan mati Namun kan ku coba untuk bangun Dari mimpi buruk ini Yang selalu menghantui Takan prnh pudar atau pun menghilang Kilau cahaya terang yang menyelimuti hati Galih diri kian tegap pandang Rangrang buana daki dunia Perlambang manah sungguh menjulang harap Walau terkadang meratap Dalam cibir prasangka Akan ku kunyah saja Segala rasa yang ada Agar bersemayam Dalam setiap aliran darahku Hingga kau ketahui Saat kau teguk darahku Dari cawan yang kau sediakan Khusus untk menadah tetesnya Dapatilah smua rasaku Berbaur pada kantung nadi tubuhmu Apakah rasa itu hambar Ataukah manis Ataukah juga pahit Mungkin kau akan tahu Jika kau menenggaknya Penantiaku berujung ambigu Menuai sangsi jelajah emosi Menegur sapa pada sang petaka Memerahkan telinga Nanarkan netra Berseteru dengan waktu Yang smakin menyelam dalam Hingga rungu inderaku terganggu Sampaikan firasat tersirat melebur niat Atau sebatas nikmat sesaat Sekutuku hanyalah sekumpulan lontar dungu Yang setia menunggu coretan pena resahku Wahai bulan tetaplah tenggelam Bahkan sinarmu tetap saja padam Malampun tetap saja kelam Bintang itu hanya kiasan malam Hingga sang malam tetap saja temaram Apa yang kau nanti malam Bahhkan bulanpun enggan Bintangpun terpejam Hanya ada lolongan ajing malam Yang setia menemani sang Malam Bukanku tak rindu padamu Dihangatnya rasa yg bertaut Sungguh senandung lirihmu Laksa bayu tiupkan hawa nan sejuk Menelisik lembut kerelung Qalbu Gemulai tarian lintang Sukma alur berbias cahaya Membuka mata hati Merajuk sayu diantara bait-bait Embun pembasuh sukma Indah pandang terhampar Menyibak kabut Pada pekatnya dinding langit Sematkan pelangi Tuju puja sang pencipta.

Menguak jiwa kerinduan Menyatu diri kurung laku Sibak tabir nurani Ramahmu mendekapku pada geta tuju-Mu Lantun kidoeng mu Senandung lirih Gembala rasa musafirmu Pada dinding-dinding cahaya Kepakan sayap keindahan Tersemat santun memapah langkah Dalam senyuman yang selalu tersungging biar kusemat bulir kesejukan Dalam hatimu Akan kulayarkan Sauh hikayat Tentang kerinduan Direlung terindah Pada rasa yang bertaut Hening berlalu Tiada jemu aku merindu Disekat ruang waktu tiada menentu Menjamu rasa dikala sendu Wahai rembulan hatiku Senja datang mentari pun redup semburat nya berwarna terangmu sinari gelap nya hatiku Malam ini tiada sastra tiada umpama seluyu mengadu pada rindu tertiup sang bayu Lantunan kidoeng Kerap kita dendangkan Bersama sebongkah gitar tua saksi cinta Di malam-malam yang istimewa Sentiasa gelak tawa hiasi beranda Guyon khas para satria Penyemat kinasih sastra Bersila di depan kita Guyon khas brata rama Tetaplah mengalun indah Di setiap jamuan Di pertemuan para satria Jemari ini Masih enggan tuk menari Setelah rentang menggurat Sepi dalam luka Ada cemas yg terutas Andai lidah kecap suara Aku tetap mengikuti jejakmu Saat poros bumi berputar Karena kuyakin Dalam keresahanku ini Tetap menempatkanmu pada langit hati yang sama Ada tarian luka Ada tarian bahagia Ditengah rintik hujan malam ini Yang menghiasi netra sayuku Dibalik selimut teman sejatiku Malam akan melumat senja Jinggapun kan segera sirna Tapi mendung tetap singgah Senja datang mentari pun redup semburat nya berwarna kan membasahkan jiwa yang hampa Akankah kau biarkan bulan Ketakutan karena ancaman oleh hujan Hingga suasana kian temaram Hampa lumat nalarku Hingga peka akan sunyi Kala simpul rembulan berseri Aku mencaci Kiranya rembulan Senantiasa puji aku yg telah luyu Malamku-malamku dihiasi sinarnya wlau kadang aku masih ingin berpegang pada gelap Yang akrab dengan kesepian Kini rembulan tak lagi ramah selalu termenung gelisah Dicekam oleh ketakutan Yang tiada berpangkal Dan tiada berhujung Marilah kita bersulang Ditarian malam Ambilah cawanmu Biarlah aku tuang air ibliz Biarkan jiwaku terjungkal Memuntahkan semua onak dalam aral Uratku lungkrah Karena beban menghantam jiwa Netra tak bisa memandang cahaya Gelap yang ada dalam sanubari Biarlah syahdunya alunan piano Menjadi penenang malam Simpony nada terindah memory lama Walau hanya sebuah kenangan Masih bisa aku khayal Senangnya ku lewati Masa masa bersamanya Biar ku sematkan dalam hati Untuk sebuah kenangan Kata dirangkai Bunga menghias bersatu Rajut indah terpadu Sanjungan hebat buatku melambung Apa daya diri tak bersayap Jatuh terkulai di lubang tanah Sungguh sangkur memadu Di racikan legam silam ku Aku menyatu Bersama sekutu waktu Di hujatan cintaku Di hinaan orang sekelilingku Tiada jemu aku mengadu Gurat aksaraku Hasil waktu di pinang sendu Diruangan hatiku Tak ada indah dipadu Hanya melara kucumbu Manakala hinaan menyapaku Hanya kidung kulantun sendu Bunga berputik Mekar indah pada masanya Harum ditangkai Musnah kala terpetik Hangat ramah surya menyapa Tebar cinta di palung rasa Bunga jiwa sentiasa bersahaja Putik di senja datang mentari pun redup semburat nya berwarna sibunga melenggik Lantas di belai sibunga terbuai Toreh imaji daki ijati Indah melambai daun kerinduan Mengobarkan semangat hati yang terkulai Rinduku tiada sekat jemuku Mendayuh ayu laksa bayu Menerjang karang Laksa ombak laut biru Tiada lapak sendu selain rindu Tiada jemu aku senantiasa merayumu Indah pagi Menuai aksara Bertitakan embun Menggores rindu Di semilir sang bayu kutitipkan Tentang suara hati mengalun merdu Kecup indah pagi ku untk dia Sang indah butiran salju ku Yang selalu temani aku Di setiap hembusan nafas Mengucap asma cinta Terlantun dlam bait indah mewangi Terpetik alunan rasa Mengemit kerinduan asmaradana Berjelaga di tiap detikan Alunan nada pagi indah untuk menyapa mu Sang kekasih hati Nun jauh di sana Apa kabar-mu belahan jiwa Di sini ku merindu senyum mu Prasasti keabsahaan Tercibir jenaka coretan senja Layu kelopak bunga lusuh Terbasuh alengka durja Layang selayang tiada hiber Kumelayang tegap kini Tunduk ragu tandang keinginan Senja kian menghilang Karena gelap mendekap semesta Junjung setia pecah Retak terurai Di natrat ikrar purnama silam Lirih tiada lagi kudengar Bahkan si manah jati Gonggongan terabaikan Tandu saja keranda Di ujung tepian telaga saksi cinta Ternyata nalarmu Tidak seluas rasa sang pengelana Tiada bisa kini terbungkam Luapan lahar amarah Telah gagahi singgasana kesantunan Patahan aksaraku Tiada akan pernah kau dapati Walau sampai didengus nafas terakhir Di ambang pagi Aku masih saja disini Mersakan sejuknya tarian embun Menikmati lembutnya hembusan sang bayu Di hamparan gulita Yang masih enggan beranjak pergi Meninggalkan malam Sementara.

Netraku yang tak sudi berdamai dengan kantuk Masih nanar menelusuri senja datang mentari pun redup semburat nya berwarna Pun resah'ku yang kian merengek manja Bersandar menghiba pada dinding qolbu Entah apa keinginan sandubari Hingga tanpa lelah Aku masih setia dengan kegelisahanku Dan tanpa jemu akupun rela bercumbu dengan sunyi Yang tak henti mendekapku Dalam mengeja perjalanan malam Awan Tak Berdawai Tak ada lagi semburat jingga Yang slalu mewarnai senjaku Beku.

kelu diam membisu Rinai hujan kini yang tersisa Membasahi bumi Menetes dr balik awan hitamku Aku terdiam sepi disini Tersentak tanpa kata Seakan dunia gelap oleh kabut Seolah cahaya hilang di telannya Aku mencintai bukan membenci Ketika ku coba memahami.

Apa arti cinta yang sebernanya Namun. kenapa luka yang ku dapati Ku coba kembali merajut Sehelai demi sehelai Ketika rajutan itu akan utuh Kau hancurkan Dengan sebuah silet tajam Kau sayat seolah tak pny rasa Aku hanya tertunduk terdiam Seakan pasrah dengan smuanya Karna.

aku mencintai Bukan aku yang di cintai Biarkan aku terlelap dalam peraduan Terasa begitu penat dikedua kelopak mataku Biarkan aku berbaring dalam damai Nyanyikanlah tembang-tembang sendu Dari goresan usangku yg telah lalu Yang mampu terbangkan segala mimpi bersama atmaku Jangan kau teteskan setitis air mata pun untukku Karena semua ini mungkin telah tertulis dikeningku Relakan dan biarkan aku pergi dengan senyuman Karena aku akan pulang kerumah keabadianku Hantarkanlah aku dengan doa-doa Agar segala siksa tiada kutemui dalam perjalanan Kusambut kematian itu penuh suka cita Bertaburkan wewangian bunga diatas pembaringan Meninggalkan segala aroma keduniawian Yang membuatku terjatuh, sengsara penuh derita Biarlah kerajaan fana menjadi tempat ku bernaung Dengan nyaman Lihatlah sayang Setiap kali senja datang Airmatalah yang menghadang Tersebab kerinduan kian meradang Sampai kapan perih ini kan terus merepih Sedangkan keanggunan cinta mu telah kupilih Pada butiran-butiran hujan semua tercatat rapih Tentang rasa ini, yang menghujam di hati pedih Selembar buku yang telah lalu terbuka Ada catatatan yg indah di sana Tentang arti sebuah kata cinta Memeluk mu di bawah temaram jingga Gemricik suara air mengalir jatuh Mengecup cadas terurai bias senja Keemasan tebarkan pesona Tentang rasa yang kian meraja Datang pulang sang camar bawa berita Ada cinta yang terukir indah disuatu senja Malam semakin larut Hanyut dalam hening sepi Terbawa arus kerinduan Mengalir jauh menuju tepi pagi Rembulan saga jatuh di telaga Pucat sinarnya menahan lara Dera kerinduan yang merajam dada Memerahkan jingga serupa magenta Dedaunan diam tak bergeming Burung malam lesu tiada bergairah Senja datang mentari pun redup semburat nya berwarna susana sepi kian parah Telaga bening memerah saga Pantulkan hati yang terdera lara Sayang Tahukan hatiku menjerit pilu Namun suara tertahan membeku Hanya desah resah terbawa angin merah Ceruk mata menitikan air mata darah Tak tahu apa yang harus kulakukan Tersebab semua diam dalam kehampaan Berdiri di batas ada dan tiada Menunggu sebutir keyakinan Di pucuk daun sebagai sapaan Ketika mentari mengecup pagi Masihkah ada.

Untuk ku, tempat berbagi cerita Hanya kita berdua tanpa ketiga Ku tak ingin berbagi cinta Meski sepenggalan waktu saja Tanpa dusta Masih kusimpan di sini Hujan yang kau jatuhkan di awal senja Di perbatasan kota Deras hujan kian meraja Dalam butiran-butiran itu Kau tulis sajak penuh gejolak Dengan tinta biru dari mata indah'mu Kau bahasakan ketulusan penuh kesetiaan Sayang.

Masih kusimpan di sini Tiap kali ku rindu pada'mu Kubuka butiran hujan itu Dengan penuh haru mengeja satu-satu Masih genap sayang. percayalah Tak satupun yang hilang Karena aku menjaganya Dengan penuh kasih sayang Derasnya hujan Tak sanggup padamkan nyalanya Kencangnya hembusan angin Tak bisa padamkan pijarnya Masihlah kugenggam cahaya ini Aku telah memprismanya Dengan ketulusan dan keikhlasn Senantiasa menjelma minyak zaitun Menjadikannya tetap berpijar terang Seterang purnama dikala malam Secerah mentari di pagi hari Akan kugenggam selalu Kemanapun aku pergi Tuk menerangi setiap jengkal langkahku Meski kau telah menyakitiku berulangkali Sebanyak itulah aku memahami Sebelum kata maaf meluncur Aku telah memaafkanya Karena aku nyata sayang kamu Engkau masih aku genggam Di bawah derasnya hujan Nyala mu memijar takkan pernah padam Ketika angin membadai Serupa mercusuar ku berdiri Memberi tanda melambai Bahwa aku masih di sini Kepada mu yang aku rindu Bersiaplah dengan bahtera baru Telah kau rakit dengan tangan yg sakit Dan kau tempatkan di atas bukit Mari kita arungi bersama Lupakanlah semua cerita lama Bahwa duka dan lara ini telah membeku Aku siram dingin salju keikhlasan Demi cinta Aku rela menderita Sebab aku mencintaimu karena-Nya.

Letih menapaki hari Memunguti jejak yang tertinggal Pada sebidang asa yang tersisa Adalah kamu yang aku cinta Merupakan ruh puisi jiwa Karena mu aku berdiri Menggores pena di dada bumi Aku menyayangimu Dalam ketelanjangan tulusnya hati Sepenuh jiwa yang hanya tinggal di ujung senja Hingga malam menjemput usia Dan ku katupkan mata dalam damai kasih Nya.

Kulelap dalam manja Berbaring dalam dekapmu Ijinkan aku berpeluk di dadamu Sandarkan kepala Agar tenang hati Yang bertubuh lara Belai hangat daku Dengan astamu Yang menghangatkan Ciumi aku dalam kasihmu Di kening dan pipiku Sayang Buaikanku dalam nasyidmu Agar lelap hingga esok Dan sakitpun hilang Lalu ku bisa menjamumu kembali Dalam bakti sebagai dewi Dari mujahid-mujahidah kita nanti,,amin Malam tak diam Gelombang kerinduan memecah Ketika airmata terurai di dada Hingga sesak terasa lenguh nafas Wahai airmata Menggenanglah engkau di telaga jiwa Kujadikan prasasti cinta Dalam seikat lantunan doa Pada sebait kerinduan malam Sayang.

Teruslah benamkan wajahmu di dada Basahi raga ini dengan tangismu Kujadikan sebait sajak doa Munajat cinta pada yang kuasa Wahai Rabb semesta alam Ku diam dalam untaian tasbih Menggelinding disetiap cecap lidah Menyerukan namaMu Dalam keaggungan malam yg kudus Sayang. Jadilah engkau madrasah tuk jundi-jundi kita Setulus rembulan ku kan selalu menyinarimu Sehangat mentari pagi kukan mendekapmu Selamanya. Mengapa tidak satukan saja langkah Dalam birama penuh gairah Genderang telah di tabuh Panji-panji illahi bherkibar Tegaklah.!

Mari rapatkan barisan Membelah hujan dan malam Tumbangkan nafsu syaithan Lihatlah Tataplah dengan mata hati mu Adakah diri ini berdiri dengan sempurna Aku adalah wanita dengan seribu luka Merejam dada tumpahkan darah saga Perih dan pilu menyelimuti hari Tapi aku mencintai luka Karena nya aku bisa kembali Menyeru pada Rabbul izatie Andai saja fikirku sama Pasti keraguan ini Akan melepaskan dekapannya Aku terlalu penat Dengan keadaan yang buram Ingin hari hanya menyembah illahi Aku wanita yang rapuh siapa yang mau memopoh aku Yang terlalu rentan Digundukkan beban Dan luka yang bertumpuk-tumpuk Aku adalah cahaya redup Yang tak mampu bersinar terang Langkahku yang gontai Mengalun penuh dosa Berteman dengan rinai air mata duka Senja meniupkan takbir Jingga merona di pelataran Dan mentari jatuh Di pangkuan samudera Duhai jiwa yang bersahaja Ambilah air suci Di pancuran illahi Mari kita satukan hati Agungkan asma-Nya Dalam kebesaran jiwa Dan malamjavascript:void(0) Sebentar lagi menghampiri Bila ingin menyendiri Ambilah sepenggal Waktu yang tersisa Uzahlah Berkhalwatlah dengan NYa Zat yang maha Suci Biar akupun mengerti Arti kesahajaan aksara Bahwa kita adalah sepasang kata Dalam sajak tanpa nama Hanya rasa yang ada Kubisikan pada rembulan Kemarilah dalam dekapan Mari kita merenda mimpi Di lembaran-lembaran awan Dan menjadikannya nyata Malam pun berbisik pada rembulan Mengapa engkau menitikan airmata Bukankah engkau telah di pangkuan samudera Bermanja dalam gelombang asmara Menepis ombak meriak di pasir pantai Masih adakah cahaya yang tersisa Hingga engkau mengais-ngais bumi Menyibak awan yang teduh dalam gendongan Seribu purnama menebar senyum Dalam satu kata berjuta makna
Kapanlagi Plus - Keindahan senja seringkali membawa kesan tersendiri di hati seseorang.

Kesan yang muncul bisa memicu perasaan bahagia atau justru menyedihkan. Oleh karena itu, ada sejumlah kata-kata senja sedih yang dapat membawa perasaan kalian merasakan betapa sedihnya hati seseorang karena kemunculan senja. Kehadiran senja yang sesaat memang tidak bisa dilewatkan begitu saja. Tidak heran jika cukup banyak orang begitu menanti datangnya senja hanya untuk menikmati panorama indahnya. Sayangnya, senja juga menyimpan makna mendalam di hati seseorang yang membuat mereka begitu sedih mengingat kehadirannya.

Kesedihan karena senja dapat muncul jika memiliki kenangan menyedihkan bersama seseorang. Selain itu, adanya pesan tersirat yang dibawa oleh senja melalui keindahannya memang cukup menyentuh perasaan. Maka dari itu, ada sejumlah kata-kata senja sedih di bawah ini menggambarkan kesedihan hati seseorang.

Berikut senja datang mentari pun redup semburat nya berwarna beberapa referensi, kata-kata senja sedih penuh arti mendalam telah dirangkum kapanlagi.com dari berbagai sumber. 1. Kata-Kata Senja Sedih Paling Menyentuh (credit: freepik.com) Kata-kata senja sedih berikut ini dapat mewakili perasaan kalian ketika memiliki kenangan indah bersama seseorang.

Sayangnya, kenangan tersebut membawa kesedihan di hati kalian yang mana tenggelam bersama matahari senja. Yuk simak, ulasannya mengenai kata-kata senja sedih paling menyentuh. 1. "Ada yang tak tenggelam ketika senja datang, yakni rasa." -Rohmatikal Maskur 2. "Senja tak pernah salah. Hanya kenanganlah yang kadang membuatnya basah. Dan pada senja, akhirnya kita mengaku kalah." 3.

"Kutunggu dirimu di bawah ungunya langit senja." 4. "Kata-kata senja yang terangkai lewat warna jingga di ufuk barat, adalah isyarat di mana aku menantimu tak kunjung lelah." 5.

"Jauh adalah ketika kita duduk bersebelahan di bangku taman menatap senja, tapi hati kita di bangku yang berbeda." 6. "Ternyata, bukan hanya senja yang dapat padam. Yaitu amarah, ketika pelukmu merengkuh semua peluh. Aku terasa seperti bayi kecil di dadamu." 7. "Aku ingin kamu saja yang menemaniku membuka pagi hingga melepas senja, menenangkan malam dan membagi cerita." - Boy Candra 8.

"Sama seperti matahari, tidak pernah membenci senja. Mengucapkan selamat tinggal ketika waktunya sudah habis." - Tere Liye 9. "Senja, kadang ungu cantik, kadang jingga keren, kadang hitam kelabu, tapi langit selalu menerima senja apa adanya." - Vatoben 10. "Ternyata dia bukan senja, semburat sinarnya tak hangatkan luka. Dia hanyalah angin yang sekedar singgah lalu pergi." 11.

"Sudah banyak senja yang ku lalui, namun belum pernah ku lewati senja yang membawamu kembali." 12. "Senja mengajarkan bahwa menanti itu tidak mudah, berjuang pun juga sama susahnya. Apalagi harus berjuang menunggu seseorang dalam ketidakpastian." 13."Melukiskanmu saat senja. Memanggil namamu ke ujung dunia. Tiada yang lebih pilu. Tiada yang menjawabku. Selain hatiku dan ombak berderu." - Dewi Lestari 14. "Jatuh hati pada senja itu sekaligus senja datang mentari pun redup semburat nya berwarna hati, karena ia hadir namun sudah diatur untuk pergi.

Kuharap kamu tidak begitu." 15. "Tuhan, bersama tenggelamnya matahari senja ini, redakanlah kekecewaan dan kemarahan di hati ini. Sabarkanlah aku. Amin." - Mario Teguh 2. Kata-Kata Senja Sedih Bikin Baper (credit: freepik.com) Sejumlah kata-kata senja sedih di bawah ini bisa bikin baper setiap pembacanya. Maka dari itu, melalui kutipan senja sedih ini mungkin saja relate dengan perasaan kalian. Misalnya saja tentang pesan sedih di bawa senja karena kehadirannya yang sesaat.

Langsung saja simak ulasannya mengenai quotes senja sedih di bawah ini. 16. "Senja mengajarkan kita bahwa apa pun yang terjadi hari ini pasti akan berakhir indah." -Shroe 17. "Senja selalu seperti ini.

Perlahan datang, lalu tiba-tiba hilang. Tergantikan keremangan malam, menyisakan kehampaan." - Suryawan W.P 18. "Karena senja tak pernah memintamu menunggu." 19. "Sekalipun hanya sejenak, namun senja pergi meninggalkan rasa hidup ini amat teramat singkat.

Titipkanlah asa." 20. "Walaupun aku bukan senja yang kau tunggu, aku adalah langit yang siap menemani hari-harimu." 21. "Hadirmu bagaikan senja menenangkan, meski hanya sesaat." 22. "Kebersamaan kita, sama seperti dua cangkir teh di saat senja, hangat dan manis." 23.

"Senja masih tak berparas bagiku, saat luka bergoresan di ulu. Laraku mengalir di hilir tak berhulu." 24."Hampa itu seperti langkah tak berjejak, senja tak jingga, dan cinta tapi tak dianggap." -Raditya Dika 25.

"Dibanding senja, aku lebih bahagia jika senyumanmu yang menghiasi soreku." -Yowesneh 26. "Senja begitu sama seperti dirimu. Datang membawa kabar gembira, pergi membawa luka." 27.

"Aku mencintaimu sebanyak hujan. Kau mencintaiku sesingkat senja. Seperti hujan, aku jatuh cinta berkali-kali. Seperti senja, kau jatuh cinta kemudian pergi." 28. "Bukankah kita hanya sebatas senja dan daratan?

Saling melihat tapi tak saling terikat, saling menatap namun tak saling menetap." 29. "Aku hanyalah kunang-kunang dan engkau hanyalah senja. Saat gelap kita berbagi. Saat gelap kita abadi." - Moammar Emka 30. "Walaupun aku bukanlah senja yang kau tunggu. Tapi akulah langit yang akan menemani hari-harimu." 31. "Gelisah, menampar tak basah pada senja yang bergeremis. Begitu keringkah ladang pertautan kita hingga tunas harapan enggan tumbuh lagi." - Moammar Emka 3. Kata-Kata Senja Sedih Ungkapkan Kerinduan (credit: freepik.com) Ada beragam pesan tersirat yang bisa kalian pahami tentang kehadiran senja.

Salah satunya senja yang membawa kerinduan. Kerinduan karena senja biasanya muncul ketika kalian memiliki peristiwa paling berkesan karena keindahan senja. Berikut ulasannya mengenai kata-kata senja sedih yang mengungkapkan kerinduan seseorang. 32. "Matahari tenggelam itu seperti masa kecil, dipandang dengan heran bukan hanya karena indah tapi karena ia datang sebentar." 33.

"Malam membuatku ingin menulis rindu, bukan untuk kau baca. Karena rindu yang sesungguhnya telah kau tinggal di tepian senja. Maaf. Kisah kita, sekarang sudah berbeda. Jadi jangan samakan dengan keadaan kita yang sekarang." 34. "Seperti senja yang setia menanti matahari menepi. Seperti itulah aku menantimu kembali." 35. "Jadilah seperti senja yang kehadirannya selalu membuat ketenangan dan kepergiannya selalu membuat kerinduan." 36.

"Memang benar, senja ibarat sebuah rindu. Selalu ingin bertemu meskipun harus menunggu terlebih dahulu. Karena senja dan rindu itu sama. Sama halnya dengan dirimu. Harus menunggu untuk mengecup rindu." 37.

"Akan tiba masanya di mana rindu tak lagi butuh temu, bukan pula termasuk hadirnya orang yang baru, namun hati yang telah beku; terlalu lama menunggu hadirnya dirimu." -Equeenta 38. "Cobalah jadi malam agar kau tahu rasanya rindu, dan jadilah senja sesekali agar kau tahu artinya menanti." 39. "Jika kamu merindukan seseorang, tataplah matahari sore. Kirimkan pesan rindumu untuknya lewat senja." 40.

"Kita memang ditakdirkan untuk jauh raga oleh jarak. Tapi, kita juga ditakdirkan untuk melihat senja yang sama tanpa jarak." 41. "Senja terlalu buru-buru berlalu, padahal aku baru hendak mewarnai langit untukmu dengan warna-warna rinduku yang selalu biru." - Firman Nofeki 42.

"Semerbak rindu kuasai udara panas ini. Senja pun ikut berdebar menanti beritamu tentang perang dan cinta." - Jerinx 43. "Walaupun terkadang dia pergi untuk menghilang, tapi tidak untuk senja. Dia pergi untuk berjanji akan kembali lagi." 44. "Terkadang senja mengingatkan pada rumah, pada orang-orang yang membuat hati kita rindu untuk pulang." - Iwok Abqary 4. Kata-Kata Senja Sedih Penuh Makna Mendalam (credit: freepik.com) Adapun kata-kata senja sedih berikut ini mengandung pesan mendalam yang bisa dijadikan nasihat bijak dan berharga.

Sebab jika diamati lebih dalam, hadirnya senja menyimpan beragam pelajaran berharga buat kalian. 45. "Setiap senja selalu menjanjikan kita awal yang baru." -Ralph Waldo Emerson senja datang mentari pun redup semburat nya berwarna. "Ingat. Setia itu memang sulit, tapi lihatlah jingga. Selalu menggenapkan warna nya, demi senja di setiap harinya." 47. "Ketika matahari mulai redup, sang awan pun dengan seksama jadi penguasa langit, terima kasih untuk hujan sore ini." 48.

"Mungkin hanya mereka yang bersyukur, yang mampu menyeka air mata untuk melihat bintang." - Fiersa besari 49. "Dengan menyaksikan, aku menyadari bahwa ada cara yang sederhana untuk kita berbahagia." 50. "Menunggu senja mengajarkan kepadaku bahwa untuk mendapatkan sesuatu yang indah dan berharga melalui jalan yang terjal dan waktu yang lama." 51. "Karena kehidupan itu adalah putih, bersih tak berwarna. Tinggal bagaimana dirimu menempatkan diri pada porsinya.

Dengan sesuai porsi dirimu akan merasa bahwa kau sudah bahagia atas segalanya." -Rabrindanath Tagore 52. "Menikmati duka yang kini kau rasa adalah sebuah asa yang tak kunjung ada, sebab kelak mungkin ia akan menjelma menjadi sesuatu yang begitu bermakna." - Karya Pemuda 53. "Kedatangan senja yang menenggelamkan matahari mengajarkan pada kita, bahwa segala sesuatu tak ada yang abadi." 54. "Senja mengajarkan pada kita, bahwa kehidupan tak selalu berjalan dengan cemerlang dan bersinar." 55.

"Matahari yang tenggelam akan mengajarkan pada kita, agar bisa menghargai apa yang diberikan matahari untuk kita." 56.

"Senja memang begitu indah, namun cahaya mentari tetap tak tergantikan, meski dengan lilin yang bersinar sangat terang sekali pun." 57.

"Di dalam dekapan sang senja, senja datang mentari pun redup semburat nya berwarna mengharapkan sebuah asa, yang dapat membuat semesta yang fana menjadi semesta yang penuh warna." 58. "Kenapa senja terdengar lebih romantis dari fajar? Karena perpisahan akan lebih mudah dikenang dari pada pertemuan." 59. "Di tengah angin senja yang mendesak, aku merasakan kekuasaan waktu, yang tanpa pandang bulu mengubah segala-galanya." - Seno Gumira Ajidarma 60.

"Aku melintasi kehidupan dan kala. Aku berlayar menembus senja. Kuberanikan diri menulis untuk mengabadikan momen hidup dalam lembaran kertas." - Iwan Setyawan Nah itulah 60 kata-kata senja sedih paling menyentuh, penuh arti mendalam dan ungkapkan kerinduan.

Kata-kata senja sedih di atas dapat dijadikan sebagai kata mutiara senja, quotes senja sedih, caption senja sedih yang bisa menyentuh hati pembacanya. Sumber: bola.com, brilio.net Yuk Baca Artikel Lainnya • 57 Kata-Kata Taaruf dalam Islam, Jalan Terbaik Menjemput Jodoh Tanpa Pacaran • 60 Caption Pemandangan Singkat Penuh Makna, Sumber Inspirasi - Bikin Postingan Makin Keren • 56 Kata-Kata Bijak tentang Alam Semesta dan Seisinya, Penuh Makna - Ingatkan Cinta Lingkungan • 75 Kata-Kata untuk Senja datang mentari pun redup semburat nya berwarna Tersayang yang Menyentuh, Penuh Ungkapan Kasih • 50 Kata-Kata Sedih untuk Suami, Ungkapan Rasa Sakit dan Kecewa Menyentuh Hati
Puisi Senja.

Situasi penuh makna saat senja adalah waktu yang sangat kita nantikan. Entah kanapa ketika senja datang, hati kita dipenuhi berbagai rasa seperti optimisme, romantisme, harapan, rasa rindu dan juga ingatan akan kenangan indah di masa lalu yang kembali datang.

Waktu senja adalah saat yang tepat untuk mengeluarkan isi hati kita lewat kata kata indah dalam bentuk puisi dan syair. Berikut ini adalah kumpulan puisi senja yang indah romantis dan penuh arti sebagai gambar perasaan kita kala senja datang. Silahkan disimak! • Puisi Senja Paling Indah • Senja Romantis • Senja Dalam Luka • Ikrar Senja • Kita Akan Bertemu Lagi • Kesaksian • Lenteraku • Sendu merindu • Senjaku • Puisi Senja Menyentuh Hati • Menjingga Bersamamu • Senjakala • Senja Yang Selalu Kunanti • Bingkai Senja • Menunggumu Dalam Senja • Ingatan Kamu • Aksara Senja • Senja… Bersamanya • Puisi Senja Penuh Makna • Renungan Senja • Senja Rindu • Yang Telah Usai • Rintihan di Ambang Senja • Senja Menitipkan Rindu • Swastamita • Hujan dan Senja • Hanya Angin Lalu • Puisi Tentang Senja Terbaik • Surat Rindu • Senja Membelai Jiwa • Aku dan Senja • Semburat Senja yang Syahdu • Senja Menjelang Malam • Senja Yang Sepi • Kita Akan Menjadi Hujan • Berkah Dalam Sehari Puisi Senja Paling Indah puisi senja Senja Romantis Puisi senja karya EM NurunNasrie Aku berjalan Di tengah padang Sendiri.

Angin meliuk-liuk Meniup ilalang Pasir, bebatuan Bermain tanpa batas Di langit indah Sekawanan burung pulang Kembali ke sarang Tempat menanti pasangan Aku mengaduh Duhai, Aku di sini Berkawan sepi Langkah kaki Semakin lelah bernyanyi Aku masih di sini Sendiri. Menanti senja romantis Mengisi hati… *** Senja Dalam Luka Puisi Senja Karangan Fie Asyura Ini sudah senja yang keseribu sayang Begitu usang kutanggung sebuah penantian Diam di sela angin yang bungkam Alam mematung menadah hujan Luka ini takkan sembuh sayang Terlalu dalam kau goreskan di hati kelam Membisu menatap hari semakin temaram Jingga bergeser memeluk malam Aku hanya bisa menuliskan beberapa aksara Menggumpal dalam kalimat menyapa Tentang rindu, cinta, dan airmata Di seberang malam kau akan merasa Entahlah, hingga kapan saya masih bertahan Bayanganmu tak pernah hilang Menyapaku dalam tenang malam Lembut, hangat menyatu dalam perasaan Aku ingin menutup senja di depan jendela Harapanku pudar dalam penantian sia-sia Bersama malam yang tiba dalam kerudung hitam Akhir penantian kuucapkan selamat malam *** Ikrar Senja Karangan Ikmal Wong Gendeng-i Rahmateallah Say … senja tiba lagi lihatlah, masih ibarat seribu senja yang berlalu kusektsakan ronamu di antara siluet jingga lalu, dengan sisa-sisa tinta semalam sebelum engkau tenggelam kubaitkan selarik puisi hati biarkan itu menjadi mantra penenang semoga malammu tiada mengerang Say … masih ingatkah pada ikrar senja ketika seutas mimpi mengikat kita menyatukan sukma dalam belanga rasa sampai kita tiada tanpa rupa tanpa warna selain serat-serat asa yang merenda pada jelujur siang juga malam Say bukankah telah seribu kali bibirku merapal ayat-ayat cinta tanpa mahkota seribu kali telah kauamini pula sematkanlah keyakinan kita hanya mengarungi samudera Tuhan kita hanya sepasang musafir cinta menekuri jalan seakan tanpa tujuan tapi membekal impian Puisi Malam say saya mencintaimu alasannya yakni engkau pendar Sang Maha Cinta merupa dalam paras perʌwan rupawan saya mencintaimu bukan pada rupa-rupa penggoda tapi alasannya yakni engkau hakikat cinta yang berkilau *** Kita Akan Bertemu Lagi Tepat di luar matahari terbenam Seseorang menungguku Tepat di luar matahari terbenam Itu adalah takdirku.

Di mana gunung nampak ragu Berbaringlah dalam ketenangan yang dalam Di sana saya akan menemukan harta karun itu Cinta selamanya, kekal abadi didalam hati Tepat di luar matahari terbenam Menunggu seseorang dalam rindu Tepat di luar matahari terbenam Sendirian mereka menunggu di sana Tepat di luar matahari terbenam Itu rumah bagi saya Di mana dunia ini damai Seperti surga seharusnya Tepat di luar matahari terbenam Suatu hari nanti, Kita pasti akan segera bertemu lagi *** Kesaksian puisi senja Puisi Senja Agus Safrudinnur Senja di atap langit mengerling mesra menyatakan kerinduannya kepada malam semoga segera tiba Ranting dan dedaunan melambai-lambai memanggilku segera menuju hening Hening mempertemukan saya dengan kesaksian perihal segala hal yang hari ini telah saya lakukan Lalu diam-diam apa yang sanggup kusembunyikan kepada malam Esok sehabis dini hari matahari kembali akan memberiku peran atau mungkin saya malah telah pergi dengan seluruh kesaksian selama hidupku Senja di atap langit masihkah akan mengerling mesra menatap seluruh kesaksianku Setiap hari menjelang malam senja selalu mempertemukan saya dengan seluruh kesaksian Aku tak bisa berpaling semua arah seolah menampakkan cemas wajahku *** Lenteraku Puisi Senja Karya Indah Putri Lestari Piringan matahari hampir lenyap di tepi langit Berganti malam yang dingin merasuk kulit Kau bagaikan senja Yang datang sekejap membawa luka Katanya kau hadir bagai lentera Penyambung hidupku yang dirundung duka Melambunkanku di atas mega Lalu jatuh bersama rintik air mata Tak sempat aku goreskan tinta Tuk menuliskan kisah hidupku yang gelita Kau yang datang lalu hilang entah kemana Jauh di dasar sukma aku cinta Cinta yang menenggelamkanku Menghancurkanku Di saat detik-detuik berbahagiaku Kau meningalkanku Bodohnya aku yang dibutakan oleh rasa Merelakanmu pergi bersama dia Aku sendiri… Di penghujung September ini Aku rela melepasmu Mengikhlaskan kepergianmu Daripada cintaku dimadu.

*** Sendu merindu Pagi ini enggan rasa untuk bangun Ku buka jendela, masih banyak rintik hujan menetes di tepi teras ku Aku berharap matahari datang lebih awal Menyinari genangan hujan yang masih tersisah Merindu sungguh aku rindu Hatiku terasa sendu, pilu yang melengggu Kian memicu aroma tubuh mu di pikiranku Namun, aku tau itu telah berlalu Berlalu menyisakan kisah dan luka Membuat cerita di goresan luka nya dengan imajenasi di kisah nya Aku rela *** Senjaku puisi senja karya darma susila Ketika proses mulai menjadi angka Dan senja pergi meninggalkan mentari Tak satupun terlihat terang Begitupula di kejauhan Keheningan terbias dan menunggumu Namun senja tak pernah mengingkari kesepakatan pergi dan selalu kembali esok hari Tak pernah lari Selalu tiba sempurna waktu Menunggu mentari dan pergi bersamannya Tak kau sadari betapa indah hari itu Batapa indah ombak berderu Menyerbu bibir pantai Seakan membawa rindu yang hanyut bersamamu Puisi Rindu *** Puisi Senja Menyentuh Hati puisi senja Menjingga Bersamamu Puisi Senja karya Siti Nurlaela Sari Ada kata yang sulit terucap Ada bibir yang enggan bicara Ada rasa yang enggan tuk diam Ada rindu yang terus menguar Semua itu karena kamu Karena kamu yang kurindu Karena kamu yang kucinta Karena kamu rasa itu ada Kau tahu, Senja itu seperti kamu Tak pernah bisa tergapai dengan jemariku Tak bisa teraih oleh jutaan rindu Terkadang, Aku ingin seperti angin Yang membawa puing kenangan Yang membawa sejuta asa.

Aku ingin menjadi sejuta cahaya Yang bisa membiaskan keindahanmu Yang menjingga di langit sore Yang bersinar layaknya senja Tentu saja tak bisa Aku hanyalah aku Yang hanya punya kenangan biasa Yang kebetulan ada kamu di dalamnya.

*** Senjakala Puisi Senja Oleh WR Satu dua kata yang kuganti Tuk memanggil kembali Bait-bait kenang dalam simfoni langgam hati Bukan puisi, Tetapi rangkaian ujar berima sunyi Senandung elegi Satu dua ingatan pergi Bersama pupus ribuan denah mimpi Bukan puisi, Hanya dongeng angan yang begitu teringini Tak mungkin kembali Lantunan soliteri Dari bayang pantul bias asa Kupincing di antara sela, Celah cahaya di kiasan rona selaksa jingga Lembayung senja Puisi yang hasilnya pun merindu kata Dalam satu dua senyawa warna Di bait-bait cinta Lirik syahdu Memutik sendu Dalam ramainya sepi, Yang kurindu….

Tertiup bayu… Sayup-sayup hidup, Di memori kelu Ingatan lalu Yang kupaksa berlalu Hilang dalam memori berdebu Hening mendayu di ritme waktu Saat hitung laju tuju Dalam langkah seribu deru Bertajuk renung di relung qalbu Satu dua kekata… Menjelas perihal betapa, Berartinya makna… *** Senja Yang Selalu Kunanti Benar kata orang Ternyata pesonamu begitu melekat Benar kata orang Indahmu menyejukkan mata Benar kata orang Warnamu menenangkan hati Bahkan benar pula kata orang Ternyata hadirmu hanya sesaat Berulang kali kiranya aku selalu menantimu Sepulang dari kantorku Sepulang dari letihku Ku sempatkan untuk menjumpaimu Melihatmu membuat letih ini berkurang Memandangmu membuat mata ini berbinar Andai kau dapat ku simpan untuk waktu yang lebih lama Akan ku buatkan untuk mu tempat terindah di ruangku Agar tak terasa beban yang ku pangku Agak tak terasa resah yang menggebu Kau senjaku, yang selalu ku nanti *** Bingkai Senja puisi senja Puisi senja karya Zunainatul Khoiriyah Mengusung denyut waktu Pada senja kesumba kelam Di bawa barekasa alam Tertepi oleh gulungan obak Hanyut tenang bersama kenangan asa Mengangkasa pada bumantara Menyeruak mengukir kisah asmaraloka Atma terlampau bahagia hingga lupa pada sarayu menguliti daksa.

Keselarasan bermatrik rajutan kesemuan Keindahan buana membabat segala adorasi Hingga tertnggal bayang tengah bersusah hati Sungguh anitya lukisan keseimbangan Sedang nabastala tetap yang jadi saksi Hirap bagaskara sebab berganti petang Senja meramu anindya Mega kemerahan tawarkan dayahu candu Sekejap Tabir tak dapat abadi Mencipta pedar bakal lestari Berat otak sebabkan limbung Teriring beranjak pergi Sebab belukur luka yang sama Sebab senja yang kian memudar Kan tergantikan oleh shyam.

Puisi Alam *** Menunggumu Dalam Senja Puisi Senja Oleh Liontin sepi Tertembak amunisi waktu Menembus otak Iblisku! Jarahilah jarak yang menjarak Semakin meradang kaku Beku membiru Iblisku! Cepatlah hancurkan pemisah itu Cepatlah tiba bangsat Kusedang sekarat Berat! Mencintaimu haruskah melara hebat Sungguh merindumu laknat Melarilah cepat Merapat!

Mendo’a dalam empat roka’at *** Ingatan Kamu Puisi Senja Karya Rara Dianda Ku tatap senja dengan lekat sambil Menahan perih yang mendenyut di dada Bolehkan aku menyesal Telah mengenalnya? Bolehkan rasa cinta di hati ini tidak seharusnya ada? Atau bolehkan aku Memberontak marah pada Tuhan Karena telah menciptakan fatamorgana ini?

Jeritan perih sedari tadi menusuk hati Entah sudah berapa lama aku menatap langit Yang berawarna oranye ini Apapun yang kulakukan kuingin lupakan Tetapi sakit Yang menyayat hati Masih saja Tak bosan bersemayan di sana Langit yang berwarna kemerah-merahan ini Mungkin sudah bosan melihat guratan pilu Andai kau tahu bahwa melupakanmu Tak secepat langit indah ini menggelap *** Aksara Senja Bias jingga di ujung cakrawala Terukir indah dalam remang Lembayung menata warna Di garis lurus sang surya senja Embusan senja datang mentari pun redup semburat nya berwarna Membelai pucuk riak Berkejaran menuju pantai Menghempas di tepian karang Pecah berderai menciprak pasir Camar kepakkan sayap Terbang edari tiang sampan Memekik di antara desiran angin Lalu pergi tinggalkan jejak Redup lentera bahtera nelayan Datang menghampiri gelap Meninggalkan pesisir pantai Berharap anugrah akan datang *** Senja… Bersamanya Puisi Senja Karya Yunita Senja datang mentari pun redup semburat nya berwarna Senja… dia apa kabar?

Akhir kita bersua Dia memberiku tuba Menamparkan angin begitu kerasnya Senja… tahukah dia? Tentang rasaku padanya? Tenang indah kala menatapnya? Aku mohon beritahu padanya Aku tak tahu cara mengungkapkannya Senja… bantulah aku Semilirkan pesanku ini bersama angin Hembuskan rasaku tepat di relungnya Senja… masihkan sama?

Ada hanya sekejap Hadir antara dua kubu Lalu hilang bersama kabut Di akhir gelap september ini Masih pada rasa yang sama Tertampar gigil angin Teronggok senyapnya hitam Senja… beritahu padanya Ada pagi yang menyongsong malam Ada cahaya yang menjemput gelap Dan ada aku yang masih mencinta. *** Puisi Senja Penuh Makna puisi senja Renungan Senja Segurat tanda tanya yang tak kutemukan jawabannya Entah apa dan mengapa tak bisa kumengejanya Hanya rasa percaya dan positif yang sekarang kupunya Walau jujur ada rasa sedih tapi tak mau kumenduga-duga Tentang sesuatu yang tak bisa kuterka Apalagi hasrat untuk menebaknya Karena kubukan orang yang harus tau segalanya Disepenggal senja yang berarakan gulungan mega Kucoba menelusuri dan mengejanya Tapi…Tak jua sanggup tereja Pandanganku luruh dan tertahan sebab adanya Kopi yang sudah siap tersedia Tak jua sempat tereguk untuk menikmatinya Hingga hingga diujung saatnya senja tiba Masih tak tereja juga oleh pandangan netra Tentang saya yang mungkin tiada guna Yang hanya bisa sebagai manusia yang setia Saat gerbang malam mulai menjemputnya Lantas, setelahnya terabaikan juga Dan hanya renungan senja yang bisa kumaknai dengan nyata *** Senja Rindu Terus mencoba.

Membidik senja. Dicelah Siang dan malam. Menukil Indah karya Pencipta. Puisi Lucu Siapa yang bisa melarang. Aku Hanya merasa. Bukan merampas indahnya. Semua untuk dinikmatkan. Lepaskan diri dimakna. Benamkan Sekat cemas jikalau melanda. Yang terlihat. Yang Terasa. Hanya rahmat bermakna. *** Yang Telah Usai Hai jingga yang selalu kusebut senja Hari ini aku datang kembali Tetapi sangat berbeda Dengan penghujung september tahun lalu Jika tahun lalu aku bersamanya Memegang dan mengikat janji Sebagai senja saksinya Kali ini aku bersama rasa rindu yang menyayat pilu Harapan bersama sampai mati Terbengkalai begitu saja Bersama kenangan yang terombang ambing Menghanyutkan rasa Sayup-sayup kurasa batinku Berteriak lirih menentang yang telah terjadi Aku masih tak mengerti Mengapa kehilangan selalu menyambut di ujung jalan Senja, bolehkan aku menatapmu lebih lama lagi?

Sambil menikmati patah hati yang ia tawarkan? Tak apa, luka ini sudah terlanjur Terlukis aku terima resiko dari jatuh cinta Aku berharap jika tahun lalu aku bersamanya menikmati indahnya cinta Dan tahun ini luka menyayat, perih kudapat Semoga senja September tahun depan aku bisa mengikhlaskan Tanpa harus membencinya.

*** Rintihan di Ambang Senja puisi senja Masih ingin kulukiskan Beberapa hal yang bisa terkenang Kala kesepahaman kugenggam Seakan kebahagiaan kan selalu bertandang Kini cahaya tak bisa terlihat lagi Perjalanan pagi hilang telah selesai Senja pun pergi; usai Waktu berganti untuk kembali Bersama awan putih terbawa angin Luka lara, merintih ibarat kemarin Menghunus dada tersiksa lahir batin Akankah cintanya kembali terjalin Bila diri ini tak berarti lagi Biarkan! Dan relakan saya pergi Kepada Sang Pemilik Hati kukembali Kepada Sang Illahi Robbi kuberserah diri *** Senja Menitipkan Rindu Dikala jingganya senja selalu tertitip rindu pada perjamuan sepasang mata kita dimusim kemarin.

Akankah terulang? Tentang lirikan matamu yang indah, perihal canda tawa mu yang selalu berdendang diragaku yang tabah. Kini, semua tingallah kenangan dibatasan senja.

Kau telah hilang dan takkembali. Sajak-sajakku pun mulai rindu pada prosa hati yang merana. Kapan? Rinduku akan berlayar dinadihku. Sedangkan kau yakni belakang layar rinduku dengan sebuah cinta. Entah kapan? Akupun takmampu menapsirkan senja dan kesendirianku. Mungkin, ini yakni setingan darimu. Akupun taktahu menahu perihal itu. *** Swastamita Puisi Senja Karangan Syayidah Maulidatul Ulya Sekeping nurani mengacak diksi Mengais aksara merakit gatra Perihal aku terlalu keluh Tuk terucap sepatah kata September merakit temu Menyudahi pilu di penghujung kelu Jingga merangkak Swastamita meramu Resah senja datang mentari pun redup semburat nya berwarna dentingan Nestapa hampiri insan Pada penghujung pengabdian Senja menjadi kelam Ketaksaan riuh menggoyahkan Baskara berangsur madam Terpatri senja bagai saksi padam Akan aku perihal ditinggalkan Terlalu sukar kupatri rasa Sedang hati merosok tak sadar Berkeping pada arunika Sebab menapakmu perlu berlacak sabar Karam tak punya pijakan Aku tak mengerti seruan Sebab candala senja Mengoyakku menetap pada penghujungnya.

*** Hujan dan Senja Tabahnya rintik hujan yang turun Membasahi bumi yang penuh debu Meluapkan kegelisahan yang terpendam pada senja yng menggelut jiwa. Angin berbisik perihal rindu dan lirih Mencoba meluluhkan hati seorang yang dituju, senjapun takmau kalah pada permainan rindu yang dimainkan.

Puisi Guru Partikel-partikel yang merajut kehangatan Dengan gemerut jinggahnya senja yang menenangkan sepasang mata Ada kenangan yang tersimpan dibalik jeruji hujan dan senja. Senyum itu, Tawa itu, Selalu tergiang dalam bayangan Entah mengapa menemani kesendirianku dikala senja.

*** Hanya Angin Lalu Puisi Senja Karya Siti Nurlaela Sari Semburat jingga terbias di langit barat Matahari seolah melambai sebelum tenggelam Malam tiba tanpa perlu sepucuk surat Tanpa harus berteriak jua ke seluruh alam.

Angin betiup menerpa rambutku Dedaunan lunglai terbawa angin Menerbangkan puing-puing asa Berharap kenangan ikut terbang jua Namun, Sia-sia saja Tak ada yang kuat menerbangkan rasa ini Tak ada yang bisa hilangkan kenangan ini Mata cokelatmu yang terbias mentari Bibir tipismu melengkung tanpa henti Harum tubuhmu berbaur lembabnya bumi Kehangatan yang kukenang hingga kini. Sayang, Senja tak lagi indah tanpa hadirnya kamu Sore tak lagi hangat tanpa pelukmu Yang ada hanyalah rasa tuk menyendu Kini, hanya sepi yang kunikmati Waktu senja untuk menyendiri Dan kenangan akan hadirnya kamu Kuanggap hanya angin lalu Sukabumi.

*** Puisi Tentang Senja Terbaik puisi senja Surat Rindu Puisi Senja Karya Indah Putri Lestari Senja… Satu kata yang indah Satu kata sarat akan makna memandangmu aku terpesona Memori tentangmu berputar di kepalaku Tersimpan apik mewarnai hariku Apa kabar kamu?

Kekasihku… Jauh di lubuk hati aku merindu Rindu akan kehadiranmu Senyuman yang menghiasi bibirmu Selalu berhasil membuatku terpaku Hitam lengam sehitam suraimu Manik matamu seolah menghipnotisku Memanggilku tuk menyentuhmu Apakah aku tertawan cintamu?

Bulan September hampir berlalu Sepucuk surat mengunjungiku Adakah tanda kita kan bertemu? Aku sudah terlanjur rindu Surat balasan kukirim padamu Surat yang membawa serta hatiku Padamu sang penawan sanubari Aku menunggumu di sini. *** Senja Membelai Jiwa Puisi Senja Oleh Angalai Juani Mentari tersenyum indah menembusi bilik istana. Berkilau tajam silaukan tatapan mata. Menjilati mesrah sekujur raga lelah terbaring . Mengajak jiwa bercanda riang nikmati senja menutup siang…. Perlahan raga menggeliat hempaskan lelah… Netra samar menyapa senja tersenyum mesrah… Kaki melatah mencium aroma tanah buana.

Dendang kebanggaan dan syukur pada sang pencipta… Sungguh Agung dan mulia anugerahMU oh khaliku… Zejuk jiwaku dibelai tenang alam buanaku. Senja datang mentari pun redup semburat nya berwarna ada emas atau yg pantas kuberikan padaMU. Hanya Percaya dan Taqwaku bersinar cemerlang dalam jiwaku… *** Aku dan Senja Puisi Senja Oleh Yunita Malistiani Aku adalah senja Bagai memberi bahagia Selalu memberi cinta Dan seolah memupuk asa Pun senja adalah aku Hadir antara perbedaan Seolah memberi peringatan Tiba waktu pergantian Di penghujung September kering ini Senja selalu cerah Senja memberi cinta Tapi tak bisa memupuk asa Semburatnya nan jingga Berkelumat dengan hitam Membaur dengan gelap Lenyap bersama kapas Hadir dengan tangisan langit Bersua dengan ribut Bertanya pada senja Engkau kenapa?

Jingga yang menua Pada titik temu pergantian Memberi satu suara Aku sudah lengah. *** Semburat Senja yang Syahdu Layaknya lintang yang tersebar di galaksi belantara Lihatlah, nabastala terpampang nyata di depan netra Sekelilingnya, ada jumantara yang mengudara Seakan menunggu sang bangaskara yang ingin terbenam segera Puisi Persahabatan Tatapan netra beralih ke langit barat Menilik matahari seakan ingin mengucapkan perpisahan yang berat “Selamat tinggal?” Ataukah “Selamat menunggu untuk senja berikutnya?” Oh tuan, aku lengah Sungguh, retisalya kembali menganga Meluluhlantakkan secercah yang terpinga-pinga Pada semburat senja di penghujung September yang menelinga.

Lihatlah, pesona tuan layaknya senja Yang gata meninggalkan sang nabastala Kemudian datang saat dini hari Menjelma menjadi sang fajar yang menyinari Hei tuan, apakah ini terlihat antagonistis? Saya ingin bersikap apatis Perihal retisalya yang begitu traumatis Sebab, nostalgia tunjukkan asmaralika yang begitu anarkistis Mungkin, sudah saatnya untuk berdamai dengan senja Sebab, tak elok rupanya bermuram durja Cukuplah nostalgia ini bersahaja.

*** Senja Menjelang Malam puisi senja Puisi Senja Karangan Arang Menjelang malam Kunang-kunang bersinar Pancaran rindu Fajar menyingsing Malampun telah khatam Rembulan pulang Senja temaram Bergegas-lekas pulang Kumpul bersama Malam nan indah Langit berbintang terang Bulan merajuk Siang berawan Berwarna lazuardi Berarak-arak *** Senja Yang Sepi Di ujung senja Rintik hujan basahi Jalan terggenang Semesta sunyi Langkah langkah terhenti Tapak menepi Jiwaku sunyi Tanpa kau di sisi Bagaikan mati Hidupku tak berarti Tak bisa ku berdiri *** Kita Akan Menjadi Hujan Puisi Karangan Windu Setyaningsih tak kukira senja telah padam gelap tiba mendahului malam alasannya gerimis kehendak langit mendung yang memberat di angkasa pun keniscayaan tak perlu angin ditiupkan ketika ingatan jatuh bersama hujan biarkan titiktitik air merendam sisa kenangan dan membilas dalam derai derasnya di langit juga kulihat kilat menegas di balik awan menyerupai sosok ular yang mengancam dan catatancatatan samar antara doa, dendam dan kerinduan yakni mimpi jelek yang ditasbihkan saya kehilangan sebuah animo semi menghalau bayangbayang janjkematian menjelang, “haruskah kita berpisah dikala bunga hati berbuah, bukankah kau ingin kita menjadi hujan?” bersama menyiram kasih sayang *** Berkah Dalam Sehari puisi senja Setiap malam Cakrawala menyala Berputar merah muda di angkasa Memudar menjadi biru dan ungu Sedikit repot untuk melihat lagi Berkah Itu hanya datang sekali sehari Setiap matahari terbenam, Senja datang mentari pun redup semburat nya berwarna alam terasa berbeda Tidak ada dua yang persis sama Perbedaan mengalir sepanjang hari Untuk kita menemukan sosok jati diri Di atas lautan Atau melalui pencakar langit Keluar di padang rumput Atau di apartemen Kita masih bisa melihat sesuatu, Sesuatu yang tidak pernah kembali, Yaitu indahnya matahari terbenam Untuk warnanya berkilauan Sejenak mereka tinggal Hanya untuk menghilang menjadi perubahan Berubah menjadi indah yang terakhir.

Ini sebabnya Ke mana pun kita pergi Satu hal tetap sama, Matahari selalu terbenan dikala senja Tanda alam akan mengalami perubahan Senja datang mentari pun redup semburat nya berwarna gelap yang kelak akan berganti terang Nikmati senja dimana pun kita berada Karena berkah hanya datang sekali dalam sehari *** Demikianlah kumpulan puisi senja terbaik yang bisa menjadi bacaan kali ini.

Semoga senja dalam kehidupan kita selalu indah dan menarik. Terimakasih! Recent Posts • 23 Manfaat Buah Nanas Untuk Kesehatan Kecantikan dan Kebugaran • 28 Drama Korea Kolosal Tentang Kerajaan terbaik Jangan Dilewatkan • 15 Fakta Kerajaan Singasari; Sejarah, Raja, Masa Kajayaan, dan Peninggalannya • 15 Fakta Unik Tentang Korea Selatan Tentang Budaya • 30 Tempat Wisata Di Solo Yang Unik, Berwawasan, Menarik dan Inspiratif • 9 Fakta Unik dan Menarik Buah Apel Yang Menakjubkan • 17 Manfaat Buah Naga Untuk Kecantikan dan Kesehatan Yg Luar Biasa • 35 Lukisan Dan Gambar Pemandangan Alam Terindah • 25 Fakta Unik Tentang Jepang Yang Mengejutkan dan Memukau • 45 Kompilasi Gambar Bunga Terindah Beserta PenjelasannyaSenja adalah sebuah pembatas antara siang dan malam.

Senja adalah pemisah, agar keduanya tidak berjumpa. Senja, sebuah penanda berakhirnya cerita. Hadirnya seperti sebuah kata pinta agar sang mentari segera menggelamkan dirinya. Membuat cahaya mentari itu meredup dan membiarkan awan menjadi penguasa sang langit. Senja adalah satu dari titah-Nya, tak ada satupun yang dapat menolaknya.

Bahkan senja itu sendiri pun harus menerima. Hadirnya bagai pengundang sang pelukis dunia yang namanya tersohor dimana-mana, yang mampu melukis warna sang langit berwarna jingga. Hingga setiap mata yang melihatnya pasti begitu terpesona. 1. Aku pernah membenci senja, karena setelahnya hanya akan ada kegelapan dimana-mana Senja itu menjemput malam, dimana hanya ada gelap dan sunyi.

Dan aku membenci itu.

senja datang mentari pun redup semburat nya berwarna

Jika disuruh memilih fajar atau senja, tentu aku akan memilih fajar. Kau tahu alasanku memilihnya?

senja datang mentari pun redup semburat nya berwarna

Fajar itu menjemput sang mentari. Dengan anggunnya sang mentari terbit dan menghangatkan langit. Menyinari sisa embun di pagi, mengisyaratkan pada seluruh isi semesta untuk segera memulai cerita. Tentu, semuanya terang, bercahaya dimana-mana, bahkan sekecil apapun celah dari ranting pohon yang saling menyilang akan tetap mendapat bias cahaya.

Terbitnya sang mentari, pertanda dimulainya sebuah hari yang baru. Segala canda tawa ceria anak manusia tak akan dapat tersembunyi di sana. Indah bukan? Dan senja? Bukannya aku benci.

Aku sedikit enggan memang dengan hadirnya. Mengisyaratkan berakhirnya sebuah cerita, menyisakan sunyi. Tidak ada cahaya yang begitu terang senja datang mentari pun redup semburat nya berwarna mampu menyinari bumi, hanya kelip lampu kecil yang seakan tak berarti. Tetap saja kegelapan pemenangnya, hawa dingin dan rasa sepi selalu hadir menemani. Menakutkan, mengharuskan cerita apapun harus tersimpan.

Entah cinta atau luka, atau bisa jadi kenangan. Dan membiarkanya menjadi penghantar tidur atau pengisi sebuah mimpi. Hingga datang lagi yang ku tunggu, fajar yang menjemput terbitnya mentari esok hari.

2. Senja menyadarkanku, bahwa terang itu tak selalu menemani Kamu adalah langitku. Langit yang selalu meneduhkanku, menemaniku kapanpun dan dimanapun aku berada. Langit biru yang selalu bisa menenangkan hatiku. Begitu seterusnya kamu jika cahaya selalu menerangi, akan selalu dapat kunikmati indahmu.

Namun hari tak selamanya siang. Aku terlalu nyaman hingga aku lupa jika malampun akan datang. Senjalah yang menjadi penanda. Katakan saja akulah mentari itu, yang jatuh cinta padamu hai langit. Seperti titah Tuhan, ada mentari, ada pula sang rembulan. Aku melupakan kehadirannya yang meminta senja menjemputku.

Ya, aku harus menenggelamkan diri agar sang rembulan dapat memikat sang langit, menunjukkan cahaya indahnya, rupa cantiknya, yang hadirnya selalu diiringi kelip bintang-bintang angkasa. Seperti itulah aku dan kamu, aku yang terlena dan terlalu nyaman akan hadirmu yang sekian lama menemaniku. Aku memang tak lagi peduli pada apa-apa yang menggodaku. Tapi aku terlalu dangkal untuk mengerti, bahwa banyak pula yang menggodamu, menginginkan hadirmu.

Dan kau peduli pada itu. Saat itulah kamu memilih pergi, seperti langit yang memilih rembulan daripada sang mentari. 3. Senja mengajariku menghargai rasa sunyi hadiahterindahadalahkesendirian via http://hipwee.com Sekali lagi, senja adalah akhir dari sebuah hari, membuat apa-apa yang telah terjadi menjadi sebuah rangkaian cerita yang terususun rapi. Seperti puzzle yang harus dirangkai agar terbentuk rupa yang dapat dikenali, kisah-kisah dihari itu yang akan menjadi kenangan dikemudian hari.

Senja yang setelahnya tentu sang malam akan tiba. Sang langit tak lagi peduli pada mentari yang telah pergi, sebab ia hanya peduli pada perjumpaannya dengan sang rembulan. Walau begitu, senja tak pernah marah, ia hanya sunyi.

Menyembunyikan segala ceritanya sendiri, etah bahagia atau luka. Ya, dari senja itu aku belajar menghargai rasa sunyi dan sepi. Tidak selalu aku akan bersama orang yang kupilih. Tidak selalu orang yang kupilih juga memilihku. Terkadang Tuhan membuat apa-apa yang begitu kita sayang pergi, bukan karena Tuhan tak peduli. Bukan. Tuhan bahkan lebih peduli melebihi diri kita sendiri. Pun dengan saat ini, Tuhan menghadiahkan kesendirian untukku, memberikan sebuah rasa sunyi agar aku menjenguk diri sendiri.

Agar aku peduli dengan diri sendiri. Aku mungkin tak sadar, aku telah terlampau mengacuhkan diri sendiri karena sibuk membahagiakan orang lain, terlalu sibuk mengkhawatirkan orang lain. Orang lain yang tidak lain adalah kamu. Dan sekarang, aku berhentikan menyibukkan diri untukmu.

senja datang mentari pun redup semburat nya berwarna

Aku hanya akan peduli dengan diriku sendiri. 4. Dan senja membuatku mengerti arti sebuah kata “rela” menemukansepertikehilangan via http://hipwee.com Seperti saat menemukan, kehilangan juga terjadi tanpa sebuah kata permisi Bagaimanakah definisi yang tepat untuk senja? Mentari yang meninggalkan sang langit ataulah sang langit yang meninggalkannya demi sang rembulan? Mungkin yang tepat adalah bulanlah yang memisahkan mereka.

Atau justru tidak pula semuanya? Semua hanya menjalankan titah-Nya tanpa penolakan dan tanpa negosiasi. Mentari bahkan selalu kembali esok hari setelah kemarin menenggelamkan diri, seperti selalu bersedia memaafkan meski berulang kali terlukai.

Senja membuatku paham makna dari kata “rela”. Bahwa apa yang ada bersama dengan kita, tak mesti selamanya. Semua ada masanya. Tanpa kita duga, tanpa kita pinta, masa itu akan tiba dan tidaklah sedikitpun kita dapat menolaknya. Siap ataupun tidak, kita tidak bisa mengaturnya seperti yang kita harapkan.

Seperti saat sebuah cinta membuat detak jantungmu berdesir, begitupun ketika kecewa menyeruak dihatimu, membuat sayatan yang begitu pedih.

Saat dihadapkan pada pertemuan, bisa jadi saat itu pula kita harus bersiap untuk kehilangan. Terkadang apa yang begitu kita jaga dan kita cintai adalah takdir orang lain. Dan senja membuatku paham apa itu rela. Dia yang selalu bersedia kembali meski terusir ribuan kali, ia menerima. Ia merelakan sang langit bersenandung dengan sang rembulan Jika kelak kamu adalah takdirku, kamu pasti akan dikembalikan padaku dengan cara yang begitu istimewa. Jika tidak, disinilah aku belajar melepaskanmu, menenggelamkan segala angan dan harapanku atas kamu.

5. Jangan bertanya kapan aku jatuh cinta pada senja, sebab kaulah yang paling tahu jawabnya kapanjatuhcintapadasenja via http://hipwee.com “Aku mencarimu, dan ternyata kamu di sini. Menunggu matahari menggelincirkan dirinya? Hm?? Aneh” “Jika kamu kesini hanya untuk memaki, lebih baik kamu pergi. Bukankah kamu memang suka meninggalkanku pergi?” “Maaf, aku merindukanmu. Tapi, ada apa denganmu?

Dan sejak kapan kamu menyukai senja? Aku tahu kamu, sejak dulu kamu tidak menyukainya” Haruskah aku menjawab pertanyaan konyol itu?

Kurasa tidak perlu. Untuk apa kau tanyakan padaku sejak kapan aku jatuh cinta pada senja kalau kamulah yang paling tahu jawabannya. Ya kamulah jawabannya, KAMU. Sejak kamu meninggalkanku pergi tanpa sebuah kata permisi, sejak kamu hadirkan dia dalam hatimu sebagai penggantiku yang bahkan masih menjaga ketulusan yang kuperuntukkan hanya padamu.

Sejak kamu tidak lagi menganggapku berarti. Sebab setelah kamu memilihnya, senjalah yang setia menemaniku.

Cukuplah dia menasehatiku dengan bahasanya sendiri, dan biarkan aku memahaminya dengan caraku sendiri. Biarlah aku menguatkan hatiku yang telah menjadi perca ini. Jangan kau buat aku sendu oleh kata rindumu. Bukankah kamu adalah langit yang meminta sang mentari pergi agar bisa bersama dengan sang rembulan? Dan lihatlah, mentari ini selalu menuruti apa maumu, demi kebahagiaanmu. Biar ku simpan rasa dan rinduku sendiri dan peruntukkanlah cinta juga rindumu itu kepada wanita barumu.

Yang demi dia kamu mengganggapku tiada. Bahagialah dengan apa yang kamu pilih, jangan lagi usik hatiku. Dan biarkan aku membahagiakan diriku dengan caraku sendiri. Aku tahu kata rindumu itu bukanlah berarti kamu ingin kembali. Atau lebih tepatnya, kamu rindu menyakitiku lagi? Terserahlah, aku tidak akan membalas setiap rasa sakit yang dari belatimu itu.

Aku pun tidak akan berdoa agar karma segera menimpamu. Tidak, aku hanya punya cinta yang hanya bisa mendoakan kebahagiaanmu, bukan melukaimu. Cukuplah aku serahkan segalanya pada Tuhan Yang Maha Tahu. Sebetapa banyaknya luka yang kamu beri, aku tetap berterimakasih pada Tuhan yang mengizinkan kita untuk pernah saling memiliki. Artikel Bermanfaat dan Menghibur Lainnya
Kumpulan puisi senja atau puisi tema senja.

Senja adalah kala susana atau waktu akan menjelang malam saat rona jingga yang indah berseri, ia seakan menyambut bergantinya hari dari siang menuju malam yang penuh mimpi dan kata yang mengurai walau tak bermakna, mencoba ciptakan rasa menjadi asa yang singkat sesingkat waktu senja.

Begitulah salah satu satu isi bait contoh puisi senja yang diterbitkan blog puisi dan kata bijak untuk Anda yang menyukai rangkaian kata kata puisi bertema senja. Ada tujuh belas judul puisi bertema senja diterbitkan puisibijak.com dikesempatan ini, semua berkaitan dengan kata senja dan cerita puisi tema senja yang selalu indah untuk di ceritakan dalam bentuk bait puisi, baik dalam bentuk puisi senja pendek seperti puisi tentang senja 3 bait maupun dalam bentuk puisi senja yang panjang semisal puisi tentang senja 5 bait ataukah puisi senja sedih.

Sebagaimana pengertian senja adalah masa terbenamnya matahari, Cahaya senja biasanya agak kekuning- kuningan ketika matahari terlindung bukit-bukit. Senja merupakan waktu yang indah, dikarenakan pesona cahayanya, suasana indah inilah yang biasa menginspirasi untuk menulis puisi tema senja. Jadi senja artinya suatu bagian dari waktu didalam satu hari, jeda diantara sore dan malam, senja merupakan pengantar siang kepada malam.

Senja hadir ditandai saat matahari telah menghilang, akan tetapi masih menyisakan cahaya yang berpadu dengan gelap, lalu muncullah cahaya berwarna jingga, senja pun juga hadir hanya sementara waktu, hal inilah membuat senja berbeda dengan waktu-waktu yang lain. Didalam hidup, senja dapat dijadikan pelajaran untuk berlaku tidak serakah serta santun.

sebagimana kita melihat senja dia selalu bersabar menantikan perjalanan matahari, dan ketika tiba waktunya, hanya sementara, namun dia tetap rela ketika malam mengambil waktunya. Kehadirannya yang tak lama tak pernah membuatnya mengeluh, kehadiran malam tak pernah membuatnya merasa kehilangan. Sedangkan kita manusia hanya mengeluh, ihklas pun sulit di terapkan dalam hidup, padahal semua yang kita cari hanya bersifat sementara yang kekal hanya amal perbuatan, maka kita sebagai manusia yang beriman, contohlah senja yang selalu sabar dan ikhlas menanti dan selalu ikhlas merelakan waktunya.

Begitulah kisah tentang senja yang dapat dijadikan sebagai contoh inspirasi hidup. dan dibawah ini adalah contoh puisi senja dan beberapa puisi bertema senja, diantaranya puisi tentang senja 5 bait, dan lain lain puisi tema senja. Kumpulan Puisi Tentang Senja - Puisi-puisi Tema Senja Waktu senja memang merupakan waktu yang indah bagai mereka yang selalu menantikan senja untuk menghabiskan waktu, setelah beraktivisa, senja memang waktu yang tepat untuk berkumpul, apa lagi ketika cahaya senja jingga nampak suasan senja seperti ini sangat indah dinikmati, sebelum senja menjelang malam.

Apakah di tempat anda sekarang sudah menuju waktu senja, sehingga anda sampai di laman puisi tentang senja ini, apakah sudah melihat senja. nikmatilah senjamu bersama contoh puisi senja dan kumpulan puisi senja sore yang dipublikasikan blog puisi dan kata bijak atau puisibijak.com di bawah ini.

PUISI SENJA Rona jingga yang indah berseri ia seakan menyambut bergantinya hari dari siang menuju malam penuh mimpi mengurai kata walau tak bermakna mencoba ciptakan rasa menjadi asa Berharap terbaca oleh warna indahmu. Datangmu sungguh kurindu Aku tak ingin mlm mengantikanmu Memohon menghiba adalah sia sia semua ini sudah sesuai kehendakNya Puisi SenjaLihatlah senja di ufuk sana,begitu indah dihiasi suasana alam henbuskan angin membuat daun nyiur melambai kegirangan bersorak gembira dengan gesekan daunnya mentaripun enggan untuk melewatinya terkesima dengan jingganya senja namun ia tak kuasa melawan kehendak yang kuasa malanggar garis yang ada keinginan hatipun kian sirna di buatnya se'iring angin berhembus dengan sayunya burung burung berbondong untuk pulang meninggalkan bayangan tak berjejak suasana pun menjadi sunyi sembunyi di balik sepi menata satu cerita menjadi kenangan dalam jiwa mempersatukan suka dalam duka,suram dan ke'indahan menjadi coretan lama di dalam kehidupan bintang pun mulai beranjak dari peristirahatannya bertebaran menghiasi malam dalam kekelaman mengantar sebuah kenangan yang di titipkan senja ketempat yang hakiki dalam keabadian, PUISI SENJA ITU masih ingatkah janji yang pernah kau ucap, ketika senja menebarkan warna jingganya, menyaksikan bait bait yang kau untai menjadi sya'ir yang begitu indah, yang membat senja datang mentari pun redup semburat nya berwarna burung terdiam sejenak, dalam kicauan yang sedang memanggil sahabat sahabatnya tuk kembali ke pesanggrahannya, anginpun membelai mesra suasana jingga, hingga tak satupun suara dedaunan terdengar membisik telinga dalam jiwa, itulah saksi janjimu yang merasuk bathinku, tak kan pernah ku lupakan sa'at itu, karna itu bagian dari hidupku, isi dari irisan jiwaku, yang membuatku mampu tegar selalu, arungi hudup karena janjimu.

PUISI DI PENANTIAN SENJA Diujung senja aku berdiri disudut jalan ini menatap camar yg berarak pulang wajah langit seakan memucat ketika sang angin terlepas dari pasungan Dijalan ini aku pernah memelukmu sampai sang senja melirik cemburu Dijalan ini.

aku pernah bercerita tentang kesetiaanku tentang penantianku Ditepi senja yg mulai beranjak pergi ini kutitipkan sepotong rindu Wahai senja katakanlah bahwa aku akan slalu menjaga rasa ini sampai aku tertidur pulas dipangkuan sang waktu Jambi 2014 By.Arie PUISI AKU DAN BIAS SENJA Tersamar bias diri mu akan angkuhnya pikiranmu Melupakan kisah yang terajut dalam benang sutra Terlempar bak bulu domba yang tak berguna Mengasingkan ku dari kedalaman sisi hatimu Hingga dalam keterasinganku Aku menyadari kau angkuh.

Kini… takkan senja datang mentari pun redup semburat nya berwarna ingat kenangan tentangmu Akan kulempar jauh kedalam sumur yang tak bisa kau gapai Agar kau mengerti sakit ya tak tergapai Aku dengn sejuta mahabbah dalam jiwaku Yang kau tampʌr pilu Aku dengan sejuta pengertianku Yang kau buang semu Kini akan kau dapati aku yang tegar akan cambukan hatimu Aku bisa tanpamu Berharap kau sadar akan egomu Berharp kau takkan kembali saat kau menyadari hanya aku di hatimu Aku dan bias senjaku Puisi Masih Alam Senja Karya : Senja datang mentari pun redup semburat nya berwarna Senja senyawa sore bernyawa menuju kegelapan hendak menuju malam Kegelapan tanpa bintang atas lain tanda tak hujan Sinar bulan terang benerang Menyambung malam gemerlap gelap awan Sepi sunyi tak pernah senja datang mentari pun redup semburat nya berwarna Karena binʌtang terus berbunyi Suara kodok dan jangkrik Jadi musik malamnya malam Malam malam terus berganti Berlalunya malam Mendatang mentari Pagi hari nan sejuk sekali Mentari terbit dari timur panas sekali Menyinari bumi menyemangati hati Manusia manusia sehat karenanya Ada energi hangat sekaligus semangat Oh itu lah alam Alam lama bergandengan Manusia manusia jadi teman dan kawan Menyambung kehidupan alam yang lama Alam hijau Biru laut Awan putih Hitam mendung Hujan bercampuran putih hitam warna awan Itulah warna kehidupan Itulah warna dunia Tak ada yang sama Akan selalu berbeda Purworejo, 25 Desember 2014 Puisi Seluet senja Oleh: Riyan Seraut wajah yang telihat sendu seakan sedang senja datang mentari pun redup semburat nya berwarna terpaku pilu.

Inginaku menyapa tapi hati tak kuasa. Karna rasa takut yang ada. Duhai sang wajah hapiri lah ak yang selalu mendambamu. Dalam setiap hebusan nafas ku. Puisi Rona Senja ingin rasanya aku genggam senja.

agar indahnya tiada sirna. saat sinar hangatnya menyapa raga. aku terbuai karnanya. burung burung menari dengan suka cita. daun daun pun bersemi bersama redupnya. tak bisakah waktu terhenti sebentar saja. agar bisa lebih lama aku menikmatinya. oh senja.engkau selalu saja membuai jiwaku yg lara. menepis segala kegalauanku akan fatamorgana nya dunia. kesahaja'anmu membuat aku ingin selalu bersama mu selamanya.

pasuruan,02/01/2015 Puisi Diujung Senja Yang Memilukan by: puisi ungkapan hati Aku yg menyedihkan Berjalan sendiri berkabut jingga Jerit tawa para pengelana meramaikan Namun aku disini pilu Senyap dengan tawa penuh tipu Diujung senja yg memilukan Aku liar mencari riang Hingga petangpun mulai datang Namun sayang Ia hitam tiada terang Mataku yang sembab Berlinang kesenduan didalamnya Ingin aku menangis Namun tanpa ku sadari air matakupun menetes Angin membuat mataku berair Dan aku benci Mengapa aku begini ?

Mengapa selalu ditempat ini? Aku sendiri tak ditemani Wahai sang pencipta kebahagian Berikan aku ketenangan Dalam kegamangan pikiranku sekarang Meski tanpa kuluapkan Kemelut hati yg berantakan Tapi kumohon. Jadikanlah tangis ini penawarnya Hingga tiada lagi sang gelap menjelma Berkuasa dalam jiwa. PUISI SENJA DI CILIWUNG Oleh : Adipati Senja di ciliwung Merah jingga hiasi angkasa Lalu lalang burung berarak sepanak pinak Menari nari dalam bingkai unggu Senja di ciliwung Hembus angin dengan sepoinya Perlahan memutus dedaun di tangkai Jatuh berserakkan penuhi tanah yang sedikit bergelombang Jejer pepohonan memagari tepian Sore di ciliwung Tetap setia mata tuk memandang Walau kini kau sudah hitam pekat Hamparan limbah plastik menutupi wajahmu yang dulu anggun mempesona Jakarta,2015 PUISI SENJA DALAM KERINDUANAdalah senja yang merona Meneduhkan seisi ruang jiwa Kala kau datang membawakan cinta Cinta yang kau benamkan dalam dada Bersemayam luluhkan segalanya Begitulah asmara kita Saat diriku dan dirimu dalam satu ikatan rasa Menggelora rindu tanpa batasan masa Hadirmu selalu dalam kegelisahan Saat hati merapuh tanpa sandaran Serupa bunga bermekaran Indah dalam dekapan Datang dan membayang dalam ingatan Seraut wajah penuh ketenangan Anggun kesahajaan dalam penantian Aku merindu dalam keremangan Kala senja akan berpulang Seperti diam dalam kehampaan Membisu dalam kegundahan Sementara resah itu mendekap jiwa Membelenggu batin yang tersiksa Saat kucari bayangmu diarsiran senja Menanti hadirmu sapakan rindu di balutan merah jingga Dan di sini aku melihat bayangan tentang kisah kita Di bangku tua yang pernah kita singgahi bersama Ada janji yang tetap terjaga Ada asa yang membunga Ada jemarimu yang merengkuh sukma Bukan merpati yang ingkar di setiap kata dan janji Bukan pula kenari yang tak lagi bernyanyi Bukan gemintang atau bahkan rembulan yang tak lagi menyinari Tak tergoyah secebis hati terberai linang gerimis di paras senja Meski menghilang warna pelangi di pelipis langit Lelah lampah tertepis sapaan angin sore Menyepoi sejuk membuai diantara pias senyum mustikamu Rona biarlah tak jingga di ambang petang berkalung mendung Hadirmu tersunting rindu yang mengembang di taman kalbuku.

by: trio wek wek PUISI SENJA Namanya senja. Ia sahabatku bercerita tentangmu Ku bagi tawa dan takut kehilangan pada lembayung itu. Namanya senja. Ia menjadi tumpuan sunyi dan sering ku lupakan ketika rinai mu berseri. Hingga sekejap senja menjadi gelap. Ketika aku di silaukan dalam asuhan cinta yang manja. Lalu senja menebar rona cerita. Dan merahnya senja menuntunku menghujami langit dengan do'a do'a. TpPandan_Jan2015 PUISI SENJA DI PENGHUJUNG JANUARI Kureguk segala gundah dalam hati Tak kubiarkan gelas-gelas jingga memecahkannya Pada pendaran petang yang sekian detik akan retak Sore merengkuh dalam pangkuan gulana Sesaat sebelum bintang malam datang mengeluh Pada sayap hitam yang menggulita Januariberujung seperkian hari lagi Kisah pun tak henti menutup pada cerita tulisan ini Yang sendu selalu mengantungi riasan paras kertas Jejak-jejak pun menjadi pengisi halaman sunyi Dalam vulome riakan aksara-aksara kecewa Kutabur kata-kata di penghujung bisu senja Secarik kalimat menghantarkan kudapan pandangan Pada lembar pias bola mata berkeringat sedu sedan Kulayangkan sehelai daun petang mengakhiri pintu kenang HONY Pelabuhan Ratu 290115 Puisi Senja Yang Tediam disini.

di senja yang terdiam ku menanti bersama berjuta harap menemani diantara diam berdiriku ranum manja mempesona warnamu wujud nyata perginya siang yang perkasa biduk telah pergi tinggalkan desir ombak menyapu pasir ku masih disini setia menanti kembalinya dayung yang mengayuh dari samudera di hujung sana wahai senja yang terdiam,, janganlah engkau pergi tinggalkan aku sendiri wahai senja yang terdiam,, jangan biarkan malam menakutiku temani aku.

31.01.2015 Shefty Puisi Senja telah berhenti menetes dari langit mataharipun hampir tak terlihat langit menjadi jingga dan burung kembali ke sarangnya suara adzan menggema dari berbagai penjuru memangil para umat islam untuk menjalankan perintah-Nya suasana di hari senja seakan melepas semua kepenatan setelah beraktivitas seharian dan suara seruan-Nya sebagai penenan jiwa PUISI SENJA MERONA Senjaku merona.

Diujung senja terhimpit malam. Terdiam dalam peraduan sang jelaga malam. Derai senja tak berperasaan. Menceking dalam hayalan kelam.

Tak seharusnya kau buai kn indah, kalau itu hanya ilusi semata. Kau tawarkan madu namun yang kudapati sembilu. Kau tawarkan mimpi indah namun nyatamu derita.

Kini kulelah tertatih diujung senja yang merona. Tak pernah kau senja datang mentari pun redup semburat nya berwarna bersalah dan kau pergi membawa sejuta luka. Kini aku hanya mampu menatap senja yan merona dan tak mampu berbuat apa- apa.

senja datang mentari pun redup semburat nya berwarna

Oh.senja yang merona akan adakah hari esok datangkan bahagia. #Angin Malem# Bppn 161114 Puisi Senja Karya : Hang Sengaja kutulis ini untukmu dariku Kau yang terindah dalam hidupku Kau yang termakna tak tergantikan Kan ada selalu dihati Matahari tenggelam seluruhnya Diganti malam dalam kegelapan Tak ada bulan atau cahaya Yang ada hanya hujan rintik-rintik Aku tertidur dalam musik alam Suara-suara alam terdengar indah Seperti kodok, jangkrik suasana alam desa Malam telah tiba mimpipun menyambutmu Oh senja aku masih cinta Tak akan aku ganti walau dunia adalah bayaran Senja oh senja selamat malam semuanya salam sejahtera buat kita semua Siapa?

Guru kita. Purworejo, 25 November 2014 ------- Demikianlah kumpulan puisi senja.Simak/baca juga puisi dengan tema senja yang lain di blog ini.

Semoga puisi tentang senja di atas menghibur dan bermanfaat. Sampai jumpa di artikel puisi bertema senja selanjutnya dengan Tetap di blog puisi dan kata bijak menyimak/membaca puisi puisi indah senja yang kami update, Terima kasih sudah berkunjung.
Kata-kata senja atau quote senja sore adalah salah satu kata-kata indah yang tercipta ketika senja. Setiap baitnya keluar dari dalam hati yang dipenuhi dengan cinta, kenangan, rindu dan romantisme lainnya.

Waktu senja yang tercipta ketika menjelang malam ini memang amat indah meski hanya berlangsung begitu singkat. Mungkin karena hal tersebutlah yang menjadikannya saat yang istimewa. Dan dari waktu yang singkat tersebutlah tercipta kata kata senja atau quotes senja dengan macam-macam cara pribadi menggambarkannya, tergantung suasana hati.

Senja selalu saja begitu, melahirkan kenangan, senyum, rindu, bahkan air mata. Qoutes senja di bawah ini bisa menjadi caption senja instagram singkat maupun media sosial lainnya yang mewakili perasaan dan suasana hatimu. Daftar isi: • Kata-Kata Senja Terbaru 2022 • Kata-Kata tentang Senja • Kata-Kata Senja Bahasa Inggris dan Artinya • Kata-Kata Senja Romantis Buat Pacar • Quotes Senja Sore • Quotes Senja dan Kopi • Kata Mutiara Senja Menjelang Malam • Kata Bijak Senja • Caption Senja Singkat • Caption Senja Foto Instagram • Puisi Senja Romantis • Puisi Senja Sederhana • Puisi Senja Bersamamu • Puisi Senja di Pantai • Puisi tentang Senja dan Kamu • Sajak Senja • Tentang Senja di Sore Hari • Kata-Kata Sunset • Penutup Kata-Kata Senja Terbaru senja datang mentari pun redup semburat nya berwarna 5 Maret 2022 Karena senja tak pernah memintamu menunggu.

*** Pada akhirnya senja hanya semakin menjauh. Namun ia tak pernah sanggup melenyapkan cinta yang paling diam dari pandangan mata, apalagi hati. Lalu aku hanya menunggunya saat magrib tiba. *** Senja tak pernah salah. Hanya kenanganlah yang kadang membuatnya basah. Dan pada senja, akhirnya kita mengaku kalah. *** Senjaku, mulai menepi. Ke peraduannya. *** Sekalipun hanya sejenak, Namun senja pergi meninggalkan rasa hidup ini amat teramat singkat.

Titipkanlah asa. *** Parade Senja Menggila. *** Malam membuatku ingin menulis rindu, bukan untuk kau baca. Karena rindu yang sesungguhnya telah kau tinggal di tepian senja. *** Lantas, ku lihat segelintir Jingga Melintas di hadapanku. *** Maaf.

Kisah kita, sekarang sudah berbeda. Jadi jangan samakan. Dengan keadaan kita yang sekarang. *** Saat itu, Hujan gerimis di kala Sang Dewi malam beranjak. Menjadi saksi. *** Bukan menolak. Hanya belum saatnya saja. *** Ingat. Setia itu memang sulit, tapi lihatlah Jingga.

Selalu menggenapkan warnanya, demi senja di setiap harinya. *** Jarak. Waktu. Cinta. Tunggu aku kembali. *** Terima kasih. Karena sudah kau pegang erat sukmaku di sana. Sampai bertemu (lagi).

*** Kita memang ditakdirkan untuk jauh raga oleh jarak. Tapi Kita juga ditakdirkan untuk melihat Senja yang sama tanpa jarak. *** Tanpamu aku serupa daun kering yang dilepaskan ranting, terbawa angin tanpa senja datang mentari pun redup semburat nya berwarna dan tanpa ingin. *** Mungkin kelak akan ada senja yang sepi untukmu, satu persatu kenangan mulai kau ingat, dan tersenyum ketika giliranku lewat. *** Senja mengajarkan bahwa sesuatu yang berakhir, tak selamanya tak indah.

Karena senja termasuk salah satu suguhan ternikmat yang disajikan. *** Senja tak pernah membenci awan kelabu yang sering menutupinya. Berhenti menjadi pecandu senja. Tidak ada apa-apa di sana kecuali romantisme berlebih tentang cinta yang tak sempat kau raih. *** Tak salah lagi aku selalu mengagumi senja. Senja cukup lapang untuk menampung gelap dan cahaya juga duka dan suka secara bersamaan. *** Biar lelah Tapi dia, tetap indah.

*** Senjaku; Selalu bermakna Apapun itu, Senja tak pernah memintaku, tuk menunggu. Itu saja. *** Senja. Perpaduan yang sungguh indah bagi alam semesta. Kata-Kata tentang Senja Mentari senjaku, pancaran sinarmu menyejukan kalbu. Entah, mata ini tak bekedip memandang sinergimu, dan kuharap kau ada selalu. *** Ada jingga yang tampak mesra melukis siluet di antara waktu dan kau ada di antaranya begitu indah. *** Dalam heningku menatap senja.

Di hati terdalam ada ruang yang sedianya untukmu. Terlalu mendalam kusimpan sendiri. Tak sepatutnya kututup dalam-dalam. Bila nyatanya kau akan ada di dalamnya, tiada cukup kata syukur kuucap. *** Cuaca di mataku dingin menatap kehilangan; lengan sehangat tenunan senja di pelupuk langit. *** Hangatnya rindu mulai mengadu-ngadu; secara teratur padu di kala senja yang kelabu; aku dan kamu kini jadi semu ketika terpisah oleh waktu.

*** Di sini aku berdiri. Di bawah dinginnya senja menghampiri. Merasakan goresan-goresan luka, mengingat kembali rangkaian rangkaian kata. Mungkin aku telah bisa melupakanmu, tapi tidak dengan rasa sakit yang kau beri untukku.

*** Semburat kemuning itu seperti memberi pesan pada hati yang masih bersandar di pohon gersang; jalanmu masih panjang, berbaliklah. Aku akan kembali ke tempat di mana kau menunggu. *** Kita dan rasa yang memudar di penghujung hari. Menuju masa di mana aku dan kamu yang tiada lagi berhubung kata “kita”. Engkau menuju pulang lalu perlahan menghilang. Hingga yang tersisa hanyalah rasa rindu yang kemudian menikam di pekatnya malam. *** Sabtu yang sama, terlalu gerimis untuk sebuah senja tidak mungkin kita bersama, walau doa kita masih senada.

*** Senja di perbatasan. Tepat waktu kembali ke peraduannya. Tak peduli orang lain yang masih terjebak dalam ambisinya. Pun tak peduli dengan orang yang mengeluh karena waktu berlalu cepat. Senja. Tetap menjadi umpama. Yang datang juga akan pergi. Senja kau tak pernah berbohong, kau selalu datang tepat waktu. Tidak seperti dia yang selalu hilang bersama ribuan pertanyaanku.

*** Karena senja praktis mengingatkanku akan dia dia yang seindah senja, namun juga sama singkatnya. *** Aku menyukai senja, karena ia seperti kamu, meski sebentar datang, namun hangatnya mampu memeluk hingga ke tulang.

*** Senja memang indah di awal tapi mengantarkan diri ini ke dalam kegelapan yang seram. Aku lebih suka pagi, karena pagi selalu mengantarkanku pada hal-hal yang baru dan membuatku lupa akan beratnya malam yang kujalani. *** Kata-Kata Senja Bahasa Inggris dan Artinya “Twilight fell: The sky turned to a light, dusky purple littered with tiny silver stars.” J.K. Rowling Senja jatuh: Langit berubah menjadi cahaya cahaya, ungu kehitaman dikotori dengan bintang perak kecil.

*** “Every sunset is opportunity to reset.” Richie Norton Setiap sunset adalah kesempatang untuk mengatur ulang. *** “Twilight drops her curtain down, and pins it with a star.” Lucky Maud Montgomery Senja menjulurkan tirainya ke bawah, dan menghiasinya dengan bintang. *** “Sunsets, like childhood, are viewed with wonder not just because they are beautiful but because they are fleeting.” Richard Paul Evans Sunset, seperti masa kanak-kanak, dilihat dengan penuh keajaiban bukan hanya karena mereka indah, tetapi karena mereka cepat berlalu.

*** “Sunset is a wonderful opportunity for us to appreciate all the great things the sun gives us!” Mehmet Murat Ildan Sunset adalah kesempatan luar biasa bagi kita untuk menghargai semua hal hebat yang diberikan matahari kepada kita. *** “I like that time is marked by each sunrise and sunset whether or not you actually see it.” Cahterine Opie Aku suka waktu itu ditandai dengan setiap matahari terbit dan terbenam baik kamu melihatnya atau tidak.

*** “How strange this fear of death is! We are never frightened at a sunset.” George MacDonald Betapa aneh ketakutan akan kematian ini! Kami tidak pernah takut saat matahari senja datang mentari pun redup semburat nya berwarna.

*** “Sunsets are my escape into the reality I want to continuously live.” Rachel Roy Sunset adalah pelarianku menuju kenyataan yang ingin terus kujalani.

senja datang mentari pun redup semburat nya berwarna

“Don’ forget: Beautiful sunsets need cloudy Skies…” Paulo Coelho Jangan lupa: Sunset yang indah membutuhkan langit mendung. *** “It is almost impossible to watch a sunset and not dream.” Bernard Williams Hampir tidak mungkin menyaksikan matahari terbenam tanpa bermimpi. *** Kata-Kata Senja Romantis Buat Pacar Kutemukan senja paling indah di matamu, kudapatkan senja paling merah di bibirmu.

*** Senja datang mentari pun redup semburat nya berwarna retak lenganmu burung-burung meruntuhkan bulunya. Dan jam pasir mengucur menuju senja, yang baka. *** Senja ini, kamu kecup bibirku sekali, dan manisnya melebihi kecap yang baru saja aku beli. *** Tanganmu seperti senja hilang cahaya, tanganmu seperti dua bayang bersilang di petang yang lengang. *** Hujan deras mengintip ke suatu senja yang tak biasa, tumbuh dari kedamaian dan senyum penduduknya. *** Apakah kautahu seperti apa tanah kelahiran air mata, kekasih?

Seperti senja saat tenggelam di pelupukmu yang senja datang mentari pun redup semburat nya berwarna. *** Senja mana yang paling kau rindukan? Saat kita bertemu, berdua, atau berpisah. Aku rindu senja sebelum kau ada di hidupku.

*** Diam mentari meredup pendarnya biarkan senja memerah jingga. Sejatinya cinta tak resah ketika perpisahan sementara ada. *** Tak ayal lagi, senja ini waktu yang sendu untuk menulis puisi: tentang kenangan dan rindu barangkali.

*** Senja larut, mari bersulang peluk. Sebab dahaga kita, adalah kerinduan; yang tak mampu dihilangkan dengan kata-kata. *** Percayalah sayang, kelak akan ada jawaban bagi doa doa kita, seperti camar yang bahagia pulang kala senja memanggil. *** Sejak kepergianmu senja kemarin, musim hujan belum berganti, dan dadaku telah menjadi danau tempat angsa angsa meneguk air mata.

*** Kadang kau perlu berada di ranah abu-abu untuk tahu sejauh hitam atau putih itu perlu. *** Hingga aku merasuk jauh ke dalam engkau, kata-kataku menjelma pondasi kalimatmu. *** Sebab, senja adalah doa-doa. Dari matamu yang kupu-kupu dan dari tanganku yang jaring candu. *** Caption senja romantis Kucintai kau seperti senja. Dengan keindahannya tanpa durasinya. *** Lalu pada bias senja yang mana kesedihan mampu kau sembunyikan? Ingatlah, rembulan selalu datang tepat di depan wajahmu. *** Senja larut, mari bersulang peluk.

Sebab dahaga kita, adalah kerinduan; yang tak mampu dihilangkan dengan kata-kata. *** Senja ini, kekasih, andai engkau mengerti: kalau rindu berwarna merah jambu, kautinggalkan di pipi kiriku. *** Padamu kukatakan senja ini begitu indah, seperti mataku yang tak henti mengagumi keelokan wajahmu.

*** Tak ayal lagi, senja ini waktu yang sendu untuk menulis puisi: tentang kenangan dan rindu barangkali. *** Quotes Senja Sore Sebab senja selalu ada bidadari tanpa sayap, yang selalu tersenyum manja, menyambut indahnya jingga. *** Senja mengajarkanku bahwa yang indah-indah bersifat hanya sementara, kusuka senja karena keindahannya tak ada duanya.

*** Senja dan rintik hujan, adalah hal yang menyenangkan, selain pelukan. *** Ah senja hampir saja tiba, suasana nampak sendu namun hati kita hangat. Seperti itulah temali kasih harusnya. selalu bisa membuat kesedihan tak pernah tumbuh dari sisi mana pun. *** Senja dan rintik hujan, adalah hal yang menyenangkan, selain pelukanmu.

*** Senja yang menakutkan; Bocah di ladang jingga Berparas nila Menanam semacam flora; Bunga trotoar Dipanggil paksa Oleh masa yang belum waktunya Wahai tuan dan nona Haruskah kita sewa hidupnya? *** Bangku panjang di ujung beranda, senja yang meremang, semilir angin yang menggetarkan dedaunan, adalah hal yang penuh kesenantiasaan, menunggu sebuah kepulangan. *** Sore dengan mendung di atap rumah, adalah waktu ternyaman untuk merebah, di dadamu segala keresahan musnah.

*** Mungkin senja pun tahu, bila apa yang telah, tak akan dapat kembali. Sekalipun camar-camar suarakan lagi, suaramu. *** Quotes Senja dan Kopi Semenjak kepergianmu, kopi yang kunikmati setiap sore kehilangan rasa. *** Rinduku ini, kekasih, manis yang kutuang dalam secangkir kopi. Jangan menangis, minumlah sampai habis.

*** Senja gerimis, saat yang indah untuk menghabiskan waktu bersama secangkir kopi manis, sambil mengingat kenangan yang romantik. *** Usailah segala letih di tengkuk jingga.

Rindu telah pulih lebamnya. *** Senja mana yang paling kau rindukan? Saat kita bertemu, berdua, atau berpisah. Aku rindu senja sebelum kau ada di hidupku. *** Sore mengulangnya lagi: sebuah senja yang menjadi asing tanpa pelukan kita. *** Pada akhirnya, senja meletakan segala ingatan yang tiada. Di debarku, kamu menjelma puisi paling nyala. *** Kala senja, camar mengepak sayap jingga-jingga. Melaju jelas menuju arah pulang. Sebab buah hati menanti di sarang.

*** Senja berjalan santai meninggalkan sore, pada detik waktu yang bisu, lengan kita, abadi saling menghangatkan. *** Gulali merah menyengat batas bibir, sedari menangis lalu hampa, bersimbah warna-warni senja, mengutuk serupa hati nestapa.

*** Senja ini, aku kecup punggung telapakmu, meresapkan rindu yang tadi siang selalu mengganggu. *** Di ujung senja, jejak kabut, tipis terurai hembus. Sehelai daun kering melayang, meninggalkan rindu putik yang kelak membuah.

*** Satu pelukan saja, katamu setengah merajuk. Dan purnama jatuh tergelincir di bibir senja yang pucat. *** Jatuh lagi, setetes, tempias sisa hujan di kaca jendela, senja ini.

Matahari meredup kuyu, langit hitam memalam. *** Senja dan sepasang kembang sepatu warna merah. Masihkah kelak merahmu terkecupi pada kelopaknya? *** Sayang, senja tak memudar hanya karena lengkung di bibirmu tetiba datar, dan airmata adalah hujan yang sempat berkabar. *** Bulan ini senja selalu mendatangkan dua hujan, air dan rindu sama-sama derasnya. *** Aku, selalu tak mampu mempuisikan hujan saat senja, sebab hujan saat senja adalah keindahan puisi tanpa aksara.

*** Kamu; selalu mampu membuatku menikmati senja di kedua pipimu. Merona malu-malu, membuatku makin tak menentu. *** Aku dan tawa telah lama bermusuhan.

Sekarang musim kemarau yang basah. Seseorang tak berhenti membuka keran di mataku. *** Yang aku rindukan kini; semebar jingga, senja melabuh dalam tirai malam dan sepatahan tulang rusuk yang menanti kembali.

*** Lihat sayang, jingga perlahan tenggelam. Semesta siap menyambut malam. Dan di hatimulah, aku jatuh semakin dalam. *** Kata Mutiara Senja Menjelang Malam Senja ini hanya sebentar; tiap adegannya, kamu jadi sorot utama.

*** Senja yang hampir pudar, ingin kugambarkan kekagumanku pada pendar-pendar kisah lama yang mungkin telah senja datang mentari pun redup semburat nya berwarna dan terlupa olehmu.

*** Meski senja tiba di ujung mata, rindu enggan tinggalkan kita, tak peduli dengan siapa menanti malam, rindu ini senantiasa menyapa. *** Yang perempuan lain irikan padamu bukan miripmu dengan ibuku.

Tapi teduh ayu senja ibu yang seteduh ayumu. *** Pada senja yang mana lagi aku mengadu, rindu semacam dadu, aku lemparkan dan bersauh di dada kelu. *** Senjaku berlari mengejar ketinggalannya, menyusuri setapak di tepian jurang menganga, di bawahnya riuh ombak berirama lara.

*** Kekasih, aku ingin merinduimu setiap hari, seperti aku merindui senja pada petang hari. *** Kelak, kita duduk bersama di selasar rumah, menikmati bagaimana mentari kembali ke peraduan. *** Walau singkat pertemuan antara kita, tapi rindu akan senja jinggamu telah aku semat di dada.

*** Bolehkah aku bertanya, duhai senja ? Apa yang membuatmu begitu merah; apakah cinta, atau rindu yang membabi buta. *** Kau dan senja adalah hal yang sama. Mampu menghangatkan dalam jarak yang begitu jauh dan hanya bisa dikagumi namun tak mampu dimiliki.

*** Akan ada suatu nanti, senja kita. Saat aku dan kau bersama dalam satu rumah. Menikmati ia dalam jingga yang memerah. Hanya aku dan kau.

*** Dalam bejana senja rinduku tetap terjaga. *** Di langitku senja kelabu. Seperti hatiku yang pilu merindu. *** Senja, ingin kumaki diri ini, sebab rindu yang selalu mencari masalah dengan hati. *** Tak kusesali siang yang berpulang, kutangisi; mengapa senja terlalu cepat datang, sedang rindu belum terbunuh sejak semalam. *** Jika kamu senja, maka aku jingga. Muncul bersama, hilang pun juga. *** Bolehkah aku bercerita sedikit padamu, jangan kau cemburu, karena yang ingin kuceritakan kerinduanku pada malam.

*** Rindu, sudahkah kau temui, indah puisi yang bertengger di langit senja. Karena rindu bukanlah beban yang harus menguraikan air mata. *** Mungkin senja kali ini tak seindah biasanya, tapi dengan dekapan hangatmu.

Semua terasa istimewa. *** Kata Bijak Senja Rindu ini berhenti padamu, setelah kulewati cahaya pagi, dan terangnya siang. Rindu ini berhenti padamu, senja. *** Senja itu serupa kau, meski keberadaannya tersapu hujan. Dia akan kembali pada masanya nanti, meluluhkan rindu dalam dada. *** Aku pasti tak akan pulang, seperih apa pun senjamu tenggelam. *** Rindu ini tak berujung, hingga akhir senja. *** Aku tak mampu berlisan menatapmu.

Hanya tulisan yang mengurai perasaanku. “Kamu indah sekali, SENJA” *** Senjaku abu-abu, karena langit sedang menyimpan kesedihan. *** Wahai dikau senja, mengapa hadirmu kerap sepintas berlalu. *** Minggu senja atau Senin senja sama saja, aku selalu rindu kamu. Tanya pada malam yang siap membekap tubuhmu. *** Aku mencintaimu seperti aku mencintai senja.

Sebab, tanpa senja tak kan mungkin ada pagi, harapan untuk kita bisa jumpa lagi. *** Senja penghabisan. Besok datang lagi kemari ya. Senja, aku sepi. *** Nikmati malam panjangmu, lalu rindukan aku untuk menemui soremu esok hari.

Pastikan, senjaku yang paling cantik di langitmu. *** Pada langit senja berpelangi, aku melihatmu sebagai hijau, bersamamu aku seperti di pulau, yang penuh tawa dan senda gurau. *** Biar malam mendekap sampai kau sulit bernafas, untuk kamu senja, aku selalu ada.

Ingat ini: aku dan kamu adalah senja abadi. *** Sampaikan salam terakhirmu untuk senja di hari Minggu. Dia akan terlelap senja datang mentari pun redup semburat nya berwarna sejenak, dan menemuimu kembali esok di penghunjung sore.

*** Senjaku tak pernah hilang, karena ia sudah kuabadikan. Tersenyum dalam setumpuk ingatan, berputar meski malam sudah menjelang. *** Aku kesepian di senja ini. Maukah kau menemani? Sekedar duduk berdiam disini, sembari membiarkan rinai hujan menari. *** Senja, kusampaikan kepadamu kisahku, kubisikan kepadamu kerinduanku.

Kini, kutanya kepadamu: Kira-kira kapan kita ketemu? *** Setabah-tabahnya aku tetap saja aku butuh kamu, senja. Kamu mengangguk setuju, iya setuju yang malu-malu. *** Senja, tak tahukah kamu hatiku gemas karenamu, apa itu menampakkan diri cuma sekilas. *** Memang begitulah perjumpaan, sejenak datang meninggalkan kenang.

Senjaku yang gugup dan lugu, makin membuatku rindu. *** Senja tak pernah malu berwarna, tak pernah bosan menghangatkan petang. Dia selalu datang, untuk mereka yang merindukan keindahan. *** Caption Senja Singkat Jikalau kamu rindu, juga belum berujung temu, lihatlah aku, di balik senja yang indah itu. *** Jangan jadikan alasanmu hilang karena kekuranganku. Aku ingin kau belajar bersama Senja, karena senja selalu apa adanya.

Senja tak pernah menjadikan kekurangan bulan sebagai alasannya untuk menghilang. *** Cakrawala. Bebas di atas langit sana. Tapi bukan berarti kau, bisa bebas dengan siapa saja.

*** Karena, senjalah yang mengajariku, tentang caraku mencintai dengan sederhana. *** Menangislah saat hujan, agar mereka tak tau bahwa kau sedang menangis, sayang. *** Berlarilah di padang rumput yang tinggi, agar mereka tak tau bahwa kau sedang berlari. *** Senja di hari ini, tidak terlalu tampak (indahnya). *** Apa gerangan dengan Senja? Cakrawala seolah ikut mengerut.

Seiring waktu yang berpacu, kebahagiaan itu kini sebuah rekaman. Aku berdoa, senja datang mentari pun redup semburat nya berwarna senja hari ini tetap indah. *** Caption Senja Foto Instagram Sahabat, berkenankah kaubagi RINDU-mu di antara labirin petang?

*** Adalah senja, tempat cinta berjumpa. Kita pernah berdiam di sana; tanpa kata, tanpa terkatakan. *** Senja; dan segala jingga di matamu; rinduku habis pada waktu, dan kata-kataku jadi batu; aku mencintai ketiadaanmu. *** Senja dan jingga kembali, padanya rindu diterakan puisi.

*** Mari kita mulai semuanya dari sini; sore berangin, langit warna tembaga dan udara yang tak lagi berbau hujan. *** Senja hampir matang, saatnya kidung cinta dikumandang, dari kalbu yang kesunyian.

*** Siapa memainkan harmonika, menutup tirai senja dengan kidung doa-doa? Napas penuh luka, berarak ke jingga-jingga. *** Senja itu anak kecil yang manja; tangisnya adalah gerimis, dan pelangi adalah pita berwarna di rambutnya. *** Senjaku remang, kidung-kidung alam menyuara dari bangau terbang, ayam-ayam kembali kekandang, malam hendak datang. *** Pada akhirnya kita hanya akan mengenang bait-bait kidung hati, yang mati setelah senja ini.

*** Gelombang adzan mendayu meminang senja. Di sanalah, Tuhan melahirkan segala rindu. *** Matahari ini kusimpan sebagai pembatas buku, kelak menjadi guguran kelopak bunga yang merindu dipuji-puji cantik kuntumnya. *** Puisi-puisi mendebarkan cahaya di atas sebilah doa.

Di sini, ada rindu yang mulai membaca arahnya. *** Tahukah Tuan, rindu ini riak yang digerakkan sekawanan teri? Makin senja makin bara.

Lebih pampat dari dada pelaut mana pun. *** Samar kulihat peluh sinar menggantung di punggung petang. Di atasnya rona RINDU merekah dalam ayunan. *** Senja yang asing, desau angin kering mengamini rindu menjelma mata lembing, sisi hatimu remuk sisi lain menolak takluk.

*** Senja nanti, kau akan mengerti. Bahwasanya rindu berwarna biru, meninggalkan lebam di dada kirimu. *** Senja dan sepercik syahdu, dari dalam hati yang merindu, bersamamu kualunkan tembang merdu, merayu ilalang sayu. *** Pada senja, aku bercanda dengan diam di bawah pepohonan kering.

Berharap kau datang membawa air kehidupan. *** Senja adalah nadir. Sampai di mana sang musafir, berjalan melintasi takdir. *** Senja lebur di teduh matamu, dengan kereta biru aku menjelajah setiap palung hatimu, menjemput anak-anak rindu. *** Kita berkelakar tentang senja yang memerah, seperti pipimu yang merona, ketika ciuman pertama kita.

*** Puisi Senja Romantis Semburat Senja yang Syahdu Layaknya lintang yang tersebar di galaksi belantara Lihatlah, nabastala terpampang nyata di depan netra Sekelilingnya, ada jumantara yang mengudara Seakan menunggu sang bangaskara yang ingin terbenam segera Tatapan netra beralih ke langit barat Menilik matahari seakan ingin mengucapkan perpisahan yang berat “Selamat tinggal?” Ataukah “Selamat menunggu untuk senja berikutnya?” Oh tuan, aku lengah Sungguh, retisalya kembali menganga Meluluhlantakkan secercah yang terpinga-pinga Pada semburat senja di penghujung September yang menelinga.

Lihatlah, pesona tuan layaknya senja Yang gata meninggalkan sang nabastala Kemudian datang saat dini hari Menjelma menjadi sang fajar yang menyinari Hei tuan, apakah ini terlihat antagonistis? Saya ingin bersikap apatis Perihal retisalya yang begitu traumatis Sebab, nostalgia tunjukkan asmaralika yang begitu anarkistis Mungkin, sudah saatnya untuk berdamai dengan senja Sebab, tak elok rupanya bermuram durja Cukuplah nostalgia ini bersahaja.

*** Aku dan Senja Aku adalah senja Bagai memberi bahagia Selalu memberi cinta Dan seolah memupuk asa Pun senja adalah aku Hadir antara perbedaan Seolah memberi peringatan Tiba waktu pergantian Di penghujung September kering ini Senja selalu cerah Senja memberi cinta Tapi tak bisa memupuk asa Semburatnya nan jingga Berkelumat dengan hitam Membaur dengan gelap Lenyap bersama kapas Hadir dengan tangisan langit Bersua dengan ribut Bertanya pada senja Engkau kenapa?

Jingga yang menua Pada titik temu pergantian Memberi satu suara Aku sudah lengah. (Oleh: Yunita Malistiani) *** Surat Rindu Senja… Satu kata yang indah Satu kata sarat akan makna memandangmu aku terpesona Memori tentangmu berputar di kepalaku Tersimpan apik mewarnai hariku Apa kabar kamu?

Kekasihku… Jauh di lubuk hati aku merindu Rindu akan kehadiranmu Senyuman yang menghiasi bibirmu Selalu berhasil membuatku terpaku Hitam legam sehitam suraimu Manik matamu seolah menghipnotisku Memanggilku tuk menyentuhmu Apakah aku tertawan cintamu? Bulan September hampir berlalu Sepucuk surat mengunjungiku Adakah tanda kita kan bertemu? Aku sudah terlanjur rindu Surat balasan kukirim padamu Surat yang membawa serta hatiku Padamu sang penawan sanubari Aku menunggumu di sini.

(Oleh: Indah Putri Lestari) *** Hanya Angin Lalu Semburat jingga terbias di langit barat Matahari seolah melambai sebelum tenggelam Malam tiba tanpa perlu sepucuk surat Tanpa harus berteriak jua ke seluruh alam. Angin bertiup menerpa rambutku Dedaunan lunglai terbawa angin Menerbangkan puing-puing asa Berharap kenangan ikut terbang jua Namun, Sia-sia saja Tak ada yang kuat menerbangkan rasa ini Tak ada yang bisa hilangkan kenangan ini Mata cokelatmu yang terbias mentari Bibir tipismu melengkung tanpa henti Harum tubuhmu berbaur lembabnya bumi Kehangatan yang kukenang hingga kini.

Sayang, Senja tak lagi indah tanpa hadirnya kamu Sore tak lagi hangat tanpa pelukmu Yang ada hanyalah rasa tuk menyendu Kini, hanya sepi yang kunikmati Waktu senja untuk menyendiri Dan kenangan akan hadirnya kamu Kuanggap hanya angin lalu Sukabumi. (Oleh: Siti Nurlaela Sari) *** Puisi Senja Sederhana Swastamita Sekeping nurani mengacak diksi Mengais aksara merakit gatra Perihal aku terlalu keluh Tuk terucap sepatah kata September merakit temu Menyudahi pilu di penghujung kelu Jingga merangkak Swastamita meramu Resah merompak dentingan Nestapa hampiri insan Pada penghujung pengabdian Senja menjadi kelam Ketaksaan riuh menggoyahkan Baskara berangsur madam Terpatri senja bagai saksi padam Akan aku perihal ditinggalkan Terlalu sukar kupatri rasa Sedang hati merosok tak sadar Berkeping pada arunika Sebab menapakmu perlu berlacak sabar Karam tak punya pijakan Aku tak mengerti seruan Sebab candala senja Mengoyakku menetap pada penghujungnya.

(Oleh: Syayidah Maulidatul Ulya) *** Yang Telah Usai Hai jingga yang selalu kusebut senja Hari ini aku datang kembali Tetapi sangat berbeda Dengan penghujung September tahun lalu Jika tahun lalu aku bersamanya Memegang dan mengikat janji Sebagai senja saksinya Kali ini aku bersama rasa rindu yang menyayat pilu Harapan bersama sampai mati Terbengkalai begitu saja Bersama kenangan yang terombang-ambing Menghanyutkan rasa Sayup-sayup kurasa batinku Berteriak lirih menentang yang telah terjadi Aku masih tak mengerti Mengapa kehilangan selalu menyambut di ujung jalan Senja, bolehkan aku menatapmu lebih lama lagi?

Sambil menikmati patah hati yang ia tawarkan? Tak apa, luka ini sudah terlanjur Terlukis aku terima rIsiko dari jatuh cinta Aku berharap jika tahun lalu aku bersamanya menikmati indahnya cinta Dan tahun ini luka menyayat, perih kudapat Semoga senja September tahun depan aku bisa mengikhlaskan Tanpa harus membencinya.

*** Puisi Senja Bersamamu Senja… Bersamanya Senja… dia apa kabar? Akhir kita bersua Dia memberiku tuba Menamparkan angin begitu kerasnya Senja… tahukah dia? Tentang rasaku padanya? Tenang indah kala menatapnya? Aku mohon beritahu padanya Aku tak tahu cara mengungkapkannya Senja… bantulah aku Semilirkan pesanku ini bersama angin Hembuskan rasaku tepat di relungnya Senja… masihkah sama?

Ada hanya sekejap Hadir antara dua kubu Lalu hilang bersama kabut Di akhir gelap September ini Masih pada rasa yang sama Tertampar gigil angin Teronggok senyapnya hitam Senja… beritahu padanya Ada pagi yang menyongsong malam Ada cahaya yang menjemput gelap Dan ada aku yang masih mencinta. (Oleh: Yunita Malistiani) *** Ingatan Kamu Kutatap senja dengan lekat sambil Menahan perih yang mendenyut di dada Bolehkan aku menyesal Telah mengenalnya?

Bolehkan rasa cinta di hati ini tidak seharusnya ada? Atau bolehkan aku Memberontak marah pada Tuhan Karena telah menciptakan fatamorgana ini? Jeritan perih sedari tadi menusuk hati Entah sudah berapa lama aku menatap langit Yang berwarna oranye ini Apa pun yang kulakukan kuingin lupakan Tetapi sakit Yang menyayat hati Masih saja Tak bosan bersemayan di sana Langit yang berwarna kemerah-merahan ini Mungkin sudah bosan melihat guratan pilu Andai kau tahu bahwa melupakanmu Tak secepat langit indah ini menggelap (Oleh: Rara Dianda) *** Puisi Senja di Pantai Bingkai Senja Mengusung denyut waktu Pada senja kesumba kelam Di bawa bareksa alam Tertepi oleh gulungan ombak Hanyut tenang bersama kenangan asa Mengangkasa pada bumantara Menyeruak mengukir kisah asmaraloka Atma terlampau bahagia hingga lupa pada serayu menguliti daksa.

Keselarasan bermatrik rajutan kesemuan Keindahan buana membabat segala adorasi Hingga tertinggal bayang tengah bersusah hati Sungguh anitya lukisan keseimbangan Sedang nabastala tetap yang jadi saksi Hirap bagaskara sebab berganti petang Senja meramu anindya Mega kemerahan tawarkan dayahu candu Sekejap Tabir tak dapat abadi Mencipta pedar bakal lestari Berat otak sebabkan limbung Teriring beranjak pergi Sebab belukur luka yang sama Sebab senja yang kian memudar Kan tergantikan oleh syam.

(Oleh: Zunainatul Khoiriyah) *** Puisi tentang Senja dan Kamu Menjingga Bersamamu Ada kata yang sulit terucap Ada bibir yang enggan bicara Ada rasa yang enggan tuk diam Ada rindu yang terus menguar Semua itu karena kamu Karena kamu yang kurindu Karena kamu yang kucinta Karena kamu rasa itu ada Kau tahu, Senja itu seperti kamu Tak pernah bisa tergapai dengan jemariku Tak bisa teraih oleh jutaan rindu Terkadang, Aku ingin seperti angin Yang membawa puing kenangan Yang membawa sejuta asa.

Aku ingin menjadi sejuta cahaya Yang bisa membiaskan keindahanmu Yang menjingga di langit sore Yang bersinar layaknya senja Tentu saja tak bisa Aku hanyalah aku Yang hanya punya kenangan biasa Yang kebetulan ada kamu di dalamnya. (Oleh: Siti Nurlaela Sari) *** Lenteraku Piringan matahari hampir lenyap di tepi langit Berganti malam yang dingin merasuk kulit Kau bagaikan senja Yang datang sekejap membawa luka Katanya kau hadir bagai lentera Penyambung hidupku yang dirundung duka Melambungkanku di atas mega Lalu jatuh bersama rintik air mata Tak sempat aku goreskan tinta Tuk menuliskan kisah hidupku yang gelita Kau yang datang lalu hilang entah ke mana Jauh di dasar sukma aku cinta Cinta yang menenggelamkanku Menghancurkanku Di saat detik-detik berbahagiaku Kau meninggalkanku Bodohnya aku yang dibutakan oleh rasa Merelakanmu pergi bersama dia Aku sendiri… Di penghujung September ini Aku rela melepasmu Mengikhlaskan kepergianmu Daripada cintaku dimadu.

(Oleh: Indah Putri Lestari) Sajak Senja Senja, kapan kamu berulang tahun? *** Senja kesekian tanpamu, dan aku masih sama; lelaki yang lupa cara berbahagia. *** Wahai senja, kutitip rindu untuknya, kuharap kau mampu sampaikan itu meski dalam duka. *** Maaf, puisi. Aku sedang menunggu seseorang. Ia membawa kata-kataku. Tepat di balik senja.

*** Senja bagai sayap patah yang tak bisa terbang di langit cerah, dan titik hujan mewakili segala kepedihannya. *** Ayah pulang membawa senja di punggungnya, dan di tangannya ada sekeranjang kata-kata untuk di masak ibu menjadi sajak. *** Lama sudah senja tak menyapa, mungkinkah ia tertidur pula, berlumur rindu yang penuh luka. *** Tak ada senja yang tak rasa kamu. Setiap senja selalu rasa rindu, harap temu, perihal kamu. *** Senja terlihat muram di matamu, Tuan, aku masih punya beberapa butir jingga, bolehkah kupasang di pelupukmu?

*** Merindukanmu itu sederhana saja. Matamu menjelma senja. Kedip yang manja, Serta tatap penuh sahaja. *** Seseorang pernah berkata, akan ada ribuan puisi yang terlahir dari rahim senja. *** Ada bait-bait syukur yang tersamar, di antara kelepak barisan camar yang menuju pulang — menuju senja. *** Petang belum datang.

Tapi senja sudah lebih dulu muncul di kening ibu yang makin hari keriputnya makin menjadi. *** Senja di matamu sedang menafkahi rindu. *** Mestinya pada senja yang begini jingga puisi biasanya menemukan tempat untuk bersandar, bukan pada bahuku tapi pada rindumu.

*** Aku menemukan sajak yang terjatuh di halaman rumah. Kupungut dan kupakaikan baju senja agar kelihatan cantik dan mewah.

*** Senja tak pernah berubah, selalu bahagia temani jingga berkisah, meski tugas berlimpah, tak kan pernah halangi cinta meruah. *** Senja selalu sama, aku kadang membayangkan ia dirimu, kadang pergi saat rindu menggelora atau kembali ketika tertikam sunyi. *** Senja, persimpangan jalan depan rumah; riuh itu bukan hanya deru motor dan nyaring klakson tapi juga cerah dan tanggal muda.

*** Senja yang hening. Anganku berkelana, bagai kuda tak berpelana. *** Saat hujan dan senja bersekongkol dengan waktu, sekeping sajak diam-diam menyelinap menghunus tajam kata, membunuh rindu. *** Senja, pulang yang berulang. Rindu berhutang cerlang, bola mata yang terpejam. PadaMu lah itu rapuh seluruh – TUHAN. *** Tentang Senja di Sore Hari Kalau sore ini aku bahagia, itu karena kamu membagi cokelat yang tadi kubawakan untukmu.

*** Kasihku, tak cukup bahasa menafsir sebuah cinta. Sebab sebentar lagi, kita akan menjadi bayang, setelah matahari tenggelam. *** Sore ini di atas mega kau berpijar. Jinggamu berbinar, keindahanmu kutatap nanar. Rinduku padamu telah terbayar. *** Rinduku terhenti pada ujung sore di Seninku.

Kau tersenyum padaku melalui senja. Kau memelukku lewat udara. *** Aku tak butuh sore untuk menemukan indahnya sang senja. Dia akan muncul di pipimu, saat menyadari aku mengecupnya lembut.

*** Senjaku sore ini, berwarna kemerahan penuh hangat. Dia terduduk manis, membalas tatapanku yang memujanya. *** Indah, semata indah, esok dan hari-hari berikutnya jangan lupa menyapa aku. Janji ya, senja.

*** Petang, deras hujan; ada kenangan yang kuaduk perlahan. Di kepala seperti memutar kumparan warna yang selalu berulang. *** Senja selalu setia kepada sang sore. Menciptakan akhir petang yang indah di setiap mata umat manusia. *** Kata-Kata Sunset Saat matahari akan tenggelam, kenang aku sebagai jingga yang pernah memberi indah pada tubuh senjamu. *** “Instead of sailing off into the sunset, he hopes to sail into the next century.” Dave Anderson Alih-alih berlayar ke matahari terbenam, dia berharap bisa berlayar ke abad berikutnya.

*** “In the full light of day, I don’t want to think about the sunset.” Shakira Saat cahaya mentari sempurna, aku tidak ingin memikirkan tentang matahari terbenam. *** “Whenever you want to see me, always look at the sunsest; I will be there.” Grace Ogot Senja datang mentari pun redup semburat nya berwarna pun kamu ingin melihatku, lihatlah selalu ke matahari terbenam; Aku akan ada di sana.

*** “Clouds come floating into my life, no longer to carry rain or usher strom, but to add color to senja datang mentari pun redup semburat nya berwarna sunset sky.” Rabindranath Tagore Awan datang melayang ke dalam hidupku, tidak lagi membawa hujan atau badai, tapi menambah warna langit matahari terbenamku.

*** “The sky takes on shades of orange during sunrise and sunset, the colour that gives you hope that the sun will set only to rise again.” Ram Charan Langit mengambil nuansa jingga saat matahari terbit dan terbenam, warna yang memberi harapan bahwa matahari terbenam hanya untuk bangkit kembali.

*** “The biggest cliche in photography is sunrise and sunset.” Catherine Opie Klise terbesar dalam fotografi adalah matahari terbit dan terbenam. *** “Every sunset brings the promise of a new dawn.” Ralph Waldo Emerson Setiap matahari terbenam, ia membawa janji fajar baru. *** “There’s never one sunrise the same or one sunset the same.” Carlos Santana Tidak pernah ada matahari terbit yang sama atau matahari terbenam yang sama.

*** “The sky broke like an egg into full sunset and the water caught fire.” Pamela Hansford Johnson Langit pecah seperti telur sampai matahari terbenam sempurna hingga (warna) air bagai terbakar.

*** “Sunset is still my favorite color, and rainbow is second.” Mattie Stepanek Matahari terbenam masih menjadi warna favoritku, dan pelangi adalah yang kedua.

*** Penutup Kumpulan kata kata senja atau quotes senja romantis dan terbaik yang kamu baca di atas adalah tulisan yang diambil dari berbagai sumber. Jika kamu menemukan karyamu di halaman ini, silakan tinggalkan komentar ya, biar kami cantumkan nama kamu. Oh iya sobat, jika kamu punya kata kata senja yang keren, boleh dong dishare ke sini. Semoga tulisan ini bermanfaat dan menginspirasi kamu yaa.

😉

jalanan dibawah pancaran cahaya mentari senja




2022 www.videocon.com